LanC-like protein 3-like protein

Overview
NameLanC-like protein 3-like protein
Smed IDSMED30026858
Length (bp)1352
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LanC-like protein 3-like protein (SMED30026858) t-SNE clustered cells

Violin plots show distribution of expression levels for LanC-like protein 3-like protein (SMED30026858) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LanC-like protein 3-like protein (SMED30026858) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LanC-like protein 3-like protein (SMED30026858) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026858

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30026858SMESG000068028.1 Contig2424newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026858SMESG000068028.1 Contig2424uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026858SMESG000011835.1 Contig2424newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026858SMESG000011835.1 Contig2424uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30026858SMESG000025869.1 Contig5638GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026858SMESG000068028.1 Contig5638GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LanC-like protein 3-like protein vs. Ensembl Human
Match: LANCL3 (LanC like 3 [Source:HGNC Symbol;Acc:HGNC:24767])

HSP 1 Score: 262.692 bits (670), Expect = 7.916e-83
Identity = 162/416 (38.94%), Postives = 238/416 (57.21%), Query Frame = 2
Query:   35 STRHFSNDYEDKVLDLTSLDSSYLIEYSLN-ILNTCIKSLPPIAENED------------GGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            + R F+N ++D    L +      +   +   +   ++ LPP+    +            GGLY G  G+ Y L H+S SPL +  R + L  AK  I+       +  +   D++ +FLLG  G   VA  VY  LG  ++  Q   +F AL     P+     GSDELFVG+AGYL A  V+K   ++  L  A+  + SI  ++++SG+QYAIK+R   PLMYSYY TEYLGA HGL+ IL  L+ + ++L  +P+   ++ Q +D+++     N N PP   ++G      ++L HWCHGA G  Y +A AYL+  + +YL+  + CG + W+ GLLKKGPGICHGV+GS Y FLLLYRLT +  Y+ RA  F+ F+ ++ FK  +RV +S YSL+EG++GT CF+ DL  P
Sbjct:    3 TKRCFANRFDDYQGSLLAGQCEEAVAPLVTATIERILQELPPLGGGAEARGATAGASACQGGLYGGVAGVAYMLYHVSQSPLFATARERYLRSAKRLIDACAR-AEEWGEPDADTRAAFLLGGAGVYAVATLVYHALG-RSDYVQPLGKFRALCAVCAPVSFLECGSDELFVGRAGYLCAALVLKQKLAQEVLTPAQ--IKSICQAILDSGKQYAIKKRKPFPLMYSYYGTEYLGAAHGLSSILQMLLSYHEHL--KPSDRELVWQSVDFLME-QEQNCNWPP---ELGETIERENELVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVFLLLYRLTGNSKYIYRAQRFAQFLFTEEFKAGSRVLESIYSLYEGFSGTVCFLIDLLQP 408          
BLAST of LanC-like protein 3-like protein vs. Ensembl Human
Match: LANCL3 (LanC like 3 [Source:HGNC Symbol;Acc:HGNC:24767])

HSP 1 Score: 223.402 bits (568), Expect = 5.052e-68
Identity = 146/380 (38.42%), Postives = 212/380 (55.79%), Query Frame = 2
Query:   35 STRHFSNDYEDKVLDLTSLDSSYLIEYSLN-ILNTCIKSLPPIAENED------------GGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSF 1135
            + R F+N ++D    L +      +   +   +   ++ LPP+    +            GGLY G  G+ Y L H+S SPL +  R + L  AK  I+       +  +   D++ +FLLG  G   VA  VY  LG  ++  Q   +F AL     P+     GSDELFVG+AGYL A  V+K   ++  L  A+  + SI  ++++SG+QYAIK+R   PLMYSYY TEYLGA HGL+ IL  L+ + ++L  +P+   ++ Q +D+++     N N PP   ++G      ++L HWCHGA G  Y +A AYL+  + +YL+  + CG + W+ GLLKKGPGICHGV+GS Y FLLLYRLT +  Y+ RA   SSF
Sbjct:    3 TKRCFANRFDDYQGSLLAGQCEEAVAPLVTATIERILQELPPLGGGAEARGATAGASACQGGLYGGVAGVAYMLYHVSQSPLFATARERYLRSAKRLIDACARA-EEWGEPDADTRAAFLLGGAGVYAVATLVYHALG-RSDYVQPLGKFRALCAVCAPVSFLECGSDELFVGRAGYLCAALVLKQKLAQEVLTPAQ--IKSICQAILDSGKQYAIKKRKPFPLMYSYYGTEYLGAAHGLSSILQMLLSYHEHL--KPSDRELVWQSVDFLME-QEQNCNWPP---ELGETIERENELVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVFLLLYRLTGNSKYIYRAQ--SSF 370          
BLAST of LanC-like protein 3-like protein vs. Ensembl Human
Match: LANCL3 (LanC like 3 [Source:HGNC Symbol;Acc:HGNC:24767])

HSP 1 Score: 223.402 bits (568), Expect = 5.052e-68
Identity = 146/380 (38.42%), Postives = 212/380 (55.79%), Query Frame = 2
Query:   35 STRHFSNDYEDKVLDLTSLDSSYLIEYSLN-ILNTCIKSLPPIAENED------------GGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSF 1135
            + R F+N ++D    L +      +   +   +   ++ LPP+    +            GGLY G  G+ Y L H+S SPL +  R + L  AK  I+       +  +   D++ +FLLG  G   VA  VY  LG  ++  Q   +F AL     P+     GSDELFVG+AGYL A  V+K   ++  L  A+  + SI  ++++SG+QYAIK+R   PLMYSYY TEYLGA HGL+ IL  L+ + ++L  +P+   ++ Q +D+++     N N PP   ++G      ++L HWCHGA G  Y +A AYL+  + +YL+  + CG + W+ GLLKKGPGICHGV+GS Y FLLLYRLT +  Y+ RA   SSF
Sbjct:    3 TKRCFANRFDDYQGSLLAGQCEEAVAPLVTATIERILQELPPLGGGAEARGATAGASACQGGLYGGVAGVAYMLYHVSQSPLFATARERYLRSAKRLIDACARA-EEWGEPDADTRAAFLLGGAGVYAVATLVYHALG-RSDYVQPLGKFRALCAVCAPVSFLECGSDELFVGRAGYLCAALVLKQKLAQEVLTPAQ--IKSICQAILDSGKQYAIKKRKPFPLMYSYYGTEYLGAAHGLSSILQMLLSYHEHL--KPSDRELVWQSVDFLME-QEQNCNWPP---ELGETIERENELVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVFLLLYRLTGNSKYIYRAQ--SSF 370          
BLAST of LanC-like protein 3-like protein vs. Ensembl Human
Match: LANCL1 (LanC like 1 [Source:HGNC Symbol;Acc:HGNC:6508])

HSP 1 Score: 183.726 bits (465), Expect = 8.304e-53
Identity = 137/416 (32.93%), Postives = 209/416 (50.24%), Query Frame = 2
Query:   32 MSTRHFSNDYED--KVLDLTSLDSSYLI--EYSLNILNTCIKSLPPI------AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQR--CRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            M+ R F N Y D  K L     D++  +  E+S  + N   + L  +      A+  DG  Y G+ G+    LH+ D  +  D           +++    +  Q     T   ++FL G+ G L VA  +Y K+    +A    T  + L +K  P        +E+  G+ GY+ A   +  +      ++ +  +  I ++++ SG+  A K+    + PLMY +Y   Y+GA HGLAGI + LM+ P     +  + ++++  +DY+  +   +GN PP   D          L HWCHGA G IY    AY ++ +EKYL  A  C +VIW+YGLLKKG G+CHG +G+ YAFL LY LT D  YL RA  F+ +   +  +   R PD+P+SLFEG AGT  F+ADL +P
Sbjct:    1 MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYD--VFGDPA---------YLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHL-NKIDP-----HAPNEMLYGRIGYIYALLFVNKNFG--VEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQ-PSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGD------NRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWC-LEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVP 389          
BLAST of LanC-like protein 3-like protein vs. Ensembl Human
Match: LANCL1 (LanC like 1 [Source:HGNC Symbol;Acc:HGNC:6508])

HSP 1 Score: 183.726 bits (465), Expect = 8.304e-53
Identity = 137/416 (32.93%), Postives = 209/416 (50.24%), Query Frame = 2
Query:   32 MSTRHFSNDYED--KVLDLTSLDSSYLI--EYSLNILNTCIKSLPPI------AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQR--CRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            M+ R F N Y D  K L     D++  +  E+S  + N   + L  +      A+  DG  Y G+ G+    LH+ D  +  D           +++    +  Q     T   ++FL G+ G L VA  +Y K+    +A    T  + L +K  P        +E+  G+ GY+ A   +  +      ++ +  +  I ++++ SG+  A K+    + PLMY +Y   Y+GA HGLAGI + LM+ P     +  + ++++  +DY+  +   +GN PP   D          L HWCHGA G IY    AY ++ +EKYL  A  C +VIW+YGLLKKG G+CHG +G+ YAFL LY LT D  YL RA  F+ +   +  +   R PD+P+SLFEG AGT  F+ADL +P
Sbjct:    1 MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYD--VFGDPA---------YLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHL-NKIDP-----HAPNEMLYGRIGYIYALLFVNKNFG--VEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQ-PSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGD------NRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWC-LEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVP 389          
BLAST of LanC-like protein 3-like protein vs. Ensembl Fly
Match: CG2061 (gene:FBgn0027498 transcript:FBtr0073431)

HSP 1 Score: 219.164 bits (557), Expect = 2.169e-66
Identity = 139/395 (35.19%), Postives = 213/395 (53.92%), Query Frame = 2
Query:   92 DSSYLIEYSLNILNTCIKSLPPIAENED--GGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLS-----LELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDY----LNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            D  ++       ++  ++   P +++ED  G LYVG  G+ +    ++      D     L+ A  FI       N+ K+ R+  + SFL GN G   V+  + Q L  T E +     F +     +     + G DE+ VG+AGYL       S C  L+      ++  D L SI   +V SG++Y+ +     PLMY Y+ TEYLGA HGL  IL  L+  P +    ++     +  I++ +D+ + +  ++GN P   +D+  ++    +L HWCHGA GA+Y  A AYL++ +EKYL +   C +++WK G L+KGPGICHGV+G+GY FLLL+RLT++  YL RA+ F   + +  FK  AR PD P+SL+EG AGT C++ DL  P
Sbjct:   24 DEEHIKNLICTYVDAILEHCHPNSDDEDNRGDLYVGNAGIAFMFWKLNSCEQTRD-LYPALDHAASFIRNAKVNANRYKK-RSAERYSFLCGNAGIYAVSAAISQALKETEELSDDLANFKSGIPCSKEFMHTKYGCDEVLVGRAGYL-------SGCYWLNDVLPEKKITDDDLVSICQLIVTSGREYSKQNNSPCPLMYQYHGTEYLGAAHGLCAILHMLLDSPWFRTLPISAPAAELRDIKRSIDFFLELQDSDGNFPVALEDL--RSGRDKRLVHWCHGAPGAVYVLAKAYLIFKEEKYLASLRRCADMVWKKGFLRKGPGICHGVAGNGYVFLLLFRLTNEMRYLYRAHKFMELLTNAEFKLRARTPDRPHSLYEGVAGTVCYLVDLLEP 407          
BLAST of LanC-like protein 3-like protein vs. Ensembl Fly
Match: CG2061 (gene:FBgn0027498 transcript:FBtr0332383)

