LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like

Overview
NameLOW QUALITY PROTEIN: SCAN domain-containing protein 3-like
Smed IDSMED30026853
Length (bp)1027
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like (SMED30026853) t-SNE clustered cells

Violin plots show distribution of expression levels for LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like (SMED30026853) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like (SMED30026853) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like (SMED30026853) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026853

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30026853SMESG000072525.1 dd_Smed_v4_4077_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 70.4774 bits (171), Expect = 1.187e-12
Identity = 42/145 (28.97%), Postives = 70/145 (48.28%), Query Frame = 3
Query:  378 SVKEHFKIFEEEISRYFPNLADT------PFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQ 794
            ++ +H +     + +YFP   D       PF +   P  +   D     +E  I+L ++ + K +FS +S+  FW   +     ++   +R+LLPF T  LCE GFS     K+KYR RL A   +R       +R+S++  NI+
Sbjct:  548 AIVQHLRGLRATLLKYFPVTNDNNAWVRNPFTVTVKPASLVARD-----YESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARRAVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMR-------IRLSNITPNIK 680          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 70.4774 bits (171), Expect = 1.187e-12
Identity = 42/145 (28.97%), Postives = 70/145 (48.28%), Query Frame = 3
Query:  378 SVKEHFKIFEEEISRYFPNLADT------PFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQ 794
            ++ +H +     + +YFP   D       PF +   P  +   D     +E  I+L ++ + K +FS +S+  FW   +     ++   +R+LLPF T  LCE GFS     K+KYR RL A   +R       +R+S++  NI+
Sbjct:  548 AIVQHLRGLRATLLKYFPVTNDNNAWVRNPFTVTVKPASLVARD-----YESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARRAVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMR-------IRLSNITPNIK 680          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 69.707 bits (169), Expect = 2.609e-12
Identity = 55/158 (34.81%), Postives = 78/158 (49.37%), Query Frame = 3
Query:  366 RKIISVKEHFKIFEEEISRYFPNLAD---------TPFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDF-SSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            RK+IS  EH     E    YFP+  D          PF      L + V        ++ ++L T++  K  F ++ S+  FWIK       ++EI L+LLL FP+T LCE GFS+L V+K+K+R+ L     LR AL+    R+  L    QA  SH
Sbjct: 1024 RKVIS--EHLTNLLECFEFYFPSKEDPRIGNLWIQNPFLSSKDNLNLTV-----TLQDKLLKLATDEGLKISFENTASLPSFWIKAKNDYPELAEIALKLLLLFPSTYLCETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTSKKQAHLSH 1174          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 69.707 bits (169), Expect = 2.676e-12
Identity = 55/158 (34.81%), Postives = 78/158 (49.37%), Query Frame = 3
Query:  366 RKIISVKEHFKIFEEEISRYFPNLAD---------TPFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDF-SSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            RK+IS  EH     E    YFP+  D          PF      L + V        ++ ++L T++  K  F ++ S+  FWIK       ++EI L+LLL FP+T LCE GFS+L V+K+K+R+ L     LR AL+    R+  L    QA  SH
Sbjct: 1175 RKVIS--EHLTNLLECFEFYFPSKEDPRIGNLWIQNPFLSSKDNLNLTV-----TLQDKLLKLATDEGLKISFENTASLPSFWIKAKNDYPELAEIALKLLLLFPSTYLCETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTSKKQAHLSH 1325          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Human
Match: FAM200B (family with sequence similarity 200 member B [Source:HGNC Symbol;Acc:HGNC:27740])

HSP 1 Score: 68.1662 bits (165), Expect = 5.745e-12
Identity = 45/120 (37.50%), Postives = 68/120 (56.67%), Query Frame = 3
Query:  447 PFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPS 806
            PFA      II +  VPE  +E  ++L ++   KND+ ++S++ FW+K      ++S   + LLLPF TT LCE+GFS L  +K+K R+ L     +R AL+      ++L  N QA PS
Sbjct:  540 PFAFRHPESIIELNLVPEEENE-LLQLSSSYTLKNDYETLSLSAFWMKVKEDFPLLSRKSVLLLLPFTTTSLCELGFSILTQLKTKERNGLNCAAVMRVALSSCVPDWNELM-NRQAHPS 657          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 195.667 bits (496), Expect = 3.802e-56
Identity = 94/146 (64.38%), Postives = 111/146 (76.03%), Query Frame = 3
Query:  372 IISVKEHFKIFEEEISRYFPNLADTPFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            +ISVKEH  +   EIS YFPNL + PFAL  SP  ++ EDVPE A E+F  L  +D A+ DFS+M +T+FW+K L S  V+SE++LRLLLPFPTT LCE GFSSLLV+KSKYRSRLV EDDLRCALA T  RISDL R  Q+QPSH
Sbjct:  611 VISVKEHLDMLASEISWYFPNLPEIPFALARSPFSVKAEDVPETAQEDFTRLTNSDAARADFSTMPVTQFWVKCLQSYPVLSEMVLRLLLPFPTTYLCETGFSSLLVIKSKYRSRLVVEDDLRCALAKTTPRISDLVRKKQSQPSH 756          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 53.5286 bits (127), Expect = 2.692e-7
Identity = 36/109 (33.03%), Postives = 55/109 (50.46%), Query Frame = 3
Query:  462 TSPLIIRVEDVPENAHEEFIELITNDEA-KNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLAR 785
            T P      +   ++ EE + +++ D   ++   SMS+T+FW+    S   + E  L+LLLPF +TCLC+  FS+L    SK R        LR A+     RI  LA+
Sbjct: 1140 TDPFATYHSNNLTDSEEEKLAVLSADTGFQSVHKSMSVTQFWVNAKTSYPKLHEKALKLLLPFSSTCLCDATFSALTA--SKQRDLRTCGPTLRLAVTSLVPRIEKLAK 1246          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 53.5286 bits (127), Expect = 2.927e-7
Identity = 36/109 (33.03%), Postives = 55/109 (50.46%), Query Frame = 3
Query:  462 TSPLIIRVEDVPENAHEEFIELITNDEA-KNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLAR 785
            T P      +   ++ EE + +++ D   ++   SMS+T+FW+    S   + E  L+LLLPF +TCLC+  FS+L    SK R        LR A+     RI  LA+
Sbjct: 1048 TDPFATYHSNNLTDSEEEKLAVLSADTGFQSVHKSMSVTQFWVNAKTSYPKLHEKALKLLLPFSSTCLCDATFSALTA--SKQRDLRTCGPTLRLAVTSLVPRIEKLAK 1154          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. UniProt/SwissProt
Match: sp|A4Z944|ZBED5_CANLF (Zinc finger BED domain-containing protein 5 OS=Canis lupus familiaris OX=9615 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 4.803e-12
Identity = 42/145 (28.97%), Postives = 70/145 (48.28%), Query Frame = 3
Query:  378 SVKEHFKIFEEEISRYFPNLADT------PFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQ 794
            ++ +H +     + +YFP   D       PF +   P  +   D     +E  I+L ++ + K +FS +S+  FW   +     ++   +R+LLPF T  LCE GFS     K+KYR RL A   +R       +R+S++  NI+
Sbjct:  549 AIVQHLRGLRSTLLKYFPVTNDNNTWVRNPFTVTVKPASLVARD-----YESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARRAVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMR-------IRLSNITPNIK 681          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. UniProt/SwissProt
Match: sp|Q49AG3|ZBED5_HUMAN (Zinc finger BED domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBED5 PE=2 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 5.702e-12