HSP 1 Score: 219.164 bits (557), Expect = 2.169e-66
Identity = 139/395 (35.19%), Postives = 213/395 (53.92%), Query Frame = 2
Query:   92 DSSYLIEYSLNILNTCIKSLPPIAENED--GGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLS-----LELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDY----LNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            D  ++       ++  ++   P +++ED  G LYVG  G+ +    ++      D     L+ A  FI       N+ K+ R+  + SFL GN G   V+  + Q L  T E +     F +     +     + G DE+ VG+AGYL       S C  L+      ++  D L SI   +V SG++Y+ +     PLMY Y+ TEYLGA HGL  IL  L+  P +    ++     +  I++ +D+ + +  ++GN P   +D+  ++    +L HWCHGA GA+Y  A AYL++ +EKYL +   C +++WK G L+KGPGICHGV+G+GY FLLL+RLT++  YL RA+ F   + +  FK  AR PD P+SL+EG AGT C++ DL  P
Sbjct:   24 DEEHIKNLICTYVDAILEHCHPNSDDEDNRGDLYVGNAGIAFMFWKLNSCEQTRD-LYPALDHAASFIRNAKVNANRYKK-RSAERYSFLCGNAGIYAVSAAISQALKETEELSDDLANFKSGIPCSKEFMHTKYGCDEVLVGRAGYL-------SGCYWLNDVLPEKKITDDDLVSICQLIVTSGREYSKQNNSPCPLMYQYHGTEYLGAAHGLCAILHMLLDSPWFRTLPISAPAAELRDIKRSIDFFLELQDSDGNFPVALEDL--RSGRDKRLVHWCHGAPGAVYVLAKAYLIFKEEKYLASLRRCADMVWKKGFLRKGPGICHGVAGNGYVFLLLFRLTNEMRYLYRAHKFMELLTNAEFKLRARTPDRPHSLYEGVAGTVCYLVDLLEP 407          
BLAST of LanC-like protein 3-like protein vs. Ensembl Fly
Match: CG2061 (gene:FBgn0027498 transcript:FBtr0073429)

HSP 1 Score: 219.164 bits (557), Expect = 2.169e-66
Identity = 139/395 (35.19%), Postives = 213/395 (53.92%), Query Frame = 2
Query:   92 DSSYLIEYSLNILNTCIKSLPPIAENED--GGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLS-----LELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDY----LNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            D  ++       ++  ++   P +++ED  G LYVG  G+ +    ++      D     L+ A  FI       N+ K+ R+  + SFL GN G   V+  + Q L  T E +     F +     +     + G DE+ VG+AGYL       S C  L+      ++  D L SI   +V SG++Y+ +     PLMY Y+ TEYLGA HGL  IL  L+  P +    ++     +  I++ +D+ + +  ++GN P   +D+  ++    +L HWCHGA GA+Y  A AYL++ +EKYL +   C +++WK G L+KGPGICHGV+G+GY FLLL+RLT++  YL RA+ F   + +  FK  AR PD P+SL+EG AGT C++ DL  P
Sbjct:   24 DEEHIKNLICTYVDAILEHCHPNSDDEDNRGDLYVGNAGIAFMFWKLNSCEQTRD-LYPALDHAASFIRNAKVNANRYKK-RSAERYSFLCGNAGIYAVSAAISQALKETEELSDDLANFKSGIPCSKEFMHTKYGCDEVLVGRAGYL-------SGCYWLNDVLPEKKITDDDLVSICQLIVTSGREYSKQNNSPCPLMYQYHGTEYLGAAHGLCAILHMLLDSPWFRTLPISAPAAELRDIKRSIDFFLELQDSDGNFPVALEDL--RSGRDKRLVHWCHGAPGAVYVLAKAYLIFKEEKYLASLRRCADMVWKKGFLRKGPGICHGVAGNGYVFLLLFRLTNEMRYLYRAHKFMELLTNAEFKLRARTPDRPHSLYEGVAGTVCYLVDLLEP 407          
BLAST of LanC-like protein 3-like protein vs. Ensembl Zebrafish
Match: lancl1 (LanC antibiotic synthetase component C-like 1 (bacterial) [Source:NCBI gene;Acc:494154])

HSP 1 Score: 183.726 bits (465), Expect = 6.215e-53
Identity = 135/415 (32.53%), Postives = 209/415 (50.36%), Query Frame = 2
Query:   26 QNMSTRHFSNDYEDKVLDLTSLDSSYLIEYSLNILNTCIKSLPPIAENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGS--DELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRV----PLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMPGNG 1252
            Q   T+HF+     K+ +L            L IL   +K+    A+  D   Y G+ G+  ALL++    +  D           F+++   + N+  +  T   ++FL G+ G L +A  VY +L    E+ +     L L    QP  +   G   DEL  G+ GYL  YS+I  +      ++    +  I D+++ SGQ   + QR ++    PLMY +Y  EY+GA HGL+GI + LM+ P  +  +  V ++++  ++Y+  +   +GN  P   D          L HWCHG+ G IY    A+ ++   +YLE A+ CG VIW+ GLLKKG G+CHG +G+ Y FL LY++T D  +L RA  F+ +  +   +   R PD+P+SLFEG AGT  F+ADL  P   
Sbjct:   27 QGNLTQHFATSISSKISEL------------LAILENGLKN----ADPRDCTGYTGWAGI--ALLYLHLHSVFGDPT---------FLQRALDYVNRSLRSLTQRWVTFLCGDAGPLAIAAVVYHRLQKHQESDECLNRLLQL----QPSVVQGKGRLPDELLYGRTGYL--YSLIFVNQQFQQEKIPFQYIQQICDAILESGQ--ILSQRNKIQDQSPLMYEWYQEEYVGAAHGLSGIYYYLMQ-PGLVAGQDRVFSLVKPSVNYVCQLKFPSGNYAPCVGDAR------DLLVHWCHGSPGVIYMLIQAFKVFGVRQYLEDALQCGEVIWQRGLLKKGYGLCHGAAGNAYGFLALYKITQDPKHLYRACMFADWCMNYG-RHGCRTPDTPFSLFEGMAGTIYFLADLLQPARA 398          
BLAST of LanC-like protein 3-like protein vs. Ensembl Zebrafish
Match: lancl2 (LanC lantibiotic synthetase component C-like 2 (bacterial) [Source:ZFIN;Acc:ZDB-GENE-070209-191])

HSP 1 Score: 173.711 bits (439), Expect = 5.733e-49
Identity = 115/368 (31.25%), Postives = 192/368 (52.17%), Query Frame = 2
Query:  161 AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRC--RVPLMYSYYNTEYLGAGHGLAGILFALMK-----FPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            A+  D   Y G+ G+    LH+  +     + +  L ++  ++++     N ++       +SFL G+ G L V   V+  L    E+    ++ L L  +   L       DEL  G+AGYL A   +    +  +++ A  T+  ++ ++V SG+  + +++   R PL+Y ++  +Y+GA HGLAGI + LM+      PD L++      +++  +DY+      +GN P    +         +L HWCHGA G ++   +A+ ++  EKYL  A+ CG +IW+ GLL+KG G+CHG +G+ YAFL LYR T D  +L+RA  F+ +   D      R+PD PYSLFEG AG   +++D+  P
Sbjct:   86 ADPHDFSTYTGWTGVALLYLHLYQA----TQEVSHLQRSLDYVKRTLRNLNGRR-------VSFLCGDAGPLAVGAVVHHHLKNQTESQDCISKLLQL--QRSVLSPDSDVPDELLYGRAGYLYALLYVNREIAPDAVDEA--TIAKVVTAIVESGKNLSKEEKKSERCPLLYEWHKKQYVGAAHGLAGIYYMLMQPSAKLHPDLLSE------LVRPSVDYLRHKKFRSGNYPSSLSN------ESDRLVHWCHGAPGVLHMLIMAHTVFKDEKYLRDALECGELIWQRGLLRKGYGLCHGTAGNAYAFLALYRCTRDRKHLHRACKFAEWC-LDYGTHGCRIPDRPYSLFEGMAGAIHYLSDVLQP 425          
BLAST of LanC-like protein 3-like protein vs. Ensembl Xenopus
Match: adam11 (ADAM metallopeptidase domain 11 [Source:Xenbase;Acc:XB-GENE-966539])

HSP 1 Score: 252.677 bits (644), Expect = 3.585e-79
Identity = 165/408 (40.44%), Postives = 238/408 (58.33%), Query Frame = 2
Query:   35 STRHFSNDYED-KVLDLTSLDSSYLIEYSLNILNTCIKSLPPIAENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLE-LAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMPGNG 1252
            S R F+N + D K   L+   S   +   L+ L + ++ LP     E+GGLY G  G+ Y L H+S   L S  R   L +A   IE  T +Y++++    +++ SFLLG VG   VA  +Y+  GL  ++ +   +F  +G+   PL     GSDELFVG++GYL A  V+K    KL +E L    + SI  +++ SG+ Y+ K+R   PLMYSYY TEYLGA HGL+ +L  L+ + DYL  +P    ++ + +D++++    N N PP   ++G      ++L HWCHGA G  Y +A AYLL  +  YL+  + CG + W+ GLLKKGPGICHGV+GS Y FLLLYRLT    Y+ RA  F+ F+ SD FK  +   ++ YSL+EG +GT CF+ DL  P + 
Sbjct:    3 SKRCFANRFSDYKGSLLSGQGSEASVPLILSTLESVLQKLPA-QGGEEGGLYGGLAGVAYMLYHVSQCHLFSSGRDTYLRKATALIESCTAYYDREQD--RETRASFLLGGVGVYAVAALIYEARGLQADSNRALDKFKEIGEICTPLGFLECGSDELFVGRSGYLCAALVLKQ---KLQVEVLTPVQIRSICQAILESGKHYSKKKRKLFPLMYSYYGTEYLGAAHGLSSVLQMLLTYQDYL--QPADRDLVWESVDFLVN-QEQNCNWPP---ELGGVIERENELVHWCHGAPGIAYLFAKAYLLTRKPCYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVFLLLYRLTGHSKYIYRAQRFAEFLFSDEFKAGSCTIENIYSLYEGLSGTVCFLVDLLQPNDA 398          
BLAST of LanC-like protein 3-like protein vs. Ensembl Xenopus
Match: uox (urate oxidase [Source:Xenbase;Acc:XB-GENE-5811053])

HSP 1 Score: 183.341 bits (464), Expect = 5.749e-53
Identity = 127/365 (34.79%), Postives = 192/365 (52.60%), Query Frame = 2
Query:  161 AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRT--DSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRC--RVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            A+  D   Y G+ G+  ALL++           QL    K     Q      K+ LR     ++SFL G+ G L V+  V+ KL    E+ +   + L L       +      DEL  G+AGYL A   + +  S  ++  A  ++  ++D+++ SG+  + ++    R PL+Y ++  +Y+GA HGLAGI + LM+ P    D  T+  +++ C+DY+      +GN P    +         +L HWCHGA G I+    A+ ++ ++KYL+ AV C  VIW+ GLL+KG GICHG SG+GYAFL LY  T D+ YL RA  F+ +   +  K   R+PD PYSLFEG AG   F++D+  P
Sbjct:   31 ADPHDCSAYTGYTGI--ALLYL-----------QLYRVTKEQSHLQRSLDYVKRILRNLNGRRVSFLCGDAGPLAVSAVVHHKLNNEAESKECIAKLLQLQRGVVSTDT--DLPDELLYGRAGYLYALLYVNNEISPDTVPPA--SIKEVVDAIIESGKNLSKEEHKTERCPLLYQWHKKQYVGAAHGLAGIYYMLMQ-PSSNVDVETLSDLVKPCIDYVRHKKFRSGNYPSSLSN------ETDRLVHWCHGAPGVIHMLLHAHKVFKEDKYLKDAVECSEVIWQRGLLRKGYGICHGTSGNGYAFLSLYNHTQDKKYLYRACRFAEWC-LEYGKHGCRIPDRPYSLFEGMAGAIHFLSDMLTP 370          
BLAST of LanC-like protein 3-like protein vs. Ensembl Xenopus
Match: uox (urate oxidase [Source:Xenbase;Acc:XB-GENE-5811053])