Identity = 42/145 (28.97%), Postives = 70/145 (48.28%), Query Frame = 3
Query:  378 SVKEHFKIFEEEISRYFPNLADT------PFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQ 794
            ++ +H +     + +YFP   D       PF +   P  +   D     +E  I+L ++ + K +FS +S+  FW   +     ++   +R+LLPF T  LCE GFS     K+KYR RL A   +R       +R+S++  NI+
Sbjct:  548 AIVQHLRGLRATLLKYFPVTNDNNAWVRNPFTVTVKPASLVARD-----YESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARRAVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMR-------IRLSNITPNIK 680          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. UniProt/SwissProt
Match: sp|A4Z943|ZBED5_BOVIN (Zinc finger BED domain-containing protein 5 OS=Bos taurus OX=9913 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 9.648e-12
Identity = 42/145 (28.97%), Postives = 69/145 (47.59%), Query Frame = 3
Query:  378 SVKEHFKIFEEEISRYFPNLAD------TPFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQ 794
            ++ +H +     + +YFP   D       PF +   P  +   D     +E  I+L ++ + K  FS +S+  FW   +     ++   +R+LLPF T  LCE GFS     K+KYR RL A   +R       +R+S++  NI+
Sbjct:  549 AIVQHLRGLRSTLLKYFPVTNDIHAWVRNPFTVTVKPASLVARD-----YESLIDLTSDSQVKQSFSELSLNDFWSSLIQEYPSVARRAVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMR-------IRLSNITPNIK 681          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. UniProt/SwissProt
Match: sp|Q6R2W3|SCND3_HUMAN (SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBED9 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.285e-11
Identity = 55/158 (34.81%), Postives = 78/158 (49.37%), Query Frame = 3
Query:  366 RKIISVKEHFKIFEEEISRYFPNLAD---------TPFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDF-SSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            RK+IS  EH     E    YFP+  D          PF      L + V        ++ ++L T++  K  F ++ S+  FWIK       ++EI L+LLL FP+T LCE GFS+L V+K+K+R+ L     LR AL+    R+  L    QA  SH
Sbjct: 1175 RKVIS--EHLTNLLECFEFYFPSKEDPRIGNLWIQNPFLSSKDNLNLTV-----TLQDKLLKLATDEGLKISFENTASLPSFWIKAKNDYPELAEIALKLLLLFPSTYLCETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTSKKQAHLSH 1325          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. UniProt/SwissProt
Match: sp|P0CF97|F200B_HUMAN (Protein FAM200B OS=Homo sapiens OX=9606 GN=FAM200B PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.759e-11
Identity = 45/120 (37.50%), Postives = 68/120 (56.67%), Query Frame = 3
Query:  447 PFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPS 806
            PFA      II +  VPE  +E  ++L ++   KND+ ++S++ FW+K      ++S   + LLLPF TT LCE+GFS L  +K+K R+ L     +R AL+      ++L  N QA PS
Sbjct:  540 PFAFRHPESIIELNLVPEEENE-LLQLSSSYTLKNDYETLSLSAFWMKVKEDFPLLSRKSVLLLLPFTTTSLCELGFSILTQLKTKERNGLNCAAVMRVALSSCVPDWNELM-NRQAHPS 657          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. TrEMBL
Match: A0A1W3JIG6 (LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like OS=Ciona intestinalis OX=7719 GN=LOC101242717 PE=4 SV=2)

HSP 1 Score: 204.912 bits (520), Expect = 2.973e-57
Identity = 106/142 (74.65%), Postives = 115/142 (80.99%), Query Frame = 3
Query:  384 KEHFKIFEEEISRYFPNLADTPFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            +E+  IFEEEISRY P   DTPFAL  SP  IRVEDVPENA EEFIELIT+D AK DFSSMS+TKFWIK L S  V+SEI LRL+L FPTT LCE GFSSLLV+KSKYRSRL  EDDLRCALA TA RISDLA+  QA+PSH