HSP 1 Score: 182.956 bits (463), Expect = 1.417e-52
Identity = 127/365 (34.79%), Postives = 192/365 (52.60%), Query Frame = 2
Query:  161 AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRT--DSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRC--RVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            A+  D   Y G+ G+  ALL++           QL    K     Q      K+ LR     ++SFL G+ G L V+  V+ KL    E+ +   + L L       +      DEL  G+AGYL A   + +  S  ++  A  ++  ++D+++ SG+  + ++    R PL+Y ++  +Y+GA HGLAGI + LM+ P    D  T+  +++ C+DY+      +GN P    +         +L HWCHGA G I+    A+ ++ ++KYL+ AV C  VIW+ GLL+KG GICHG SG+GYAFL LY  T D+ YL RA  F+ +   +  K   R+PD PYSLFEG AG   F++D+  P
Sbjct:   44 ADPHDCSAYTGYTGI--ALLYL-----------QLYRVTKEQSHLQRSLDYVKRILRNLNGRRVSFLCGDAGPLAVSAVVHHKLNNEAESKECIAKLLQLQRGVVSTDT--DLPDELLYGRAGYLYALLYVNNEISPDTVPPA--SIKEVVDAIIESGKNLSKEEHKTERCPLLYQWHKKQYVGAAHGLAGIYYMLMQ-PSSNVDVETLSDLVKPCIDYVRHKKFRSGNYPSSLSN------ETDRLVHWCHGAPGVIHMLLHAHKVFKEDKYLKDAVECSEVIWQRGLLRKGYGICHGTSGNGYAFLSLYNHTQDKKYLYRACRFAEWC-LEYGKHGCRIPDRPYSLFEGMAGAIHFLSDMLTP 383          
BLAST of LanC-like protein 3-like protein vs. Ensembl Xenopus
Match: uox (urate oxidase [Source:Xenbase;Acc:XB-GENE-5811053])

HSP 1 Score: 182.956 bits (463), Expect = 2.848e-52
Identity = 127/365 (34.79%), Postives = 192/365 (52.60%), Query Frame = 2
Query:  161 AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRT--DSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRC--RVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            A+  D   Y G+ G+  ALL++           QL    K     Q      K+ LR     ++SFL G+ G L V+  V+ KL    E+ +   + L L       +      DEL  G+AGYL A   + +  S  ++  A  ++  ++D+++ SG+  + ++    R PL+Y ++  +Y+GA HGLAGI + LM+ P    D  T+  +++ C+DY+      +GN P    +         +L HWCHGA G I+    A+ ++ ++KYL+ AV C  VIW+ GLL+KG GICHG SG+GYAFL LY  T D+ YL RA  F+ +   +  K   R+PD PYSLFEG AG   F++D+  P
Sbjct:   81 ADPHDCSAYTGYTGI--ALLYL-----------QLYRVTKEQSHLQRSLDYVKRILRNLNGRRVSFLCGDAGPLAVSAVVHHKLNNEAESKECIAKLLQLQRGVVSTDT--DLPDELLYGRAGYLYALLYVNNEISPDTVPPA--SIKEVVDAIIESGKNLSKEEHKTERCPLLYQWHKKQYVGAAHGLAGIYYMLMQ-PSSNVDVETLSDLVKPCIDYVRHKKFRSGNYPSSLSN------ETDRLVHWCHGAPGVIHMLLHAHKVFKEDKYLKDAVECSEVIWQRGLLRKGYGICHGTSGNGYAFLSLYNHTQDKKYLYRACRFAEWC-LEYGKHGCRIPDRPYSLFEGMAGAIHFLSDMLTP 420          
BLAST of LanC-like protein 3-like protein vs. Ensembl Xenopus
Match: uox (urate oxidase [Source:Xenbase;Acc:XB-GENE-5811053])

HSP 1 Score: 182.956 bits (463), Expect = 3.449e-52
Identity = 127/365 (34.79%), Postives = 192/365 (52.60%), Query Frame = 2
Query:  161 AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRT--DSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRC--RVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            A+  D   Y G+ G+  ALL++           QL    K     Q      K+ LR     ++SFL G+ G L V+  V+ KL    E+ +   + L L       +      DEL  G+AGYL A   + +  S  ++  A  ++  ++D+++ SG+  + ++    R PL+Y ++  +Y+GA HGLAGI + LM+ P    D  T+  +++ C+DY+      +GN P    +         +L HWCHGA G I+    A+ ++ ++KYL+ AV C  VIW+ GLL+KG GICHG SG+GYAFL LY  T D+ YL RA  F+ +   +  K   R+PD PYSLFEG AG   F++D+  P
Sbjct:   93 ADPHDCSAYTGYTGI--ALLYL-----------QLYRVTKEQSHLQRSLDYVKRILRNLNGRRVSFLCGDAGPLAVSAVVHHKLNNEAESKECIAKLLQLQRGVVSTDT--DLPDELLYGRAGYLYALLYVNNEISPDTVPPA--SIKEVVDAIIESGKNLSKEEHKTERCPLLYQWHKKQYVGAAHGLAGIYYMLMQ-PSSNVDVETLSDLVKPCIDYVRHKKFRSGNYPSSLSN------ETDRLVHWCHGAPGVIHMLLHAHKVFKEDKYLKDAVECSEVIWQRGLLRKGYGICHGTSGNGYAFLSLYNHTQDKKYLYRACRFAEWC-LEYGKHGCRIPDRPYSLFEGMAGAIHFLSDMLTP 432          
BLAST of LanC-like protein 3-like protein vs. Ensembl Mouse
Match: Lancl3 (LanC lantibiotic synthetase component C-like 3 (bacterial) [Source:MGI Symbol;Acc:MGI:2443335])

HSP 1 Score: 259.61 bits (662), Expect = 7.053e-82
Identity = 162/417 (38.85%), Postives = 238/417 (57.07%), Query Frame = 2
Query:   35 STRHFSNDYEDKVLDLTSLDSSYLIE-YSLNILNTCIKSLPPIAENED------------GGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDT-LYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            + R F+N ++D    L +      +     + +   ++ LPP+    +            GGLY G  G+ Y L H+S SPL +  R + L  AK  I+       +  +   D++ +FLLG  G   VA  VY  LG   +  Q   +F AL     P+     GSDELFVG+AGYL A  V+K    KL+ E+   T + +I  ++++SG+QYA+K+R   PLMYSYY TEYLGA HGL+ IL  L+ + ++L  +P+   ++ Q +D+++     N N PP   ++G      ++L HWCHGA G  Y +A AYL+  + +YL+  + CG + W+ GLLKKGPGICHGV+GS Y FLLLYRLT +  Y+ RA  F+ F+ ++ FK  +RV +S YSL+EG++GT CF+ DL  P
Sbjct:    3 TKRCFANRFDDYQGSLLAGQCEEAVAPLVTSTIERILQELPPLGGGAEARGATGAGSSCQGGLYSGVAGVAYMLYHVSQSPLFAAARERYLRFAKRLIDA-CLRAEEWGETDADTRAAFLLGGAGVYAVATLVYHALG-RPDYVQPLGKFRALCAVCAPVSFLDCGSDELFVGRAGYLCAALVLKQ---KLAQEVLTPTQIKAICQAILDSGKQYALKKRKPFPLMYSYYGTEYLGAAHGLSSILQMLLSYQEHL--KPSDRELVWQSVDFLME-QEQNCNWPP---ELGETIERENELVHWCHGAPGIAYLFAKAYLISKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVFLLLYRLTGNSKYIYRAQRFAQFLFTEEFKSGSRVLESIYSLYEGFSGTVCFLIDLLQP 408          
BLAST of LanC-like protein 3-like protein vs. Ensembl Mouse
Match: Lancl2 (LanC (bacterial lantibiotic synthetase component C)-like 2 [Source:MGI Symbol;Acc:MGI:1919085])

HSP 1 Score: 189.119 bits (479), Expect = 1.442e-54
Identity = 127/367 (34.60%), Postives = 199/367 (54.22%), Query Frame = 2
Query:  161 AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDS--KLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKF--QPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRC--RVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            A+  D   Y G+ G+  ALL++    +  D+         Y +    Y    K+ LR  S  +++FL G+ G L V   +Y KL    E+ +  T+ L +      Q  E+     DEL  G+AGYL A   + +     ++   +  +  ++ +++ SG+  + ++R   R PL+Y ++  +Y+GA HG+AGI + LM+ P+   D+ T+  M++  +DY+      +GN P    +         +L HWCHGA G I+    AY ++ +EKYL+ A+ C +VIW+ GLL+KG GICHG SG+GY+FL LYRLT D+ YL RA  F+ +   D      R+PD PYSLFEG AG   F++D+ +P
Sbjct:   86 ADPHDCSAYTGWTGI--ALLYLQLYRVTGDQ--------TYLLRSLDYV---KRTLRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTIVCQESEL----PDELLYGRAGYLYALLYLNTEIGPGTV--GETAIKEVVSAIIESGKSLSREERKSERCPLLYQWHRKQYVGAAHGMAGIYYMLMQ-PEAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSN------ETDRLVHWCHGAPGVIHVLLQAYQVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTSGNGYSFLSLYRLTQDKKYLYRACKFAEWC-LDYGAHGCRIPDRPYSLFEGMAGAVHFLSDILVP 425          
BLAST of LanC-like protein 3-like protein vs. Ensembl Mouse
Match: Lancl2 (LanC (bacterial lantibiotic synthetase component C)-like 2 [Source:MGI Symbol;Acc:MGI:1919085])

HSP 1 Score: 189.119 bits (479), Expect = 1.656e-54
Identity = 127/367 (34.60%), Postives = 199/367 (54.22%), Query Frame = 2
Query:  161 AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDS--KLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKF--QPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRC--RVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            A+  D   Y G+ G+  ALL++    +  D+         Y +    Y    K+ LR  S  +++FL G+ G L V   +Y KL    E+ +  T+ L +      Q  E+     DEL  G+AGYL A   + +     ++   +  +  ++ +++ SG+  + ++R   R PL+Y ++  +Y+GA HG+AGI + LM+ P+   D+ T+  M++  +DY+      +GN P    +         +L HWCHGA G I+    AY ++ +EKYL+ A+ C +VIW+ GLL+KG GICHG SG+GY+FL LYRLT D+ YL RA  F+ +   D      R+PD PYSLFEG AG   F++D+ +P
Sbjct:   95 ADPHDCSAYTGWTGI--ALLYLQLYRVTGDQ--------TYLLRSLDYV---KRTLRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTIVCQESEL----PDELLYGRAGYLYALLYLNTEIGPGTV--GETAIKEVVSAIIESGKSLSREERKSERCPLLYQWHRKQYVGAAHGMAGIYYMLMQ-PEAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSN------ETDRLVHWCHGAPGVIHVLLQAYQVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTSGNGYSFLSLYRLTQDKKYLYRACKFAEWC-LDYGAHGCRIPDRPYSLFEGMAGAVHFLSDILVP 434          
BLAST of LanC-like protein 3-like protein vs. Ensembl Mouse
Match: Lancl2 (LanC (bacterial lantibiotic synthetase component C)-like 2 [Source:MGI Symbol;Acc:MGI:1919085])

HSP 1 Score: 189.119 bits (479), Expect = 1.656e-54
Identity = 127/367 (34.60%), Postives = 199/367 (54.22%), Query Frame = 2
Query:  161 AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDS--KLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKF--QPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRC--RVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            A+  D   Y G+ G+  ALL++    +  D+         Y +    Y    K+ LR  S  +++FL G+ G L V   +Y KL    E+ +  T+ L +      Q  E+     DEL  G+AGYL A   + +     ++   +  +  ++ +++ SG+  + ++R   R PL+Y ++  +Y+GA HG+AGI + LM+ P+   D+ T+  M++  +DY+      +GN P    +         +L HWCHGA G I+    AY ++ +EKYL+ A+ C +VIW+ GLL+KG GICHG SG+GY+FL LYRLT D+ YL RA  F+ +   D      R+PD PYSLFEG AG   F++D+ +P
Sbjct:   95 ADPHDCSAYTGWTGI--ALLYLQLYRVTGDQ--------TYLLRSLDYV---KRTLRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTIVCQESEL----PDELLYGRAGYLYALLYLNTEIGPGTV--GETAIKEVVSAIIESGKSLSREERKSERCPLLYQWHRKQYVGAAHGMAGIYYMLMQ-PEAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSN------ETDRLVHWCHGAPGVIHVLLQAYQVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTSGNGYSFLSLYRLTQDKKYLYRACKFAEWC-LDYGAHGCRIPDRPYSLFEGMAGAVHFLSDILVP 434          
BLAST of LanC-like protein 3-like protein vs. Ensembl Mouse
Match: Lancl1 (LanC (bacterial lantibiotic synthetase component C)-like 1 [Source:MGI Symbol;Acc:MGI:1336997])