Sbjct:  443 EENDXIFEEEISRYLP---DTPFALARSPFTIRVEDVPENAQEEFIELITSDAAKTDFSSMSVTKFWIKSLQSYPVLSEIALRLILSFPTTYLCETGFSSLLVIKSKYRSRLDVEDDLRCALAKTAPRISDLAKKKQAKPSH 581          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. TrEMBL
Match: A0A0C2J4D3 (Uncharacterized protein OS=Thelohanellus kitauei OX=669202 GN=RF11_15183 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 3.098e-57
Identity = 99/149 (66.44%), Postives = 116/149 (77.85%), Query Frame = 3
Query:  363 NRKIISVKEHFKIFEEEISRYFPNLADTPFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            N  II++KEHF +  +EIS YFPNL  TPFAL  SPL + V DVPE++ EEFIELI +D AK DFSSMSI++FWIK LPS  VMSE++LRLLLPFPTT LCE  F SLL +KSK R+RL AEDDLRCALA+T  RI+DL +  QAQPS 
Sbjct:   20 NIMIITIKEHFHMLTDEISLYFPNLPYTPFALIRSPLSVNVGDVPESSQEEFIELINSDAAKTDFSSMSISQFWIKCLPSYPVMSEMVLRLLLPFPTTYLCESAFFSLLFIKSKQRARLDAEDDLRCALAITIPRIADLVKMKQAQPSR 168          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. TrEMBL
Match: G1KUE3 (Uncharacterized protein OS=Anolis carolinensis OX=28377 PE=4 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 4.338e-57
Identity = 100/146 (68.49%), Postives = 114/146 (78.08%), Query Frame = 3
Query:  372 IISVKEHFKIFEEEISRYFPNLADTPFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            +ISVKEH ++  +EIS YFPNL DTPFAL  SP  +RVEDVPE A +EFIE I +D  + DFS M +TKFWIK LPS  V+SE +LRLLLPFPTT LCE GFSSLLV+KS+YRS LV ED LRCALA TA RISDL R  Q+QPSH
Sbjct:  447 LISVKEHLRMLADEISLYFPNLPDTPFALARSPFTVRVEDVPETAQKEFIEFINSDAVRTDFSRMPVTKFWIKCLPSYPVLSETVLRLLLPFPTTYLCETGFSSLLVIKSQYRSSLVVEDYLRCALAKTAPRISDLVRKKQSQPSH 592          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. TrEMBL
Match: A0A2D4KAW6 (Dimer_Tnp_hAT domain-containing protein OS=Micrurus paraensis OX=1970185 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.631e-56
Identity = 93/137 (67.88%), Postives = 107/137 (78.10%), Query Frame = 3
Query:  399 IFEEEISRYFPNLADTPFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            +  +EIS YFPNL DTPFAL  SP  ++VEDVPE A EEFI+LI ND A+ DFS+M +TKFWIK L    ++SE +LRLLLPFPTT LCE GFSSLLV+KSKYRSRLV E+DLRCALA TA RIS+L    Q QPSH
Sbjct:    1 MLADEISSYFPNLPDTPFALARSPFTVKVEDVPETAQEEFIDLINNDAARTDFSTMPLTKFWIKCLQLYPILSETVLRLLLPFPTTYLCETGFSSLLVIKSKYRSRLVVENDLRCALAKTAPRISELVSKKQPQPSH 137          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. TrEMBL
Match: G3I2L6 (SCAN domain-containing protein 3 OS=Cricetulus griseus OX=10029 GN=I79_017654 PE=4 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 1.810e-53
Identity = 94/146 (64.38%), Postives = 112/146 (76.71%), Query Frame = 3
Query:  372 IISVKEHFKIFEEEISRYFPNLADTPFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            IIS+K+H  +  +EIS YFPNL D PFAL  SP  + VED+PE A EEFIEL+ +D A+ DFS++ +T+FWIK L S  V+SE +LRLLLPFPTT LCE GFSSLLV+KSKYR RL  E+DLRCALA T  RISDL R  Q+QPSH
Sbjct:  455 IISMKKHLHMLAQEISWYFPNLPDVPFALARSPFTVNVEDIPEPAQEEFIELVNSDAARTDFSTLPVTQFWIKCLQSYPVLSETVLRLLLPFPTTYLCEKGFSSLLVIKSKYRRRLAVENDLRCALAKTTPRISDLVRKKQSQPSH 600          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Cavefish
Match: ENSAMXT00000051422.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:35461191:35465166:-1 gene:ENSAMXG00000032672.1 transcript:ENSAMXT00000051422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 1.574e-17