HSP 1 Score: 183.341 bits (464), Expect = 8.140e-53
Identity = 134/416 (32.21%), Postives = 212/416 (50.96%), Query Frame = 2
Query:   32 MSTRHFSNDYED--KVLDLTSLDSSYLI--EYSLNILNTCIKSLPPI------AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQR--CRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            M+ R F N Y D  K L     DS+  +  E+S  + N   + L  +      A+  DG  Y G+ G+    LH+ +  +  D           +++    +  Q     +   ++FL G+ G L VA  +Y K+    +A +  T  + L +K  P        +E+  G+ GY+ A   +  +  +   ++ +  +  I ++++ SG+  + K+    + PLMY +Y   Y+GA HGLAGI + LM+ P    ++  + ++++  +D++  +   +GN PP  DD          L HWCHGA G IY    AY ++ +E+YL  A  C +VIW+YGLLKKG G+CHG +G+ YAFL LY LT D  YL RA  F+ +   D  +   R  D+P+SLFEG AGT  F+ADL +P
Sbjct:    1 MAQRAFPNPYADYNKSLAENYFDSTGRLTPEFSHRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLHN--VFGDPA---------YLQMAHSYVKQSLNCLSRRSITFLCGDAGPLAVAAVLYHKMNSEKQAEECITRLIHL-NKIDP-----HVPNEMLYGRIGYIFALLFVNKNFGEE--KIPQSHIQQICENILTSGENLSRKRNLAAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQ-PSLQVNQGKLHSLVKPSVDFVCRLKFPSGNYPPCLDDTR------DLLVHWCHGAPGVIYMLIQAYKVFKEERYLCDAQQCADVIWQYGLLKKGYGLCHGAAGNAYAFLALYNLTQDLKYLYRACKFAEWC-LDYGEHGCRTADTPFSLFEGMAGTIYFLADLLVP 389          
BLAST of LanC-like protein 3-like protein vs. UniProt/SwissProt
Match: sp|Q6ZV70|LANC3_HUMAN (LanC-like protein 3 OS=Homo sapiens OX=9606 GN=LANCL3 PE=2 SV=2)

HSP 1 Score: 262.692 bits (670), Expect = 3.801e-82
Identity = 162/416 (38.94%), Postives = 238/416 (57.21%), Query Frame = 2
Query:   35 STRHFSNDYEDKVLDLTSLDSSYLIEYSLN-ILNTCIKSLPPIAENED------------GGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            + R F+N ++D    L +      +   +   +   ++ LPP+    +            GGLY G  G+ Y L H+S SPL +  R + L  AK  I+       +  +   D++ +FLLG  G   VA  VY  LG  ++  Q   +F AL     P+     GSDELFVG+AGYL A  V+K   ++  L  A+  + SI  ++++SG+QYAIK+R   PLMYSYY TEYLGA HGL+ IL  L+ + ++L  +P+   ++ Q +D+++     N N PP   ++G      ++L HWCHGA G  Y +A AYL+  + +YL+  + CG + W+ GLLKKGPGICHGV+GS Y FLLLYRLT +  Y+ RA  F+ F+ ++ FK  +RV +S YSL+EG++GT CF+ DL  P
Sbjct:    3 TKRCFANRFDDYQGSLLAGQCEEAVAPLVTATIERILQELPPLGGGAEARGATAGASACQGGLYGGVAGVAYMLYHVSQSPLFATARERYLRSAKRLIDACAR-AEEWGEPDADTRAAFLLGGAGVYAVATLVYHALG-RSDYVQPLGKFRALCAVCAPVSFLECGSDELFVGRAGYLCAALVLKQKLAQEVLTPAQ--IKSICQAILDSGKQYAIKKRKPFPLMYSYYGTEYLGAAHGLSSILQMLLSYHEHL--KPSDRELVWQSVDFLME-QEQNCNWPP---ELGETIERENELVHWCHGAPGIAYLFAKAYLVSKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVFLLLYRLTGNSKYIYRAQRFAQFLFTEEFKAGSRVLESIYSLYEGFSGTVCFLIDLLQP 408          
BLAST of LanC-like protein 3-like protein vs. UniProt/SwissProt
Match: sp|Q8CD19|LANC3_MOUSE (LanC-like protein 3 OS=Mus musculus OX=10090 GN=Lancl3 PE=2 SV=2)

HSP 1 Score: 259.61 bits (662), Expect = 4.934e-81
Identity = 162/417 (38.85%), Postives = 238/417 (57.07%), Query Frame = 2
Query:   35 STRHFSNDYEDKVLDLTSLDSSYLIE-YSLNILNTCIKSLPPIAENED------------GGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDT-LYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            + R F+N ++D    L +      +     + +   ++ LPP+    +            GGLY G  G+ Y L H+S SPL +  R + L  AK  I+       +  +   D++ +FLLG  G   VA  VY  LG   +  Q   +F AL     P+     GSDELFVG+AGYL A  V+K    KL+ E+   T + +I  ++++SG+QYA+K+R   PLMYSYY TEYLGA HGL+ IL  L+ + ++L  +P+   ++ Q +D+++     N N PP   ++G      ++L HWCHGA G  Y +A AYL+  + +YL+  + CG + W+ GLLKKGPGICHGV+GS Y FLLLYRLT +  Y+ RA  F+ F+ ++ FK  +RV +S YSL+EG++GT CF+ DL  P
Sbjct:    3 TKRCFANRFDDYQGSLLAGQCEEAVAPLVTSTIERILQELPPLGGGAEARGATGAGSSCQGGLYSGVAGVAYMLYHVSQSPLFAAARERYLRFAKRLIDA-CLRAEEWGETDADTRAAFLLGGAGVYAVATLVYHALG-RPDYVQPLGKFRALCAVCAPVSFLDCGSDELFVGRAGYLCAALVLKQ---KLAQEVLTPTQIKAICQAILDSGKQYALKKRKPFPLMYSYYGTEYLGAAHGLSSILQMLLSYQEHL--KPSDRELVWQSVDFLME-QEQNCNWPP---ELGETIERENELVHWCHGAPGIAYLFAKAYLISKKPQYLDTCIRCGELTWQKGLLKKGPGICHGVAGSAYVFLLLYRLTGNSKYIYRAQRFAQFLFTEEFKSGSRVLESIYSLYEGFSGTVCFLIDLLQP 408          
BLAST of LanC-like protein 3-like protein vs. UniProt/SwissProt
Match: sp|Q29HZ1|LANC3_DROPS (LanC-like protein 3 homolog OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA15215 PE=3 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 1.045e-67
Identity = 143/418 (34.21%), Postives = 222/418 (53.11%), Query Frame = 2
Query:   32 MSTRHFSNDYEDKVLDLTSL---DSSYLIEYSLNILNTCIKSLPPIAENED--GGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLS-----LELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDY----LNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            M  R+  N ++D +    +    D  ++       ++T ++   P +++ED  G LYVG  G+ +    ++      D     L  A  FI        + K+ R+  + SFL GN G   V+  + Q +  T E +     F +     +     + G DE+ VG+AGYL       S C  L+      ++  D L SI   +V SG++Y+      +PLM+ Y+ TEYLGA HGL  IL  L+  P +    ++     +  I++ +DY + +  A GN P   +D+  ++    +L HWCHGA GA+Y  A AYL++ +EKYL +     +++WK G L+KGPGICHGV+G+GY FLLL+RLT++  YL RA+ F   + +  FKQ AR+PD+P+SL+EG AGT CF+ D+  P
Sbjct:    1 MERRYLKNPFQDFIGGENTAFASDEEHIKNLICTYVDTILEHCHPNSDDEDDRGDLYVGNAGIAFMFWKLASCEQTRDLYPPALQHASAFIRNAKANAERFKK-RSAERYSFLCGNAGIYAVSAAISQAVKDTEELSNDLANFKSGIPSSKEFIHTKNGCDEVLVGRAGYL-------SGCYWLNDVLPDKKITDDDLISICQLIVTSGREYSKMNNSPLPLMFQYHGTEYLGAAHGLCAILHMLLDSPWFRTVPISAPAAELREIKRSIDYFLVLQDAEGNFPVALEDL--RSGRDKRLVHWCHGAPGAVYMLAKAYLIFKEEKYLTSLRRSADLVWKKGFLRKGPGICHGVAGNGYVFLLLFRLTNEMKYLYRAHKFMELLTNSEFKQRARIPDNPHSLYEGVAGTVCFLVDILEP 408          
BLAST of LanC-like protein 3-like protein vs. UniProt/SwissProt
Match: sp|Q9Y0Y7|LANC3_DROME (LanC-like protein 3 homolog OS=Drosophila melanogaster OX=7227 GN=CG2061 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 2.175e-65
Identity = 139/395 (35.19%), Postives = 213/395 (53.92%), Query Frame = 2
Query:   92 DSSYLIEYSLNILNTCIKSLPPIAENED--GGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLS-----LELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDY----LNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            D  ++       ++  ++   P +++ED  G LYVG  G+ +    ++      D     L+ A  FI       N+ K+ R+  + SFL GN G   V+  + Q L  T E +     F +     +     + G DE+ VG+AGYL       S C  L+      ++  D L SI   +V SG++Y+ +     PLMY Y+ TEYLGA HGL  IL  L+  P +    ++     +  I++ +D+ + +  ++GN P   +D+  ++    +L HWCHGA GA+Y  A AYL++ +EKYL +   C +++WK G L+KGPGICHGV+G+GY FLLL+RLT++  YL RA+ F   + +  FK  AR PD P+SL+EG AGT C++ DL  P
Sbjct:   24 DEEHIKNLICTYVDAILEHCHPNSDDEDNRGDLYVGNAGIAFMFWKLNSCEQTRD-LYPALDHAASFIRNAKVNANRYKK-RSAERYSFLCGNAGIYAVSAAISQALKETEELSDDLANFKSGIPCSKEFMHTKYGCDEVLVGRAGYL-------SGCYWLNDVLPEKKITDDDLVSICQLIVTSGREYSKQNNSPCPLMYQYHGTEYLGAAHGLCAILHMLLDSPWFRTLPISAPAAELRDIKRSIDFFLELQDSDGNFPVALEDL--RSGRDKRLVHWCHGAPGAVYVLAKAYLIFKEEKYLASLRRCADMVWKKGFLRKGPGICHGVAGNGYVFLLLFRLTNEMRYLYRAHKFMELLTNAEFKLRARTPDRPHSLYEGVAGTVCYLVDLLEP 407          
BLAST of LanC-like protein 3-like protein vs. UniProt/SwissProt
Match: sp|F1MVX2|LANC1_BOVIN (Glutathione S-transferase LANCL1 OS=Bos taurus OX=9913 GN=LANCL1 PE=1 SV=2)

HSP 1 Score: 189.889 bits (481), Expect = 1.993e-54
Identity = 143/418 (34.21%), Postives = 211/418 (50.48%), Query Frame = 2
Query:   32 MSTRHFSNDYED--KVLDLTSLDSSYLI--EYSLNILNTCIKSLPPI------AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSK--LSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRC--RVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            M+ R F N Y D  K L     DS+  +  E+S  + N   + L  +      A+  D  +Y G+ G+    LH+ D          +     Y      Y    K+ L + SK  ++FL G+ G L VA  V+ K+    +A +  T  + L +K  P         E+  G+ GY+ A   +  +  +   ++ +  +  I ++V+ SG+  A K+R   + PLMY +Y   Y+GA HGLAGI + LM+ P        +  +++  +DY+  +   +GN PP  DD          L HWCHGA G IY    AY ++ +E+YL  A  C +VIW+YGLLKKG G+CHG +G+ YAFL LY LT D  YL RA  F+ +   D  +   R PD+P+SLFEG AGT  F+ADL +P
Sbjct:    1 MAQRAFPNPYADYNKSLAEGYFDSAGRLTPEFSQRLNNKIRELLQQMERGLKSADPRDSTVYTGWAGIAVLYLHLYD----------VFGDPNYLQMAHGYV---KQSLNSLSKHSITFLCGDGGPLAVAAVVHHKMNNEKQAEECITRLIHL-NKIDP-----HAPSEMLYGRMGYISALLFVNKNFGEE--KIPQSHIQQICETVLTSGEDLARKRRFTGKTPLMYEWYQEYYVGAAHGLAGIYYYLMQ-PSLQVSHAKLHNLVKPSVDYVCQLKFPSGNYPPCVDD------SRDLLIHWCHGAPGVIYMLTQAYKVFKEERYLNDAYQCADVIWQYGLLKKGYGLCHGTAGNAYAFLSLYSLTQDAKYLYRACKFAEWC-LDYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVP 389          
BLAST of LanC-like protein 3-like protein vs. TrEMBL
Match: A0A074ZSX2 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_13985 PE=4 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 1.508e-108
Identity = 195/414 (47.10%), Postives = 255/414 (61.59%), Query Frame = 2
Query:   32 MSTRHFSNDYEDKVLDLTS---LDSSYLIEYSLNILNTCIKSLPPIAENEDGGLYVGFIGLGYALLHIS-DSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSK---LSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISIT-PANGNLPPGTDDIG-RKAIPGSQ-LTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            MS R F N Y D V D      +   + ++ +L  + TC K+ PP     DG LY G+IG+ +A L I+  + + S  R  LL  AK  +E       ++   R  +K   LS LLG  G    AV +YQ+L    +  +F   ++ L   FQP  I++ GSDE F+G+AGYL   +V++S   +  +  A  T++SI D+++ SG  YA   R   PLMY+YY TEYLGAGHG+ GILFALM FP YL   P     +QQ L Y+ISIT P  GNLP   D++G ++  P S  L HWCHGA GAI AYA AYLLW  E+YL     C   +W+ GLLKKGPGICHGV+GSGYA LL++RLT + +YL+RA  F++FM+SD+F+Q AR PD P+SLFEG AGTACF ADLA P
Sbjct:    1 MSARCFQNPYND-VTDPRQPLVISPEFSMQQALECIQTCFKNCPPSPRTFDGCLYTGYIGIAWAALDITRHANVPSTARSVLLGNAKQLVEAALRSVQEQSNARRMNKEDCLSILLGQPGIWIAAVMLYQQLNDMEQRNRFLEAYVNLAPHFQPAVIFQQGSDEYFIGRAGYLAGLAVLRSYTGEQFI--ADSTIHSICDAILQSGVNYARAHRSPCPLMYAYYGTEYLGAGHGMIGILFALMLFPSYLRSNPAADQAVQQTLLYLISITSPQTGNLPCAMDEVGPQRQRPDSDILVHWCHGATGAIMAYARAYLLWKDERYLAECRRCAETVWQRGLLKKGPGICHGVAGSGYALLLMFRLTGELVYLHRAAMFATFMQSDTFRQ-ARRPDCPHSLFEGLAGTACFFADLADP 410          
BLAST of LanC-like protein 3-like protein vs. TrEMBL
Match: A0A4S2MCN1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002303 PE=4 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 2.088e-108
Identity = 195/414 (47.10%), Postives = 256/414 (61.84%), Query Frame = 2
Query:   32 MSTRHFSNDYEDKVLDLTS---LDSSYLIEYSLNILNTCIKSLPPIAENEDGGLYVGFIGLGYALLHIS-DSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSK---LSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISIT-PANGNLPPGTDDIG-RKAIPGSQ-LTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            MS R F N Y D V D      +   + ++ +L  +  C K+ PP     DG LY G+IG+ +A L I+  + + S  R  LL  AK+ +E       ++   R  +K   LS LLG  G    AV +YQ+L    +  +F   ++ L   FQP  I++ GSDE F+G+AGYL   +V++S   +  +  A  T++SI D+++ SG  YA   R   PLMY+YY TEYLG+GHGL GILFALM FP YL   P     +QQ L Y+ISIT P  GNLP   D++G ++  P S  L HWCHGA GAI AYA AYLLW  E+YL     C   +W+ GLLKKGPGICHGV+GSGYAFLL++RLT + +YL+RA  F++FM+SD+F+Q AR PD P+SLFEG AGTACF ADLA P
Sbjct:    1 MSVRCFQNPYND-VTDPRQPLVISPEFSMQQALECIQNCFKNCPPSPRTFDGCLYTGYIGIAWAALDITRHANVPSTVRSVLLGNAKHLVEAALRSVQEQSNARRMNKEDCLSILLGQPGIWITAVMLYQQLNDMEQRNRFLEAYVNLAPHFQPEVIFQQGSDEYFIGRAGYLAGVAVLRSYTGEQFI--ADSTIHSICDAILQSGVNYARAHRSPCPLMYAYYGTEYLGSGHGLIGILFALMLFPSYLRSNPAADQAVQQTLLYLISITSPQTGNLPCAMDEVGPQRQRPDSDILVHWCHGATGAIMAYARAYLLWKDERYLAECRRCAETVWQRGLLKKGPGICHGVAGSGYAFLLMFRLTGELVYLHRAAMFATFMQSDTFRQ-ARRPDCPHSLFEGLAGTACFFADLADP 410          
BLAST of LanC-like protein 3-like protein vs. TrEMBL
Match: A0A419PLM4 (LanC-like protein 3-like protein (Fragment) OS=Clonorchis sinensis OX=79923 GN=CSKR_4778s PE=4 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 2.582e-103
Identity = 183/371 (49.33%), Postives = 237/371 (63.88%), Query Frame = 2
Query:  152 PPIAENEDGGLYVGFIGLGYALLHIS-DSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSK---LSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISIT-PANGNLPPGTDDIG-RKAIPGSQ-LTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            PP     DG +Y G+IG+ +A L I+  + + S  R  LL  AK  +E       ++   R  +K   LS LLG  G    AV +YQ+L    +  +F   ++ L   FQP  I++ GSDE F+G+AGYL   +V++S   +  +  A  T++SI D+++ SG  YA   R   PLMY+YY TEYLGAGHGL GILFALM FP YL   P     +QQ L Y+ISIT P  GNLP   D++G ++  P S  L HWCHGA GAI AYA AYLLW  E+YL  +  C   +W+ GLLKKGPGICHGV+GSGYAFLL++RLT + +YL+RA  F++FM+SD+F+Q AR PD P+SLFEG AGTACF ADLA P
Sbjct:    3 PPSPRTFDGCIYTGYIGIAWAALDITRHANVPSTARSVLLGNAKQLVEAALRSVQEQSNARRMNKEDCLSILLGQPGVWIAAVMLYQQLNDMEQRNRFLEAYVNLAPHFQPEVIFQQGSDEYFIGRAGYLAGVAVLRSYTGEQFI--ADSTIHSICDAILQSGVNYARAHRSPCPLMYAYYGTEYLGAGHGLIGILFALMLFPSYLRSNPAADQAVQQTLLYLISITSPQTGNLPCAMDEVGPQRQRPDSDILVHWCHGATGAIMAYARAYLLWKDERYLAESRRCAEAVWQRGLLKKGPGICHGVAGSGYAFLLMFRLTGELVYLHRAAMFATFMQSDAFRQ-ARRPDCPHSLFEGLAGTACFFADLADP 370          
BLAST of LanC-like protein 3-like protein vs. TrEMBL
Match: A0A5J4P0A2 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0007844 PE=4 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 6.159e-103
Identity = 185/413 (44.79%), Postives = 245/413 (59.32%), Query Frame = 2
Query:   32 MSTRHFSNDYEDKVLDLT-SLDSSYLIEYSLNILNTCIKSLPPIAENEDGGLYVGFIGLGYALLHISD-SPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSK---LSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPA-NGNLPPGTDDI--GRKAIPGSQ-LTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            MS R F N Y D   +   S      ++  +  L +C  S+     N DGGLY G++G+ +A LH+     L    R  +   A  FI+    +  ++ ++   +K   LS LLG  G    A   Y + G   +  Q+   +  L  +F P  +++ GSDE F+G+AGYL     ++S   +  L    +T+YSI D++V SG +Y    R   PLMY+YY TEYLGAGHGLAGILFALM FP Y    PT   +++Q L +MI +TPA  GNLP   D++   R+  P S  L HWCHGA GAI AYA AY+LW  E+YL     C +V+W+ GLLKKGPGICHGV+GSGY FLL+YRLT   +YL+RA+ F+ FM++D F+Q AR PD PYSLFEG AGTACF AD A P
Sbjct:    1 MSVRFFPNPYVDATSNQPLSFPPGQAVQKCIECLQSCFASVSTNPRNFDGGLYTGYLGIAWAALHVLRLEQLPPGSRESITGNANQFIQAALSYVAERTKVHQSNKEDSLSMLLGIPGVWLTASMFYHRFGDLTKRDQYLHAYKNLASQFLPEILFQQGSDEFFIGRAGYLAGLVALRSYTGEHILP--DETVYSICDAIVQSGLRYTRSHRSSCPLMYAYYGTEYLGAGHGLAGILFALMLFPSYFKANPTAEQLVRQSLLFMIGVTPAATGNLPAAMDEVDSSRRRRPDSDVLVHWCHGATGAILAYARAYILWKDERYLTECYRCADVVWQRGLLKKGPGICHGVAGSGYVFLLMYRLTGRPLYLHRASNFAYFMQTDVFRQ-ARRPDCPYSLFEGLAGTACFYADFANP 410          
BLAST of LanC-like protein 3-like protein vs. TrEMBL
Match: A0A504Y8Y1 (Lanthionine synthetase c like protein 1 OS=Fasciola gigantica OX=46835 GN=FGIG_06244 PE=4 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 5.235e-100
Identity = 183/419 (43.68%), Postives = 252/419 (60.14%), Query Frame = 2
Query:   32 MSTRHFSNDYEDKVLDLTS---LDSSYLIEYSLNILNTCIKSLPPIAENEDGGLYVGFIGLG---YALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYN--QKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDT-LYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPAN-GNLPPGTDDI-GRKAIPGSQ-LTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMPGNG 1252
            MS R F+N Y D V+D      +  +  +  ++  L  C+  + P   N DGGLY G++G+    +A+L  + S +  D +  LL+++   +       +   K+    + +LS LLG  G    A   Y  LG      ++  ++  L  +F+  E++  GSDE F+G+AGYL   + ++S   +    +  DT ++ I  ++V SG+ YA       PLMY+YY TEYLGAGHGLAGILF+LM FPDYL   P    +++  L YM+ ITP + GNLP   D++ G+   P S  L HWCHGA GA+ AYA A++LW   +YL A   C +VIW+ GLLKKGPGICHGV+GS YAFLLLYRLTS+  YL+RA+ F+ FM+SD+F+  AR PDSPYSLFEG AGTACF ADLA P   
Sbjct:    1 MSVRCFNNPYSD-VMDPKQPLVVGPTLAVHRAVECLQNCVTHVTPTPRNFDGGLYTGYLGIAWACFAVLRKNASEISPDVKQFLLSKSHDLVNAALSRVSGMTKQPSSKEDRLSMLLGESGVWMTAAMFYHHLGEAETRDRYLKKYADLASEFKTNELFPQGSDEFFIGRAGYLAGIAALRSWTGQ---SVIPDTDIFDICHAIVESGRVYARNHYSPCPLMYAYYETEYLGAGHGLAGILFSLMLFPDYLKANPESEQLVRSALAYMLQITPVDTGNLPSAMDEVSGQYRRPSSDILVHWCHGATGAVLAYARAFVLWKDPRYLVACRQCADVIWQRGLLKKGPGICHGVAGSAYAFLLLYRLTSEVFYLHRASMFAEFMQSDTFRH-ARRPDSPYSLFEGLAGTACFYADLANPSQA 414          
BLAST of LanC-like protein 3-like protein vs. Ensembl Cavefish
Match: lancl2 (LanC like 2 [Source:NCBI gene;Acc:103034499])

HSP 1 Score: 181.8 bits (460), Expect = 2.557e-52
Identity = 120/365 (32.88%), Postives = 192/365 (52.60%), Query Frame = 2
Query:  161 AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRT--DSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRC--RVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            A+  D   Y G+ G+    L +           ++ N+A +      Y    K+ LR     +++FL G+ G L V   V+ +L    ++ +  T+ L L  +   L       DEL  G+AGYL A   +       +++  + T+  ++ +++ SG+  + +++   R PL+Y ++  +Y+GA HGLAGI + LM+ P    +   +  +++  +DY+      +GN P    +         +L HWCHGA G ++   +A  ++  EKY++ AV+CG VIW+ GLL+KG GICHG +G+GYAFL LY+LT D  YL RA  F+ +   D      R+PD PYSLFEG AG   F++DLA P
Sbjct:   56 ADPHDFSTYTGWTGIALLYLQLH----------RVSNEAAHLQRSLDYV---KRTLRNLNGRRVTFLCGDAGPLAVGAVVHHRLNNQADSKECITKLLQL--QRSVLSPDSDMPDELLYGRAGYLFALLYVNKEIGSDTVD--ESTISKVVTAILESGKNLSKEEKKTERCPLLYEWHKKQYVGAAHGLAGIYYMLMQ-PSAKVNAEMLSELVRPSVDYVRHKKFRSGNYPSSLSN------ETDRLVHWCHGAPGVVHMLIMANKVFKDEKYVKDAVDCGEVIWQRGLLRKGYGICHGTAGNGYAFLSLYKLTQDPKYLYRACKFAEWC-LDYGTHGCRIPDRPYSLFEGMAGAIHFLSDLAQP 395          
BLAST of LanC-like protein 3-like protein vs. Ensembl Cavefish
Match: lancl2 (LanC like 2 [Source:NCBI gene;Acc:103034499])