Identity = 51/145 (35.17%), Postives = 75/145 (51.72%), Query Frame = 3
Query:  387 EHFKIFEEEISRYFPNLADTPFALPTSPLI----IRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            EH +  + ++  YFP L D  F+   +P +      +  +  +  +  I+L  +   K  FS  S+  FW+        +S+  +R L+PFPTT LCE GFS L+V+K+KYR+RL  E DLR  L+     I  L    Q QPSH
Sbjct:  528 EHLQSLKMQLRDYFPAL-DVHFSWIENPFVDICQGAIASLSASEEDRLIDLSCDSALKLIFSQKSLVNFWLHARSEYPDLSDKAVRFLMPFPTTYLCETGFSMLVVLKTKYRNRLNVEPDLRLQLSALQPDIHHLVAGKQHQPSH 671          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Cavefish
Match: ENSAMXT00000044261.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000070.1:2279767:2281653:1 gene:ENSAMXG00000037161.1 transcript:ENSAMXT00000044261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 1.771e-17
Identity = 53/149 (35.57%), Postives = 76/149 (51.01%), Query Frame = 3
Query:  387 EHFKIFEEEISRYFPNLADTPFALPTSPLIIRVEDVPENA--------HEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            EH +  + ++  YFP L D  F+   +P +    D+ + A         +  I+L  +   K  FS  S+  FW+        +S+  +R L+PFPTT LCE GFS L+V+K+KYR+RL  E DLR  L+     I  L    Q QPSH
Sbjct:  485 EHLQSLKMQLRDYFPAL-DVHFSWIENPFV----DICQGAFASLSASEEDRLIDLSCDSALKFIFSQKSLVNFWLHARSEYPDLSDKAVRFLMPFPTTYLCETGFSMLVVLKTKYRNRLNVEPDLRLQLSALQPDIHHLVAGKQHQPSH 628          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Medaka
Match: ENSORLT00000040389.1 (pep primary_assembly:ASM223467v1:19:265767:268275:-1 gene:ENSORLG00000025045.1 transcript:ENSORLT00000040389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 7.562e-13
Identity = 42/149 (28.19%), Postives = 74/149 (49.66%), Query Frame = 3
Query:  381 VKEHFKIFEEEISRYFP------NLADTPFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            +KEH         +YFP      +    PF  P        E+      ++FI++ ++   +  F+S ++++FW+       ++ +  + +LLPF T+ LCE GFS++  +K+KYRS+L  E +LR A++    R   L    +A  SH
Sbjct:  470 IKEHISSLIGFFKKYFPENSSQYDWVRDPFNAPAPTSFSSAEE------DQFIDMTSDSTLRLRFTSQTLSEFWLNVERQYPLLGQRAMGILLPFATSYLCETGFSAVAALKTKYRSQLNIEQELRVAVSCFKPRFEKLCTAKRAHCSH 612          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Medaka
Match: ENSORLT00000035512.1 (pep primary_assembly:ASM223467v1:11:22712371:22714941:1 gene:ENSORLG00000026495.1 transcript:ENSORLT00000035512.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 7.841e-13
Identity = 42/149 (28.19%), Postives = 74/149 (49.66%), Query Frame = 3
Query:  381 VKEHFKIFEEEISRYFP------NLADTPFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            +KEH         +YFP      +    PF  P        E+      ++FI++ ++   +  F+S ++++FW+       ++ +  + +LLPF T+ LCE GFS++  +K+KYRS+L  E +LR A++    R   L    +A  SH
Sbjct:  470 IKEHISSLIGFFKKYFPENSSQYDWVRDPFNAPAPTSFSSAEE------DQFIDMTSDSTLRLRFTSQTLSEFWLNVERQYPLLGQRAMGILLPFATSYLCETGFSAVAALKTKYRSQLNIEQELRVAVSCFKPRFEKLCTAKRAHCSH 612          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Medaka
Match: ENSORLT00000033301.1 (pep primary_assembly:ASM223467v1:24:1653567:1654763:-1 gene:ENSORLG00000025431.1 transcript:ENSORLT00000033301.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 4.262e-12
Identity = 42/151 (27.81%), Postives = 74/151 (49.01%), Query Frame = 3
Query:  372 IISVKEHFKIFEEEISRYFP------NLADTPFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPS 806
            I  +KEH         +YFP      +    PF  P        E+      ++FI++ ++   +  F+S ++++FW+       ++ +  + +LLPF T+ LCE GFS++  +K+KYRS+L  E +LR A++    R   L    +A  S
Sbjct:  251 IPHIKEHISSLIGFFKKYFPENSSQYDWVRDPFNAPAPTSFSSAEE------DQFIDMTSDSTLRLRFTSQTLSEFWLNVERQYPLLGQRAMGILLPFATSYLCETGFSAVAALKTKYRSQLNIEQELRVAVSCFKPRFEKLCTAKRAHCS 395          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Medaka
Match: ENSORLT00000030244.1 (pep primary_assembly:ASM223467v1:13:28104458:28106771:-1 gene:ENSORLG00000022768.1 transcript:ENSORLT00000030244.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 1.361e-11
Identity = 44/150 (29.33%), Postives = 71/150 (47.33%), Query Frame = 3
Query:  378 SVKEHFKIFEEEISRYFPNLADTPFALPTSPLIIRVED----VPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVA--EDDLRCALAMTALRISDLARNIQAQPSH 809
            SV +H     E+ + YFP            P  +   +    +P +   + +E+ T+   K  +  + +  FWI       +++   +++LLPF TT LCE GFS++   K+K RSRL A  E  LR +L+    R+  +    QAQ SH
Sbjct:  320 SVSQHLSQLAEKFAEYFPEDPREGHMWVVDPFSVDPTENDVALPSHLESQLLEVSTDSTLKGQWGKLDLGSFWIVVSKEYPLLALRAVKVLLPFTTTYLCESGFSTVATTKTKARSRLRASLEATLRVSLSPIPPRLDLIRSKRQAQVSH 469          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Medaka
Match: ENSORLT00000032459.1 (pep primary_assembly:ASM223467v1:8:14240678:14247355:1 gene:ENSORLG00000024991.1 transcript:ENSORLT00000032459.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 7.017e-10
Identity = 42/149 (28.19%), Postives = 68/149 (45.64%), Query Frame = 3
Query:  378 SVKEHFKIFEEEISRYFPNLADTPFALPTSPLIIRVED----VPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVA--EDDLRCALAMTALRISDLARNIQAQPS 806
            SV +H      + + YFP            P  +   +    +P +   + +E+ T+   K  +  + +  FWI       +++    ++LLPF TT LCE GFS++   K+K RSRL A  E  LR +L+    R+  +    QAQ S
Sbjct:  449 SVSQHLSHLANKFAEYFPEDPREGHMWVVDPFSVDPTENDVALPSHLESQLLEVSTDSTLKGQWGKLDLGSFWIVVSKEYPLLALRAFKVLLPFTTTYLCESGFSTVATTKTKARSRLRASLEATLRVSLSPIPPRLDLIMSKRQAQKS 597          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Planmine SMEST
Match: SMESG000080396.1 (SMESG000080396.1)

HSP 1 Score: 97.0561 bits (240), Expect = 4.415e-31
Identity = 49/68 (72.06%), Postives = 54/68 (79.41%), Query Frame = 1
Query:  484 LKMSPRMHMRNSLNSLPTMKQKMISLQCQLPNSGSSICLHVMLCLRSFCACFFLFQQHAFVK*AFQAC 687
            ++ SPRMH RNSLNSL  M+ KMIS QCQLPNS SSI  HV+ CLRS CACFFL QQH F+K AFQAC
Sbjct:   80 VEESPRMHKRNSLNSLSAMQLKMISFQCQLPNSVSSIFPHVLFCLRSSCACFFLLQQHTFMKQAFQAC 147          

HSP 2 Score: 56.6102 bits (135), Expect = 4.415e-31
Identity = 28/46 (60.87%), Postives = 33/46 (71.74%), Query Frame = 3
Query:  363 NRKIISVKEHFKIFEEEISRYFPNLADTPFALPTSPLIIRVEDVPE 500
            NR I+SV  +FKI +E ISRYFPNL DT F+L  SP  IRVE+ P 
Sbjct:   41 NRTILSVNGNFKILDE-ISRYFPNLPDTQFSLTRSPFTIRVEESPR 85          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Planmine SMEST
Match: SMESG000006260.1 (SMESG000006260.1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.901e-16
Identity = 46/146 (31.51%), Postives = 75/146 (51.37%), Query Frame = 3
Query:  381 VKEHFKIFEEEISRYFPNLADTPFALPTSPLIIRVEDVPENAHEE--FIELITNDEAKNDFSS-MSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            +  H     ++ S YF +L  + +    +P +I   D      E+   I+L ++   K  F    +I  FW++       ++   L +LLPF T+ LCEIGFS++ V+K+KY+S L+ E +LR A++    R   +    QAQPSH