HSP 1 Score: 181.8 bits (460), Expect = 3.568e-52
Identity = 120/365 (32.88%), Postives = 192/365 (52.60%), Query Frame = 2
Query:  161 AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRT--DSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRC--RVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            A+  D   Y G+ G+    L +           ++ N+A +      Y    K+ LR     +++FL G+ G L V   V+ +L    ++ +  T+ L L  +   L       DEL  G+AGYL A   +       +++  + T+  ++ +++ SG+  + +++   R PL+Y ++  +Y+GA HGLAGI + LM+ P    +   +  +++  +DY+      +GN P    +         +L HWCHGA G ++   +A  ++  EKY++ AV+CG VIW+ GLL+KG GICHG +G+GYAFL LY+LT D  YL RA  F+ +   D      R+PD PYSLFEG AG   F++DLA P
Sbjct:   65 ADPHDFSTYTGWTGIALLYLQLH----------RVSNEAAHLQRSLDYV---KRTLRNLNGRRVTFLCGDAGPLAVGAVVHHRLNNQADSKECITKLLQL--QRSVLSPDSDMPDELLYGRAGYLFALLYVNKEIGSDTVD--ESTISKVVTAILESGKNLSKEEKKTERCPLLYEWHKKQYVGAAHGLAGIYYMLMQ-PSAKVNAEMLSELVRPSVDYVRHKKFRSGNYPSSLSN------ETDRLVHWCHGAPGVVHMLIMANKVFKDEKYVKDAVDCGEVIWQRGLLRKGYGICHGTAGNGYAFLSLYKLTQDPKYLYRACKFAEWC-LDYGTHGCRIPDRPYSLFEGMAGAIHFLSDLAQP 404          
BLAST of LanC-like protein 3-like protein vs. Ensembl Cavefish
Match: lancl2 (LanC like 2 [Source:NCBI gene;Acc:103034499])

HSP 1 Score: 181.8 bits (460), Expect = 5.524e-52
Identity = 120/365 (32.88%), Postives = 192/365 (52.60%), Query Frame = 2
Query:  161 AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRT--DSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRC--RVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            A+  D   Y G+ G+    L +           ++ N+A +      Y    K+ LR     +++FL G+ G L V   V+ +L    ++ +  T+ L L  +   L       DEL  G+AGYL A   +       +++  + T+  ++ +++ SG+  + +++   R PL+Y ++  +Y+GA HGLAGI + LM+ P    +   +  +++  +DY+      +GN P    +         +L HWCHGA G ++   +A  ++  EKY++ AV+CG VIW+ GLL+KG GICHG +G+GYAFL LY+LT D  YL RA  F+ +   D      R+PD PYSLFEG AG   F++DLA P
Sbjct:   84 ADPHDFSTYTGWTGIALLYLQLH----------RVSNEAAHLQRSLDYV---KRTLRNLNGRRVTFLCGDAGPLAVGAVVHHRLNNQADSKECITKLLQL--QRSVLSPDSDMPDELLYGRAGYLFALLYVNKEIGSDTVD--ESTISKVVTAILESGKNLSKEEKKTERCPLLYEWHKKQYVGAAHGLAGIYYMLMQ-PSAKVNAEMLSELVRPSVDYVRHKKFRSGNYPSSLSN------ETDRLVHWCHGAPGVVHMLIMANKVFKDEKYVKDAVDCGEVIWQRGLLRKGYGICHGTAGNGYAFLSLYKLTQDPKYLYRACKFAEWC-LDYGTHGCRIPDRPYSLFEGMAGAIHFLSDLAQP 423          
BLAST of LanC-like protein 3-like protein vs. Ensembl Cavefish
Match: lancl1 (LanC antibiotic synthetase component C-like 1 (bacterial) [Source:NCBI gene;Acc:494154])

HSP 1 Score: 174.481 bits (441), Expect = 1.200e-49
Identity = 125/367 (34.06%), Postives = 191/367 (52.04%), Query Frame = 2
Query:  119 LNILNTCIKSLPPIAENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGS--DELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRV----PLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEG 1201
            L ++   +KS    A+  D   Y G+ G+  ALL++    +  D           F+++     ++  +  T S+++FL G+VG L VA  VY +L    EA +     L +        +  TG+  +EL  G+ GYL  YS+I  +       +    +  + D+V+ SG    + QR R+    PLMY +Y  +Y+GA HGL GI + LM+ P ++ D   ++A+++  +D++  +    GN PP   D          L HWCHGA G IY    AY ++  ++YLE AV CG V+W+ GLLKKG G+CHG +G+ Y FL LY+LT D  YL R   F+ +  +   K   R PD+P+SLFEG
Sbjct:   46 LAVMENGLKS----ADPRDCTGYTGWAGI--ALLYLHLHTVYGDPA---------FLQRAFDHVSRSLKCLTGSRVTFLCGDVGPLAVAAVVYHRLQRPQEAEECINRVLQMHRTV----VKSTGNLPNELLYGRVGYL--YSLIFINQQLQQEVIPAQYIQQVCDTVLASGHN--LSQRMRIVEQSPLMYEWYQEQYVGAAHGLTGIYYYLMQ-PGFMTDEGRLLALVKPSVDFVCRLKFPTGNYPPCVGD------ERDLLVHWCHGAPGIIYMLLQAYKVFGVQQYLEDAVRCGEVVWQRGLLKKGYGLCHGAAGNAYCFLSLYKLTQDPKYLYRTCMFADWCMNYG-KHGCRTPDTPFSLFEG 381          
BLAST of LanC-like protein 3-like protein vs. Ensembl Cavefish
Match: lancl1 (LanC antibiotic synthetase component C-like 1 (bacterial) [Source:NCBI gene;Acc:494154])

HSP 1 Score: 165.622 bits (418), Expect = 2.669e-46
Identity = 125/379 (32.98%), Postives = 186/379 (49.08%), Query Frame = 2
Query:  119 LNILNTCIKSLPPIAENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRV----PLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            L ++   +KS    A+  D   Y G+ G+  ALL++    +  D           F+++     ++  +  T S+++FL G+VG L VA  VY +L    EA +     +       P        +EL  G+ GYL  YS+I  +       +    +  + D+V+ SG    + QR R+    PLMY +Y  +Y+GA HGL GI + LM+ P ++ D   ++A+++  +D++  +    GN PP   D          L HWCHGA G IY    AY ++  ++YLE AV CG V+W+ GLLKKG G+CHG +G+ Y FL LY+LT D  YL R    S       F       D P  +  G AGT  F+ADL  P
Sbjct:   46 LAVMENGLKS----ADPRDCTGYTGWAGI--ALLYLHLHTVYGDPA---------FLQRAFDHVSRSLKCLTGSRVTFLCGDVGPLAVAAVVYHRLQRPQEAEECINRTVVKSTGNLP--------NELLYGRVGYL--YSLIFINQQLQQEVIPAQYIQQVCDTVLASGHN--LSQRMRIVEQSPLMYEWYQEQYVGAAHGLTGIYYYLMQ-PGFMTDEGRLLALVKPSVDFVCRLKFPTGNYPPCVGD------ERDLLVHWCHGAPGIIYMLLQAYKVFGVQQYLEDAVRCGEVVWQRGLLKKGYGLCHGAAGNAYCFLSLYKLTQDPKYLYRTCMVSEIKIKKKFAHPDNFYDFPLEIC-GMAGTIYFLADLLQP 389          
BLAST of LanC-like protein 3-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003909.1 (pep scaffold:Pmarinus_7.0:GL485580:10630:11486:-1 gene:ENSPMAG00000003582.1 transcript:ENSPMAT00000003909.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 4.650e-31
Identity = 56/101 (55.45%), Postives = 69/101 (68.32%), Query Frame = 2
Query:  944 LLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANC-FSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            LL  + +YL   V C  + W+ GLL KGPGICHGV+GS Y FLLL+RLT D  YL RA+  F+ FM S+ FK  ++  D+P+SLFEG AGTACF  DL  P
Sbjct:   17 LLSGEARYLAVCVRCAEIAWRRGLLNKGPGICHGVAGSAYVFLLLHRLTRDPKYLYRAHSRFAEFMFSEEFKAGSQPLDAPFSLFEGLAGTACFFLDLLQP 117          
BLAST of LanC-like protein 3-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006249.1 (pep scaffold:Pmarinus_7.0:GL477220:692:9560:-1 gene:ENSPMAG00000005656.1 transcript:ENSPMAT00000006249.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 8.602e-18
Identity = 75/252 (29.76%), Postives = 116/252 (46.03%), Query Frame = 2
Query:   41 RHFSNDYEDKV-LDLTSLDSSYLIEYSLNILNTCIKSLPPIAENEDG--------------GLYVGFIGLGYALLHIS--DSPLLSD----KRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEI----YRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYS-ILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLA 718
            R F+N ++D     L       L+     +L+      PP +   DG              GLY G  G+  AL   +  DS LL +    +R +  + A+   E    +  + ++  +++  +FLLG  G    A       G T  A   A  F  L  + QP  +    +R GSDELFVG+AG L    ++K    +L +E+  D   S +  ++V+SG++YA ++   VPLMY+YY TEYLG  H L+
Sbjct:    5 RGFTNRFDDLAGSPLPGRSREALLPLVTAMLDAIAGQAPPGSGEGDGVGKRAAAVSVAPAGGLYRGPAGMALALAFAAAPDSSLLPELDAGRRERYADAARRLAEASVEYAEEMEESGSETSAAFLLGGAGAFVAAALASGAAGRTAAAVGHAQSFARLHRELQPRAVTVRAHRLGSDELFVGRAGILCGALLLKR---RLGIEILTDEETSTVCQAIVDSGKEYAARKHKPVPLMYAYYGTEYLGTWHHLS 253          
BLAST of LanC-like protein 3-like protein vs. Ensembl Nematostella
Match: EDO42075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2P7])

HSP 1 Score: 301.982 bits (772), Expect = 7.032e-99
Identity = 178/409 (43.52%), Postives = 247/409 (60.39%), Query Frame = 2
Query:   35 STRHFSNDYEDKVLDLTSLDSSYLIEYSLNILNTCIKSLPPIAE-NEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGL--TNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLA-YSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPP--GTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            S+R+F+N Y+D   +L S D  Y+      IL    K+ PP +  N DGGLYVG  G+ YA  H++ S L  ++R +LLN A  +I+ +      K Q       SFLLG+VG   VA  +   LG   T E      + L   +  +PL+ ++ GSDELFVG+AGYL A   + ++ CS++  +     L+   D+ + SG+ YA + R    LMY+YY+ EYLGAGHGL+ IL  L+ FP +L  RP V + +++ +++++     NG+ PP  G   + R       L HWCHGA G +Y +A A+L+W  ++YL+AA+ CG V+W+ GLL+KGPGICHGV+G+GY FLLLYRLT D  YL R+  FS FM++  F Q AR PD PYSLFEG AGT CF ADL  P
Sbjct:    3 SSRYFTNRYKDYDGNLGSCD--YVRNLIPEILQKISKNCPPNSRSNRDGGLYVGPAGVAYAFYHVATSGLFDEQREKLLNTAWEYIQVRLELKTIKTQ-HGGIGASFLLGHVGVYTVAALISHALGKCHTKERDASIAKVLQYHEICKPLDFFKPGSDELFVGRAGYLCASLKLNQAFCSQVIPDAITAPLF---DATIQSGRYYAQRHRSASSLMYAYYDKEYLGAGHGLSSILQMLLSFPQFLTSRPEVESTLREAVEFVLRCE-RNGDYPPVPGKPKVNRSK--SHMLVHWCHGAPGVVYLFAKAFLVWKDQRYLQAALRCGEVVWERGLLRKGPGICHGVAGNGYVFLLLYRLTRDPKYLYRSYQFSDFMQTAEFTQGARTPDCPYSLFEGLAGTICFYADLMRP 402          
BLAST of LanC-like protein 3-like protein vs. Ensembl Nematostella
Match: EDO42198 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S296])