Sbjct:   56 INNHLTSLWKQFSLYFKDLDISKYEWIRNPFVIEKYDFGLTIAEQEMIIDLSSDSTLKQMFQDENNIVTFWLRVKDDFPTLTNKYLEILLPFVTSYLCEIGFSTVAVLKTKYQSGLMIEKELRTAISSMISRFEKICAEKQAQPSH 201          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Planmine SMEST
Match: SMESG000029188.1 (SMESG000029188.1)

HSP 1 Score: 77.411 bits (189), Expect = 2.804e-15
Identity = 43/148 (29.05%), Postives = 77/148 (52.03%), Query Frame = 3
Query:  375 ISVKEHFKIFEEEISRYFPN------LADTPFALPTSPLIIRVEDVPENAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQ 800
            I + +H +   + + +YFP         + PF +   P  + + +     +E  IE+ ++++ K +F+++ +T FW   +    V++E  +R+LLPF TT LCE GFS     K+KYR+RL    D+R  L+     IS + +  + Q
Sbjct: 1917 IDIVKHLRELYDNLQKYFPASNNDLMWVENPFIIKEKPDCLSISE-----YENLIEINSDEQLKYNFNTVHLTTFWGNLISEHKVLAERAIRVLLPFSTTYLCETGFSYYTSTKTKYRNRLNCSADMRIQLSAITPNISMICQEKKQQ 2059          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Planmine SMEST
Match: SMESG000077403.1 (SMESG000077403.1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.032e-14
Identity = 45/147 (30.61%), Postives = 75/147 (51.02%), Query Frame = 3
Query:  381 VKEHFKIFEEEISRYFPNLADTPFALPTSPLII-RVEDVPENAHEE--FIELITNDEAKNDF-SSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            +  H     ++ S YF +L  + +    +P +I + +D      E+   I+L ++   K  F    +I  FW++       ++   L +LLPF T+ LCE GFS++ V+K+ YRSRL+ E +LR A++    R   +    QAQ SH
Sbjct:   56 INNHLTSLWKQFSLYFKDLDMSKYEWIRNPFVIEKCDDFGLTTAEQEIIIDLSSDSTLKQMFRDENNIVMFWLRVKDDFPTLTNKALEILLPFATSYLCETGFSTVAVLKTMYRSRLMIEKELRTAISSMIPRFEKICAEKQAQSSH 202          
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Planmine SMEST
Match: SMESG000059630.1 (SMESG000059630.1)

HSP 1 Score: 72.7886 bits (177), Expect = 4.761e-14
Identity = 45/147 (30.61%), Postives = 72/147 (48.98%), Query Frame = 3
Query:  381 VKEHFKIFEEEISRYFPNLADTPFALPTSPLIIRVED---VPENAHEEFIELITNDEAKNDF-SSMSITKFWIKYLPSCHVMSEIILRLLLPFPTTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQPSH 809
            +  H     ++ S YF +L  + +    +P +I   D   +     E  I+L ++   K  F    +I  FW++       ++   L +LLPF T+ LCE GFS+  V+K+ YRSRL+ E +LR A++    R   +    Q QPSH
Sbjct:  255 INNHLTSLWKQFSLYFKDLDMSKYEWIRNPFVIEKYDDFGLTTAEKEMIIDLSSDSTIKQMFRDENNIVMFWLRVKDDFPTLTNKALEILLPFVTSYLCETGFSTEAVLKTNYRSRLIIEKELRTAISSMIPRFEKICAEKQVQPSH 401          
The following BLAST results are available for this feature:
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZBED51.187e-1228.97zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
ZBED51.187e-1228.97zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
ZBED92.609e-1234.81zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
ZBED92.676e-1234.81zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
FAM200B5.745e-1237.50family with sequence similarity 200 member B [Sour... [more]
back to top
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Zbed53.802e-5664.38zinc finger, BED type containing 5 [Source:MGI Sym... [more]
Zmym62.692e-733.03zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Zmym62.927e-733.03zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4Z944|ZBED5_CANLF4.803e-1228.97Zinc finger BED domain-containing protein 5 OS=Can... [more]
sp|Q49AG3|ZBED5_HUMAN5.702e-1228.97Zinc finger BED domain-containing protein 5 OS=Hom... [more]
sp|A4Z943|ZBED5_BOVIN9.648e-1228.97Zinc finger BED domain-containing protein 5 OS=Bos... [more]