HSP 1 Score: 200.675 bits (509), Expect = 8.173e-60
Identity = 141/390 (36.15%), Postives = 210/390 (53.85%), Query Frame = 2
Query:   98 SYLIEYSLNILNTCIKSLPPIAENEDGGLYVGFIGLGYALLHISDSPLLSDK--RIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKF---QPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTV---VAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            S L E +L +L    + L    +  +  +Y G  G     LH++ +    DK  R   L+ A   +EQ        K L T  +++FL G+ G   +   +Y+KLG  +E+T+   E   + D+    Q L       DE+  G+AGYL  YS++         ++ +  +  I  +VV+SG   A   R + PLMY+++   YLGA HG+ GIL+ L++        P+V   ++ I++C+D+ +S+   +GN P    +         +L HWCHGA GAI+    A+ ++ +EKYL AA  CG VIW+ GLLKKG GICHGV+G+GYA L LY+ T++  YL RA  F+ + K D  K   R PD+P+SLFEG AGT  F+ADL  P
Sbjct:   34 SNLTEQALKMLRRYEEGLKSERDESNHSVYTGSGGAALLYLHLASTLFRDDKEKRECYLSSALQILEQAA------KNL-TGRRVTFLCGDAGIHAMLAVLYEKLGRHSESTRCIQELYKMTDRVLHDQSL------PDEVLYGRAGYL--YSLLHVQQEIGINKIDRALIDQICSAVVSSGLNLAKHLRHQSPLMYAWHGKHYLGAAHGIVGILYMLLQAVSC----PSVQSNLSTIEECIDFFLSLQFPSGNFPSSLGN------SSDKLVHWCHGAPGAIHLLLKAHKVFGKEKYLNAAQRCGEVIWRRGLLKKGYGICHGVAGNGYALLALYKATNESKYLYRAIKFADWCK-DYGKHGCRTPDTPFSLFEGMAGTVHFLADLIEP 397          
BLAST of LanC-like protein 3-like protein vs. Ensembl Nematostella
Match: EDO27790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8A4])

HSP 1 Score: 146.747 bits (369), Expect = 1.161e-42
Identity = 72/119 (60.50%), Postives = 88/119 (73.95%), Query Frame = 2
Query:  887 LTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            L HWCHGA G +Y +A  +L+W  ++YL+AA+ CG V+W+ GLL+KGPGICHG +G+GY FLLLYRLT D  YL R+  FS FM++  F Q AR PD PYSLFEG AGT CF ADL  P
Sbjct:    2 LVHWCHGAPGVVYLFAETFLVWKDQRYLQAALRCGEVVWERGLLRKGPGICHGGAGNGYVFLLLYRLTRDPKYLYRSYQFSDFMQTAEFTQGARTPDCPYSLFEGLAGTICFYADLMRP 120          
BLAST of LanC-like protein 3-like protein vs. Ensembl Medaka
Match: LANCL3 (LanC like 3 [Source:NCBI gene;Acc:101155066])

HSP 1 Score: 259.996 bits (663), Expect = 3.147e-82
Identity = 159/407 (39.07%), Postives = 235/407 (57.74%), Query Frame = 2
Query:   35 STRHFSNDYED-KVLDLTSLDSSYLIEYSLNILNTCIKSLPPIAENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLE-LAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLN--DRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            + R F+N + D K   L    +  ++   +  +   +K +P    + DGGLY G  G+ Y L H+S+ PL S+ R   L  AK  I+    + + +     + + +FLLG  G    A  +Y+ +GL +      T+F  L +   P+     GSDELFVG+AGYL A  V+K    KL +E L+KD + SI  +++ SG+QYA ++R   PLMYSYY TEYLGA HGL+ +L  L+ + D L+  DR     ++ Q +D++++    N N P    ++G      ++L HWCHGA G  Y +A AYL+  + +YL+  +  G ++W+ GLLKKGPGICHG++GS Y FLLLYRLT +  Y+ RA  F+ F+ ++ FK  +R   S YSLFEG +GT CF+ DL  P
Sbjct:    4 NNRCFANRFSDYKGALLPGQSAEIIVPAVVATVEKILKKVPVDVSDCDGGLYDGPAGVAYMLYHVSECPLFSEHREVYLKTAKQIIDVSVRYVDAEPD--KNMRAAFLLGGAGVYAAATMIYKAMGLADFVRPL-TKFRNLWEVCAPIHFLECGSDELFVGRAGYLCAALVLKQ---KLGIEILSKDQIKSICQAIIESGKQYARRKRKPFPLMYSYYGTEYLGAAHGLSSVLQMLLSYRDMLSGADRD----LVWQSVDFLMN-QEQNCNWPA---ELGTMIERENELVHWCHGAPGVAYLFAKAYLINKKPQYLDTCIRSGELVWQKGLLKKGPGICHGIAGSAYVFLLLYRLTGNSKYIYRAQRFAEFIFTEEFKAGSRSLTSIYSLFEGLSGTVCFLVDLLQP 396          
BLAST of LanC-like protein 3-like protein vs. Ensembl Medaka
Match: LANCL3 (LanC like 3 [Source:NCBI gene;Acc:101155066])

HSP 1 Score: 223.016 bits (567), Expect = 7.577e-68
Identity = 140/366 (38.25%), Postives = 209/366 (57.10%), Query Frame = 2
Query:   35 STRHFSNDYED-KVLDLTSLDSSYLIEYSLNILNTCIKSLPPIAENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLE-LAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLN--DRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRAN 1120
            + R F+N + D K   L    +  ++   +  +   +K +P    + DGGLY G  G+ Y L H+S+ PL S+ R   L  AK  I+    + + +     + + +FLLG  G    A  +Y+ +GL +      T+F  L +   P+     GSDELFVG+AGYL A  V+K    KL +E L+KD + SI  +++ SG+QYA ++R   PLMYSYY TEYLGA HGL+ +L  L+ + D L+  DR     ++ Q +D++++    N N P    ++G      ++L HWCHGA G  Y +A AYL+  + +YL+  +  G ++W+ GLLKKGPGICHG++GS Y FLLLYRLT +  Y+ RA 
Sbjct:    4 NNRCFANRFSDYKGALLPGQSAEIIVPAVVATVEKILKKVPVDVSDCDGGLYDGPAGVAYMLYHVSECPLFSEHREVYLKTAKQIIDVSVRYVDAEPD--KNMRAAFLLGGAGVYAAATMIYKAMGLADFVRPL-TKFRNLWEVCAPIHFLECGSDELFVGRAGYLCAALVLKQ---KLGIEILSKDQIKSICQAIIESGKQYARRKRKPFPLMYSYYGTEYLGAAHGLSSVLQMLLSYRDMLSGADRD----LVWQSVDFLMN-QEQNCNWPA---ELGTMIERENELVHWCHGAPGVAYLFAKAYLINKKPQYLDTCIRSGELVWQKGLLKKGPGICHGIAGSAYVFLLLYRLTGNSKYIYRAQ 355          
BLAST of LanC-like protein 3-like protein vs. Ensembl Medaka
Match: lancl1 (LanC like 1 [Source:NCBI gene;Acc:101159421])

HSP 1 Score: 177.178 bits (448), Expect = 1.696e-50
Identity = 122/367 (33.24%), Postives = 187/367 (50.95%), Query Frame = 2
Query:  161 AENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGS----DELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCR--VPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            A+  D  +Y G+ G+    LH+ D          +  +  +  +   Y     + L     ++FL G+ G L VA  VY ++    EA+   +         Q  ++   GS    DEL  G+ GYL  YS++  +       +    +  I ++V+ SG+  + K R +   PLM+ +Y  +Y+GA HGLAGI + LM+ P ++     V  +++  +D++  +   +GN PP   D          L HWCHG+ G IY    A+  +   +YLE A+ CG V+WK+GLLKKG G+CHG +G+ YAFL LYR T D  +L RA  F+ +  +   K   R PD+P+SLFEG AGT  F+AD+  P
Sbjct:   56 ADPGDATVYTGWAGIALLYLHLHD----------VFKEESFLHKALDYVSRSLQCLTRRHDVTFLCGDAGPLAVAAVVYSRMQRAQEASDCISRLA------QYHKVVVDGSSGLPDELLYGRVGYL--YSLVFVNQQLGGDRIPGQFIQQISETVLASGELLSRKFRVQNQSPLMFEWYQEQYVGAAHGLAGIYYFLMQ-PGFVPAVEHVHRLVKPSVDHVCRLKLPSGNYPPCIGD------ERDLLVHWCHGSPGVIYMLLQAHKAFGVPQYLEEALQCGEVVWKWGLLKKGYGLCHGAAGNAYAFLALYRQTQDPKHLFRACMFADWCMNYG-KHGCRTPDTPFSLFEGLAGTIYFLADILQP 396          
BLAST of LanC-like protein 3-like protein vs. Planmine SMEST
Match: SMESG000068028.1 (SMESG000068028.1)

HSP 1 Score: 746.503 bits (1926), Expect = 0.000e+0
Identity = 382/407 (93.86%), Postives = 385/407 (94.59%), Query Frame = 2
Query:   32 MSTRHFSNDYEDKVLDLTSLDSSYLIEYSLNILNTCIKSLPPIAENEDGGLYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMPGNG 1252
            MSTRHFSNDYEDKVL+LTSLDSSYLIEYSLNILNTCIKSLPPIAENEDGGLYVGFIGL                   LLNQAKYFIEQQTYFY+QKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRP VVAMIQQCLDYMISITPANGNLPPGTDDIGRKA PGSQLTHWCHGAAGAIYAYAIAYLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYL+RANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLA PGNG
Sbjct:    1 MSTRHFSNDYEDKVLNLTSLDSSYLIEYSLNILNTCIKSLPPIAENEDGGLYVGFIGL-------------------LLNQAKYFIEQQTYFYSQKKQLRTDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEIYRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPVVVAMIQQCLDYMISITPANGNLPPGTDDIGRKATPGSQLTHWCHGAAGAIYAYAIAYLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLHRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLATPGNG 388          
BLAST of LanC-like protein 3-like protein vs. Planmine SMEST
Match: SMESG000000888.1 (SMESG000000888.1)

HSP 1 Score: 135.191 bits (339), Expect = 4.289e-35
Identity = 89/262 (33.97%), Postives = 141/262 (53.82%), Query Frame = 2
Query:  497 DELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRV----PLMYSYYNTEYLGAGHGLAGILFALMKFPDYLND---------RPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            DE+  GK+GYL A  ++      + +++ K     +  +++ +G + A  +R  +    PL Y ++   YLGA HG++GI+F L++   YL++         +  V   I   ++++  +  + GN P    +  ++ +    L HWCHGA G I+ +  A+ ++    Y+E     G VIW+ GLL KG GICHG +G+GYAFL LY+ T+D  YL RA  F+ +    S  ++ R  D PYSLFEG AGT  F+ D   P
Sbjct:  154 DEMLYGKSGYLAALLILHKYDKAVDIQIIK----KVFKAIIIAGLRLAKIKRNEISNIPPLFYEWHGKPYLGAAHGISGIVFMLLQV--YLDESLIEIHSYLKQDVDDYIYPTIEFLCKLRLSTGNYPSSIGESSKRDV----LVHWCHGAPGWIHLFIAAHKVYKNPIYMERIQEIGEVIWQRGLLYKGCGICHGSAGNGYAFLALYQYTNDPKYLYRALRFAQWCTEYSTNRT-READRPYSLFEGLAGTLHFLIDCLDP 404          
BLAST of LanC-like protein 3-like protein vs. Planmine SMEST
Match: SMESG000000888.1 (SMESG000000888.1)

HSP 1 Score: 135.191 bits (339), Expect = 4.484e-35
Identity = 89/262 (33.97%), Postives = 141/262 (53.82%), Query Frame = 2
Query:  497 DELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQQYAIKQRCRV----PLMYSYYNTEYLGAGHGLAGILFALMKFPDYLND---------RPTVVAMIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHXXXXXXXXXXXXXLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLYRLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVADLAMP 1243
            DE+  GK+GYL A  ++      + +++ K     +  +++ +G + A  +R  +    PL Y ++   YLGA HG++GI+F L++   YL++         +  V   I   ++++  +  + GN P    +  ++ +    L HWCHGA G I+ +  A+ ++    Y+E     G VIW+ GLL KG GICHG +G+GYAFL LY+ T+D  YL RA  F+ +    S  ++ R  D PYSLFEG AGT  F+ D   P
Sbjct:  154 DEMLYGKSGYLAALLILHKYDKAVDIQIIK----KVFKAIIIAGLRLAKIKRNEISNIPPLFYEWHGKPYLGAAHGISGIVFMLLQV--YLDESLIEIHSYLKQDVDDYIYPTIEFLCKLRLSTGNYPSSIGESSKRDV----LVHWCHGAPGWIHLFIAAHKVYKNPIYMERIQEIGEVIWQRGLLYKGCGICHGSAGNGYAFLALYQYTNDPKYLYRALRFAQWCTEYSTNRT-READRPYSLFEGLAGTLHFLIDCLDP 404          
The following BLAST results are available for this feature:
BLAST of LanC-like protein 3-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LANCL37.916e-8338.94LanC like 3 [Source:HGNC Symbol;Acc:HGNC:24767][more]
LANCL35.052e-6838.42LanC like 3 [Source:HGNC Symbol;Acc:HGNC:24767][more]
LANCL35.052e-6838.42LanC like 3 [Source:HGNC Symbol;Acc:HGNC:24767][more]
LANCL18.304e-5332.93LanC like 1 [Source:HGNC Symbol;Acc:HGNC:6508][more]
LANCL18.304e-5332.93LanC like 1 [Source:HGNC Symbol;Acc:HGNC:6508][more]
back to top
BLAST of LanC-like protein 3-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LanC-like protein 3-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG20612.169e-6635.19gene:FBgn0027498 transcript:FBtr0073431[more]
CG20612.169e-6635.19gene:FBgn0027498 transcript:FBtr0332383[more]
CG20612.169e-6635.19gene:FBgn0027498 transcript:FBtr0073429[more]
back to top
BLAST of LanC-like protein 3-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lancl16.215e-5332.53LanC antibiotic synthetase component C-like 1 (bac... [more]
lancl25.733e-4931.25LanC lantibiotic synthetase component C-like 2 (ba... [more]
back to top
BLAST of LanC-like protein 3-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adam113.585e-7940.44ADAM metallopeptidase domain 11 [Source:Xenbase;Ac... [more]
uox5.749e-5334.79urate oxidase [Source:Xenbase;Acc:XB-GENE-5811053][more]
uox1.417e-5234.79urate oxidase [Source:Xenbase;Acc:XB-GENE-5811053][more]
uox2.848e-5234.79urate oxidase [Source:Xenbase;Acc:XB-GENE-5811053][more]
uox3.449e-5234.79urate oxidase [Source:Xenbase;Acc:XB-GENE-5811053][more]
back to top
BLAST of LanC-like protein 3-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lancl37.053e-8238.85LanC lantibiotic synthetase component C-like 3 (ba... [more]
Lancl21.442e-5434.60LanC (bacterial lantibiotic synthetase component C... [more]
Lancl21.656e-5434.60LanC (bacterial lantibiotic synthetase component C... [more]
Lancl21.656e-5434.60LanC (bacterial lantibiotic synthetase component C... [more]
Lancl18.140e-5332.21LanC (bacterial lantibiotic synthetase component C... [more]
back to top
BLAST of LanC-like protein 3-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZV70|LANC3_HUMAN3.801e-8238.94LanC-like protein 3 OS=Homo sapiens OX=9606 GN=LAN... [more]
sp|Q8CD19|LANC3_MOUSE4.934e-8138.85LanC-like protein 3 OS=Mus musculus OX=10090 GN=La... [more]
sp|Q29HZ1|LANC3_DROPS1.045e-6734.21LanC-like protein 3 homolog OS=Drosophila pseudoob... [more]
sp|Q9Y0Y7|LANC3_DROME2.175e-6535.19LanC-like protein 3 homolog OS=Drosophila melanoga... [more]
sp|F1MVX2|LANC1_BOVIN1.993e-5434.21Glutathione S-transferase LANCL1 OS=Bos taurus OX=... [more]
back to top
BLAST of LanC-like protein 3-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074ZSX21.508e-10847.10Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4S2MCN12.088e-10847.10Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A419PLM42.582e-10349.33LanC-like protein 3-like protein (Fragment) OS=Clo... [more]
A0A5J4P0A26.159e-10344.79Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A504Y8Y15.235e-10043.68Lanthionine synthetase c like protein 1 OS=Fasciol... [more]
back to top
BLAST of LanC-like protein 3-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lancl22.557e-5232.88LanC like 2 [Source:NCBI gene;Acc:103034499][more]
lancl23.568e-5232.88LanC like 2 [Source:NCBI gene;Acc:103034499][more]
lancl25.524e-5232.88LanC like 2 [Source:NCBI gene;Acc:103034499][more]
lancl11.200e-4934.06LanC antibiotic synthetase component C-like 1 (bac... [more]
lancl12.669e-4632.98LanC antibiotic synthetase component C-like 1 (bac... [more]
back to top
BLAST of LanC-like protein 3-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003909.14.650e-3155.45pep scaffold:Pmarinus_7.0:GL485580:10630:11486:-1 ... [more]
ENSPMAT00000006249.18.602e-1829.76pep scaffold:Pmarinus_7.0:GL477220:692:9560:-1 gen... [more]
back to top
BLAST of LanC-like protein 3-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LanC-like protein 3-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO420757.032e-9943.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421988.173e-6036.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277901.161e-4260.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LanC-like protein 3-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
LANCL33.147e-8239.07LanC like 3 [Source:NCBI gene;Acc:101155066][more]
LANCL37.577e-6838.25LanC like 3 [Source:NCBI gene;Acc:101155066][more]
lancl11.696e-5033.24LanC like 1 [Source:NCBI gene;Acc:101159421][more]
back to top
BLAST of LanC-like protein 3-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000068028.10.000e+093.86SMESG000068028.1[more]
SMESG000000888.14.289e-3533.97SMESG000000888.1[more]
SMESG000000888.14.484e-3533.97SMESG000000888.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026858 ID=SMED30026858|Name=LanC-like protein 3-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1352bp
CTATATAAATCTTATATGTTATTGACAGAACATGTCGACTAGACATTTTT
CCAATGATTATGAAGATAAAGTATTGGATTTAACGTCTCTAGATTCATCA
TATTTAATCGAATATTCTCTCAATATTTTAAATACTTGCATCAAAAGTTT
GCCTCCAATTGCCGAAAATGAAGATGGGGGTCTTTACGTTGGATTTATTG
GATTGGGTTATGCATTATTGCATATTTCTGATTCACCTTTGCTATCTGAC
AAAAGAATCCAGTTGTTAAATCAGGCAAAATATTTCATTGAGCAACAAAC
GTATTTTTATAATCAAAAGAAACAATTACGAACTGATTCAAAATTGTCAT
TTCTGCTCGGCAATGTTGGAACTTTATGCGTTGCTGTCAATGTTTATCAA
AAATTAGGTCTCACTAACGAAGCAACTCAATTTGCAACGGAGTTTCTAGC
TCTCGGAGACAAATTTCAACCTTTGGAAATCTATCGCACGGGATCAGATG
AGTTATTTGTCGGCAAGGCCGGTTATTTGTTGGCCTATTCGGTGATTAAG
TCAAGCTGTTCTAAATTATCGCTTGAACTTGCTAAAGATACGTTATACAG
TATTTTGGATAGCGTTGTGAATTCTGGACAACAGTACGCTATCAAACAGA
GATGCCGTGTACCTCTTATGTACTCTTATTACAACACCGAATATTTAGGA
GCCGGGCATGGATTGGCAGGAATCTTGTTTGCTTTAATGAAATTTCCCGA
CTATTTAAACGATAGACCTACAGTTGTTGCTATGATTCAGCAGTGCCTTG
ATTATATGATTTCAATTACCCCAGCCAATGGCAATTTACCCCCGGGAACC
GATGATATTGGGCGTAAAGCAATTCCTGGTAGTCAGTTAACACACTGGTG
TCATGGCGCAGCAGGGGCTATTTATGCTTACGCTATAGCATATTTATTGT
GGCATCAAGAGAAATATTTAGAAGCTGCGGTAAACTGTGGCAACGTAATT
TGGAAATATGGCCTATTAAAAAAGGGACCCGGAATTTGTCATGGGGTATC
TGGCAGTGGATATGCTTTTCTATTACTCTATCGGTTGACATCGGATGAAA
TTTATCTCAACCGAGCAAACTGTTTCTCCAGTTTCATGAAGTCCGATAGC
TTTAAACAGAGCGCTCGTGTTCCCGATAGTCCGTATTCCTTGTTTGAAGG
GTGGGCTGGAACGGCTTGCTTTGTTGCTGATTTAGCAATGCCCGGAAATG
GGTTTTTTCCATTTTTTGATGTTTTCAATTAATAATATTATTATCATTAT
ATTGTCATTCGTTATGAGGTTTAATATGAATAATTTAATGTTTGTTCTCA
AA
back to top

protein sequence of SMED30026858-orf-1

>SMED30026858-orf-1 ID=SMED30026858-orf-1|Name=SMED30026858-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=417bp
MSTRHFSNDYEDKVLDLTSLDSSYLIEYSLNILNTCIKSLPPIAENEDGG
LYVGFIGLGYALLHISDSPLLSDKRIQLLNQAKYFIEQQTYFYNQKKQLR
TDSKLSFLLGNVGTLCVAVNVYQKLGLTNEATQFATEFLALGDKFQPLEI
YRTGSDELFVGKAGYLLAYSVIKSSCSKLSLELAKDTLYSILDSVVNSGQ
QYAIKQRCRVPLMYSYYNTEYLGAGHGLAGILFALMKFPDYLNDRPTVVA
MIQQCLDYMISITPANGNLPPGTDDIGRKAIPGSQLTHWCHGAAGAIYAY
AIAYLLWHQEKYLEAAVNCGNVIWKYGLLKKGPGICHGVSGSGYAFLLLY
RLTSDEIYLNRANCFSSFMKSDSFKQSARVPDSPYSLFEGWAGTACFVAD
LAMPGNGFFPFFDVFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR0123416hp_glycosidase-like_sf
IPR007822LANC-like
IPR020464LanC-like_prot_euk
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007822Lanthionine synthetase C-likePRINTSPR01950LANCSUPERcoord: 172..189
score: 47.63
coord: 9..25
score: 51.95
coord: 121..134
score: 52.65
coord: 74..94
score: 40.29
IPR007822Lanthionine synthetase C-likeSMARTSM01260LANC_like_2coord: 1..202
e-value: 7.5E-22
score: 88.6
IPR007822Lanthionine synthetase C-likePFAMPF05147LANC_likecoord: 1..200
e-value: 8.3E-46
score: 156.2
IPR020464LanC-like protein, eukaryoticPRINTSPR01951LANCEUKARYTEcoord: 137..155
score: 49.56
coord: 91..112
score: 44.7
coord: 188..202
score: 40.28
coord: 48..63
score: 25.78
IPR020464LanC-like protein, eukaryoticCDDcd04794euk_LANCLcoord: 1..198
e-value: 2.589E-75
score: 228.365
IPR012341Six-hairpin glycosidase-like superfamilyGENE3DG3DSA:1.50.10.10coord: 1..202
e-value: 1.9E-76
score: 259.4
NoneNo IPR availablePANTHERPTHR12736LANC-LIKE PROTEINcoord: 1..202
NoneNo IPR availablePANTHERPTHR12736:SF7LANC-LIKE PROTEIN 3coord: 1..202
NoneNo IPR availableSUPERFAMILYSSF158745LanC-likecoord: 1..202