sp|Q6R2W3|SCND3_HUMAN1.285e-1134.81SCAN domain-containing protein 3 OS=Homo sapiens O... [more]
sp|P0CF97|F200B_HUMAN2.759e-1137.50Protein FAM200B OS=Homo sapiens OX=9606 GN=FAM200B... [more]
back to top
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W3JIG62.973e-5774.65LOW QUALITY PROTEIN: SCAN domain-containing protei... [more]
A0A0C2J4D33.098e-5766.44Uncharacterized protein OS=Thelohanellus kitauei O... [more]
G1KUE34.338e-5768.49Uncharacterized protein OS=Anolis carolinensis OX=... [more]
A0A2D4KAW61.631e-5667.88Dimer_Tnp_hAT domain-containing protein OS=Micruru... [more]
G3I2L61.810e-5364.38SCAN domain-containing protein 3 OS=Cricetulus gri... [more]
back to top
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000051422.11.574e-1735.17pep primary_assembly:Astyanax_mexicanus-2.0:15:354... [more]
ENSAMXT00000044261.11.771e-1735.57pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040389.17.562e-1328.19pep primary_assembly:ASM223467v1:19:265767:268275:... [more]
ENSORLT00000035512.17.841e-1328.19pep primary_assembly:ASM223467v1:11:22712371:22714... [more]
ENSORLT00000033301.14.262e-1227.81pep primary_assembly:ASM223467v1:24:1653567:165476... [more]
ENSORLT00000030244.11.361e-1129.33pep primary_assembly:ASM223467v1:13:28104458:28106... [more]
ENSORLT00000032459.17.017e-1028.19pep primary_assembly:ASM223467v1:8:14240678:142473... [more]
back to top
BLAST of LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080396.14.415e-3172.06SMESG000080396.1[more]
SMESG000006260.11.901e-1631.51SMESG000006260.1[more]
SMESG000029188.12.804e-1529.05SMESG000029188.1[more]
SMESG000077403.11.032e-1430.61SMESG000077403.1[more]
SMESG000059630.14.761e-1430.61SMESG000059630.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026853 ID=SMED30026853|Name=LOW QUALITY PROTEIN: SCAN domain-containing protein 3-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1027bp
CCATTTTGAATTATTTTCTTTCTGTAGTTTATTTTGAAAAATGACAATTT
TTTGTTTTAATGAATGGGTCGTCATTTTGAATTATTTTCTTTCTAGAGTT
CCTTTGCCTAATGACAGATTTTTGTTTTATTGGATTTGCCTCCTTTTGAA
TTATTTTCTTTCTGAAGCTCCTTTGAATAATGCTGGAATTTTTGTTTTAA
TAAAGTGGCTCCCATTTTGAATATTTTTAATGAAATCAACGTTTATCATT
ATTTTTTTGCTGTTACTAGTGGTTAGTTTTCTTAACTCATTGGAATTTTG
AAGCTATTAGATCAGCGGTTCCCAACAAGTGGGTCTCGTGACAATTTGCC
ATGGGTCTATTCAATAGAAAAATAATTTCTGTCAAAGAACACTTTAAAAT
TTTTGAGGAAGAAATTTCAAGATATTTTCCAAATTTAGCTGACACACCAT
TTGCACTTCCTACAAGTCCATTAATCATCAGAGTTGAAGATGTCCCCGAG
AATGCACATGAGGAATTCATTGAACTCATTACCAACGATGAAGCAAAAAA
TGATTTCTCTTCAATGTCAATTACCAAATTCTGGATCAAGTATTTGCCTT
CATGTCATGTTATGTCTGAGATCATTTTGCGCCTGCTTCTTCCTTTTCCA
ACAACATGCCTTTGTGAAATAGGCTTTTCAAGCTTGTTAGTTATGAAATC
TAAATACAGAAGTAGACTTGTTGCAGAAGATGATCTGCGTTGTGCTCTTG
CAATGACCGCGCTGAGAATTTCTGATTTGGCAAGAAATATACAAGCACAG
CCTTCTCACTGACGCTATTTGGGTTTTCCAACTCTAACATTTTCGTAGTT
ATAATTAAAGTGATAATATTTTTGCTTTCTTCAGCTTTATTTTCTTTTCA
AATTTTATAAATTAAAAAGCCTTAACTTTAAAGTTGTTAGCTTCGATTGT
GTGTGACTCTTAATTGCAGAATACACACTTAAAATATTGTAAGCATTTTA
TTCCTTTGCAAATTCATTTTTTTAATT
back to top

protein sequence of SMED30026853-orf-1

>SMED30026853-orf-1 ID=SMED30026853-orf-1|Name=SMED30026853-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=154bp
MGLFNRKIISVKEHFKIFEEEISRYFPNLADTPFALPTSPLIIRVEDVPE
NAHEEFIELITNDEAKNDFSSMSITKFWIKYLPSCHVMSEIILRLLLPFP
TTCLCEIGFSSLLVMKSKYRSRLVAEDDLRCALAMTALRISDLARNIQAQ
PSH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell