Ubiquitin-conjugating enzyme E2

Overview
NameUbiquitin-conjugating enzyme E2
Smed IDSMED30026849
Length (bp)731
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin-conjugating enzyme E2 (SMED30026849) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin-conjugating enzyme E2 (SMED30026849) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin-conjugating enzyme E2 (SMED30026849) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin-conjugating enzyme E2 (SMED30026849) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026849

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026849h1SMcG0007233 SmedASXL_003875SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30026849h1SMcG0007233 dd_Smed_v4_12569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Human
Match: UBE2K (ubiquitin conjugating enzyme E2 K [Source:HGNC Symbol;Acc:HGNC:4914])

HSP 1 Score: 155.221 bits (391), Expect = 1.038e-46
Identity = 83/194 (42.78%), Postives = 121/194 (62.37%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA QY +N E+F++TA  W HVYA  P  S   E   K++ L   GF ++  +  LS   W+++
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSS--PEYTKKIENLCAMGFDRNAVIVALSSKSWDVE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Human
Match: UBE2K (ubiquitin conjugating enzyme E2 K [Source:HGNC Symbol;Acc:HGNC:4914])

HSP 1 Score: 116.316 bits (290), Expect = 5.514e-32
Identity = 62/134 (46.27%), Postives = 88/134 (65.67%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQ 464
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA Q
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQ 133          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Human
Match: UBE2K (ubiquitin conjugating enzyme E2 K [Source:HGNC Symbol;Acc:HGNC:4914])

HSP 1 Score: 109.768 bits (273), Expect = 1.125e-29
Identity = 58/127 (45.67%), Postives = 85/127 (66.93%), Query Frame = 3
Query:  264 FKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
             K  + +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA QY +N E+F++TA  W HVYA  P  S   E   K++ L   GF ++  +  LS   W+++
Sbjct:   17 LKSEEVRFITKIWHPNISSVTGAICLDILK-DQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSS--PEYTKKIENLCAMGFDRNAVIVALSSKSWDVE 140          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Human
Match: UBE2D2 (ubiquitin conjugating enzyme E2 D2 [Source:HGNC Symbol;Acc:HGNC:12475])

HSP 1 Score: 94.3597 bits (233), Expect = 8.768e-24
Identity = 49/145 (33.79%), Postives = 79/145 (54.48%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R+  EL   + D        P  D D+ +   +  G  ++PY+ G + + I  P+++PFKPPK  F TR++HPNI+S  G ICL++LR  +W  ++++  VL SI  LL    P +P    +A+ Y  ++E + + A  W   YA
Sbjct:    5 RIHKELNDLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Human
Match: UBE2D2 (ubiquitin conjugating enzyme E2 D2 [Source:HGNC Symbol;Acc:HGNC:12475])

HSP 1 Score: 94.3597 bits (233), Expect = 8.768e-24
Identity = 49/145 (33.79%), Postives = 79/145 (54.48%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R+  EL   + D        P  D D+ +   +  G  ++PY+ G + + I  P+++PFKPPK  F TR++HPNI+S  G ICL++LR  +W  ++++  VL SI  LL    P +P    +A+ Y  ++E + + A  W   YA
Sbjct:    5 RIHKELNDLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Celegans
Match: ubc-21 (Probable ubiquitin-conjugating enzyme E2 21 [Source:UniProtKB/Swiss-Prot;Acc:P52484])

HSP 1 Score: 158.303 bits (399), Expect = 4.973e-48
Identity = 81/196 (41.33%), Postives = 124/196 (63.27%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRFSDDNSDDIK----LVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            MS +   RV  + K  +  N+ DI      V   +++++++ G   G E TPY  G +EI ++IP ++PF+PPKAKF+TR+WHPNISS TG ICL++L+  KW AS++LR VL S++ +L + EP +PQDA+VAKQ++ N  +F  TA YW   Y A  +K    + + KV  L++ G  + EA+  LS + W ++
Sbjct:   15 MSNLALARVTRKCKEVA--NASDITEAGIHVEIKENNLMDIKGFIKGPEGTPYAGGTFEIKVDIPEHYPFEPPKAKFVTRIWHPNISSQTGTICLDILKD-KWTASLTLRTVLLSLQAMLCSPEPSDPQDAVVAKQFINNYPMFTATAVYWTS-YFANSKKDVEPDFNRKVGRLIEMGIRETEAIVYLSCNNWKLE 206          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Celegans
Match: ubc-20 (UBiquitin Conjugating enzyme [Source:UniProtKB/TrEMBL;Acc:Q9TZ69])

HSP 1 Score: 150.599 bits (379), Expect = 3.105e-45
Identity = 78/195 (40.00%), Postives = 120/195 (61.54%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRFSDDN--SDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEK-SYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            MS I   R+  E K    ++  S+   ++   + ++  + G   G  +TPY  G +++ I+IP  +PF PP  KF T++WHPN+SS TG ICL++L+  +W AS++LR VL SI+ L+ T EP +PQDA+VAKQY+E   +F+ TA YW   +A G  K + +  + DK+K   D G  ++EAV  LS + W+I+
Sbjct:    1 MSNIAFNRLQRECKEVVTNSEISETGIMIEILNENLTEIKGHIRGPPDTPYAGGMFDLDIKIPDQYPFSPPNVKFSTKIWHPNVSSQTGVICLDILKD-QWAASLTLRTVLLSIQALMCTPEPKDPQDAVVAKQYMEKPAVFKATAEYWTTKFAKGAVKNAGYQALVDKLK---DMGVREEEAVSVLSCNNWDIN 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Celegans
Match: C28G1.10 (pep chromosome:WBcel235:X:8847122:8848482:1 gene:WBGene00219376.1 transcript:C28G1.10.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C28G1.10)

HSP 1 Score: 117.087 bits (292), Expect = 3.625e-32
Identity = 66/195 (33.85%), Postives = 105/195 (53.85%), Query Frame = 3
Query:   90 RVMGELKRF-----SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNI--DLIE 653
            RV  EL+ +     S D    IK++   + +I++L G   G E TPYE G +E+ I+I  ++PFK P  KFIT++WHP++S   G ICL  +  G W  S+++  VL  I+  +       P D  + +Q   N+E+FEKTA +W   +A    K Y  E   KV+L+     +++ ++  LS   W +  D++E
Sbjct:    7 RVTNELRNYYSCVSSVDTGIRIKVI---EGNIMHLKGIIKGVEETPYEGGIFELDIKIGESYPFKAPTVKFITKIWHPSVSPFDGTICLHDVDNGVWPVSMTIYKVLIVIQSWMSNFNEKEPIDVEILEQATNNREVFEKTAEFWTKRFAGSRRKPYNQECQQKVQLMSRVIRNEELSIIALSYHNWTLPYDVLE 198          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Celegans
Match: let-70 (Ubiquitin-conjugating enzyme E2 2 [Source:UniProtKB/Swiss-Prot;Acc:P35129])

HSP 1 Score: 94.7449 bits (234), Expect = 2.977e-24
Identity = 49/145 (33.79%), Postives = 78/145 (53.79%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R+  EL+    D        P  D D+ +   +  G   +PY+ G + + I  P+++PFKPPK  F TR++HPNI+S  G ICL++LR  +W  ++++  VL SI  LL    P +P    +A+ Y  ++E + + A  W   YA
Sbjct:    5 RIQKELQDLGRDPPAQCSAGPVGD-DLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRERYNQLAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Celegans
Match: ubc-1 (Ubiquitin-conjugating enzyme E2 1 [Source:UniProtKB/Swiss-Prot;Acc:P52478])

HSP 1 Score: 90.8929 bits (224), Expect = 2.446e-22
Identity = 46/142 (32.39%), Postives = 83/142 (58.45%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEK 494
            M+     R+M + K+  +D    +   P  D +IL       G + TP+E+G +++++E    +P KPP  KFI++++HPN+ +  G ICL++L Q +W  +  +  +LTSI+ LL    P++P +++ A+ Y EN+  +EK
Sbjct:    1 MTTPSRRRLMRDFKKLQEDPPAGVSGAPTED-NILTWEAIIFGPQETPFEDGTFKLSLEFTEEYPNKPPTVKFISKMFHPNVYA-DGSICLDIL-QNRWSPTYDVAAILTSIQSLLDEPNPNSPANSLAAQLYQENRREYEK 139          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Fly
Match: Ubc4 (gene:FBgn0015321 transcript:FBtr0345603)

HSP 1 Score: 143.665 bits (361), Expect = 1.650e-42
Identity = 83/195 (42.56%), Postives = 119/195 (61.03%), Query Frame = 3
Query:   69 MSQICHTRVMGELK---RFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ +  +R+  E K   R  +     IK+   +DS    L G   G  +TPYE GK+ + I++P  +PF PPK +FITR+WHPNISSVTG ICL++L+   W A+++LR VL S++ LL  AEP +PQDA+VA Q+ +  +LF  TA +W + YA GP    F + D K++ L D G  + EA   LS   WN++
Sbjct:    1 MANMAVSRIKREFKEVMRSEEIVQCSIKIELVNDS-WTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKDN-WAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWTNAYAGGPHT--FPDCDSKIQRLRDMGIDEHEARAVLSKENWNLE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Fly
Match: Ubc4 (gene:FBgn0015321 transcript:FBtr0076395)

HSP 1 Score: 143.665 bits (361), Expect = 1.650e-42
Identity = 83/195 (42.56%), Postives = 119/195 (61.03%), Query Frame = 3
Query:   69 MSQICHTRVMGELK---RFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ +  +R+  E K   R  +     IK+   +DS    L G   G  +TPYE GK+ + I++P  +PF PPK +FITR+WHPNISSVTG ICL++L+   W A+++LR VL S++ LL  AEP +PQDA+VA Q+ +  +LF  TA +W + YA GP    F + D K++ L D G  + EA   LS   WN++
Sbjct:    1 MANMAVSRIKREFKEVMRSEEIVQCSIKIELVNDS-WTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKDN-WAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWTNAYAGGPHT--FPDCDSKIQRLRDMGIDEHEARAVLSKENWNLE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Fly
Match: Ubc4 (gene:FBgn0015321 transcript:FBtr0345604)

HSP 1 Score: 143.665 bits (361), Expect = 1.650e-42
Identity = 83/195 (42.56%), Postives = 119/195 (61.03%), Query Frame = 3
Query:   69 MSQICHTRVMGELK---RFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ +  +R+  E K   R  +     IK+   +DS    L G   G  +TPYE GK+ + I++P  +PF PPK +FITR+WHPNISSVTG ICL++L+   W A+++LR VL S++ LL  AEP +PQDA+VA Q+ +  +LF  TA +W + YA GP    F + D K++ L D G  + EA   LS   WN++
Sbjct:    1 MANMAVSRIKREFKEVMRSEEIVQCSIKIELVNDS-WTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKDN-WAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWTNAYAGGPHT--FPDCDSKIQRLRDMGIDEHEARAVLSKENWNLE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Fly
Match: eff (gene:FBgn0011217 transcript:FBtr0310554)

HSP 1 Score: 93.2041 bits (230), Expect = 1.214e-23
Identity = 49/145 (33.79%), Postives = 79/145 (54.48%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R+  EL+    D        P  D D+ +   +  G  ++PY+ G + + I  P+++PFKPPK  F TR++HPNI+S  G ICL++LR  +W  ++++  VL SI  LL    P +P    +A+ Y  ++E + + A  W   YA
Sbjct:    5 RINKELQDLGRDPPAQCSAGPVGD-DLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Fly
Match: eff (gene:FBgn0011217 transcript:FBtr0336876)

HSP 1 Score: 93.2041 bits (230), Expect = 1.214e-23
Identity = 49/145 (33.79%), Postives = 79/145 (54.48%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R+  EL+    D        P  D D+ +   +  G  ++PY+ G + + I  P+++PFKPPK  F TR++HPNI+S  G ICL++LR  +W  ++++  VL SI  LL    P +P    +A+ Y  ++E + + A  W   YA
Sbjct:    5 RINKELQDLGRDPPAQCSAGPVGD-DLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWTRKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Zebrafish
Match: ube2kb (ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-980605-9])

HSP 1 Score: 156.377 bits (394), Expect = 2.633e-47
Identity = 84/194 (43.30%), Postives = 121/194 (62.37%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA QY +N E+F++TA  W+HVYA  P  S   E   K+  L   GF K+  +  LS   W+++
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELKGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWSHVYAGAPVSS--PEYTRKIDKLCAMGFDKNAVIVALSSKSWDVE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Zebrafish
Match: ube2kb (ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-980605-9])

HSP 1 Score: 156.377 bits (394), Expect = 2.633e-47
Identity = 84/194 (43.30%), Postives = 121/194 (62.37%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA QY +N E+F++TA  W+HVYA  P  S   E   K+  L   GF K+  +  LS   W+++
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELKGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWSHVYAGAPVSS--PEYTRKIDKLCAMGFDKNAVIVALSSKSWDVE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Zebrafish
Match: ube2kb (ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-980605-9])

HSP 1 Score: 156.377 bits (394), Expect = 2.633e-47
Identity = 84/194 (43.30%), Postives = 121/194 (62.37%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA QY +N E+F++TA  W+HVYA  P  S   E   K+  L   GF K+  +  LS   W+++
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELKGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWSHVYAGAPVSS--PEYTRKIDKLCAMGFDKNAVIVALSSKSWDVE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Zebrafish
Match: ube2kb (ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-980605-9])

HSP 1 Score: 151.369 bits (381), Expect = 3.557e-45
Identity = 76/162 (46.91%), Postives = 108/162 (66.67%), Query Frame = 3
Query:  159 DSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA QY +N E+F++TA  W+HVYA  P  S   E   K+  L   GF K+  +  LS   W+++
Sbjct:   41 DENFTELKGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWSHVYAGAPVSS--PEYTRKIDKLCAMGFDKNAVIVALSSKSWDVE 199          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Zebrafish
Match: ube2ka (ubiquitin-conjugating enzyme E2Ka (UBC1 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-050320-48])

HSP 1 Score: 148.673 bits (374), Expect = 1.283e-44
Identity = 81/179 (45.25%), Postives = 113/179 (63.13%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSK 599
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA QY +N E+F++TA  W+HVYA  P  S   E   K+  L   GF K
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWSHVYAGAPVSS--PEYTRKIDKLCAMGFDK 176          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Xenopus
Match: orai1 (ORAI calcium release-activated calcium modulator 1 [Source:Xenbase;Acc:XB-GENE-962826])

HSP 1 Score: 156.377 bits (394), Expect = 4.272e-47
Identity = 83/194 (42.78%), Postives = 121/194 (62.37%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA QY +N E+F++TA  W HVYA  P  S   E   K++ L   GF ++  +  LS   W+++
Sbjct:    1 MANIAAQRIKREFKEVLKSEETSKNQIKVDLVDENFSELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVTS--PEYTKKIENLCAMGFDRNAVIAALSSKAWDVE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Xenopus
Match: ube2d3 (ubiquitin conjugating enzyme E2 D3 [Source:NCBI gene;Acc:548818])

HSP 1 Score: 94.3597 bits (233), Expect = 7.948e-24
Identity = 49/145 (33.79%), Postives = 79/145 (54.48%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R+  EL   + D        P  D D+ +   +  G  ++PY+ G + + I  P+++PFKPPK  F TR++HPNI+S  G ICL++LR  +W  ++++  VL SI  LL    P +P    +A+ Y  ++E + + A  W   YA
Sbjct:    5 RIHKELNDLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Xenopus
Match: ube2d3 (ubiquitin conjugating enzyme E2 D3 [Source:NCBI gene;Acc:548818])

HSP 1 Score: 94.3597 bits (233), Expect = 1.072e-23
Identity = 49/144 (34.03%), Postives = 79/144 (54.86%), Query Frame = 3
Query:   93 VMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            + GEL   + D        P  D D+ +   +  G  ++PY+ G + + I  P+++PFKPPK  F TR++HPNI+S  G ICL++LR  +W  ++++  VL SI  LL    P +P    +A+ Y  ++E + + A  W   YA
Sbjct:   14 ISGELNDLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRLAREWTEKYA 154          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Xenopus
Match: chmp2b (charged multivesicular body protein 2B [Source:Xenbase;Acc:XB-GENE-948820])

HSP 1 Score: 93.2041 bits (230), Expect = 2.321e-23
Identity = 49/145 (33.79%), Postives = 78/145 (53.79%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R+  EL     D        P  D D+ +   +  G  ++PY+ G + + I  P+++PFKPPK  F T+++HPNI+S  G ICL++LR  +W  ++++  VL SI  LL    P +P    +A+ Y  +KE + + A  W   YA
Sbjct:    5 RIQKELNDLQRDPPAQCSAGPVGD-DLFHWQATIMGPTDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINS-NGSICLDILR-SQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRLAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Xenopus
Match: ube2a (ubiquitin conjugating enzyme E2 A [Source:NCBI gene;Acc:448176])

HSP 1 Score: 93.2041 bits (230), Expect = 2.508e-23
Identity = 48/145 (33.10%), Postives = 85/145 (58.62%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAA 503
            MS     R+M + KR  +D    +   P S+++I+       G E TP+E+G +++ IE    +P KPP  +F+++++HPN+ +  G ICL++L Q +W  +  + ++LTSI+ LL    P++P ++  A+ Y ENK  +EK  +
Sbjct:    1 MSTPARRRLMRDFKRLQEDPPAGVSGAP-SENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYA-DGSICLDIL-QNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVS 142          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Mouse
Match: Ube2k (ubiquitin-conjugating enzyme E2K [Source:MGI Symbol;Acc:MGI:1858216])

HSP 1 Score: 155.221 bits (391), Expect = 7.129e-47
Identity = 83/194 (42.78%), Postives = 121/194 (62.37%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA QY +N E+F++TA  W HVYA  P  S   E   K++ L   GF ++  +  LS   W+++
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSS--PEYTKKIENLCAMGFDRNAVIVALSSKSWDVE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Mouse
Match: Ube2k (ubiquitin-conjugating enzyme E2K [Source:MGI Symbol;Acc:MGI:1858216])

HSP 1 Score: 116.316 bits (290), Expect = 3.785e-32
Identity = 62/134 (46.27%), Postives = 88/134 (65.67%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQ 464
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA Q
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQ 133          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Mouse
Match: Ube2k (ubiquitin-conjugating enzyme E2K [Source:MGI Symbol;Acc:MGI:1858216])

HSP 1 Score: 109.768 bits (273), Expect = 7.726e-30
Identity = 58/127 (45.67%), Postives = 85/127 (66.93%), Query Frame = 3
Query:  264 FKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
             K  + +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA QY +N E+F++TA  W HVYA  P  S   E   K++ L   GF ++  +  LS   W+++
Sbjct:   17 LKSEEVRFITKIWHPNISSVTGAICLDILK-DQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSS--PEYTKKIENLCAMGFDRNAVIVALSSKSWDVE 140          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Mouse
Match: Ube2d2b (ubiquitin-conjugating enzyme E2D 2B [Source:MGI Symbol;Acc:MGI:1920568])

HSP 1 Score: 94.7449 bits (234), Expect = 4.332e-24
Identity = 47/145 (32.41%), Postives = 81/145 (55.86%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R+  EL   + D        P  + D+ +   +  G  ++PY+ G + + I+ P+ +PFKPPK +F TR++HPN++S  G ICL++LR  +W  ++++  VL SI  LL    P +P    +A+ Y  +++ + +TA  W   YA
Sbjct:    5 RIHKELNDLAQDPPAQCSAGPVGE-DMFHWQATIMGPNDSPYQGGAFFLTIDFPTEYPFKPPKVEFTTRIYHPNVNS-NGSICLDILR-SQWSPALTISKVLLSISSLLCDPNPDDPLVPEIAQIYKTDRDKYNRTAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Mouse
Match: Ube2d2a (ubiquitin-conjugating enzyme E2D 2A [Source:MGI Symbol;Acc:MGI:1930715])

HSP 1 Score: 94.3597 bits (233), Expect = 6.020e-24
Identity = 49/145 (33.79%), Postives = 79/145 (54.48%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R+  EL   + D        P  D D+ +   +  G  ++PY+ G + + I  P+++PFKPPK  F TR++HPNI+S  G ICL++LR  +W  ++++  VL SI  LL    P +P    +A+ Y  ++E + + A  W   YA
Sbjct:    5 RIHKELNDLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 vs. UniProt/SwissProt
Match: sp|P52484|UBC21_CAEEL (Probable ubiquitin-conjugating enzyme E2 21 OS=Caenorhabditis elegans OX=6239 GN=ubc-21 PE=3 SV=3)

HSP 1 Score: 158.303 bits (399), Expect = 6.326e-47
Identity = 81/196 (41.33%), Postives = 124/196 (63.27%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRFSDDNSDDIK----LVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            MS +   RV  + K  +  N+ DI      V   +++++++ G   G E TPY  G +EI ++IP ++PF+PPKAKF+TR+WHPNISS TG ICL++L+  KW AS++LR VL S++ +L + EP +PQDA+VAKQ++ N  +F  TA YW   Y A  +K    + + KV  L++ G  + EA+  LS + W ++
Sbjct:   15 MSNLALARVTRKCKEVA--NASDITEAGIHVEIKENNLMDIKGFIKGPEGTPYAGGTFEIKVDIPEHYPFEPPKAKFVTRIWHPNISSQTGTICLDILKD-KWTASLTLRTVLLSLQAMLCSPEPSDPQDAVVAKQFINNYPMFTATAVYWTS-YFANSKKDVEPDFNRKVGRLIEMGIRETEAIVYLSCNNWKLE 206          
BLAST of Ubiquitin-conjugating enzyme E2 vs. UniProt/SwissProt
Match: sp|P61087|UBE2K_MOUSE (Ubiquitin-conjugating enzyme E2 K OS=Mus musculus OX=10090 GN=Ube2k PE=1 SV=3)

HSP 1 Score: 155.221 bits (391), Expect = 4.987e-46
Identity = 83/194 (42.78%), Postives = 121/194 (62.37%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA QY +N E+F++TA  W HVYA  P  S   E   K++ L   GF ++  +  LS   W+++
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSS--PEYTKKIENLCAMGFDRNAVIVALSSKSWDVE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. UniProt/SwissProt
Match: sp|P61086|UBE2K_HUMAN (Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens OX=9606 GN=UBE2K PE=1 SV=3)

HSP 1 Score: 155.221 bits (391), Expect = 4.987e-46
Identity = 83/194 (42.78%), Postives = 121/194 (62.37%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA QY +N E+F++TA  W HVYA  P  S   E   K++ L   GF ++  +  LS   W+++
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSS--PEYTKKIENLCAMGFDRNAVIVALSSKSWDVE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. UniProt/SwissProt
Match: sp|P61085|UBE2K_BOVIN (Ubiquitin-conjugating enzyme E2 K OS=Bos taurus OX=9913 GN=UBE2K PE=1 SV=3)

HSP 1 Score: 155.221 bits (391), Expect = 4.987e-46
Identity = 83/194 (42.78%), Postives = 121/194 (62.37%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA QY +N E+F++TA  W HVYA  P  S   E   K++ L   GF ++  +  LS   W+++
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSS--PEYTKKIENLCAMGFDRNAVIVALSSKSWDVE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. UniProt/SwissProt
Match: sp|P21734|UBC1_YEAST (Ubiquitin-conjugating enzyme E2 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC1 PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.647e-44
Identity = 81/186 (43.55%), Postives = 116/186 (62.37%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA---AGPEKSYFTEMD------DKVKLLMDKGFSKDEAVHKL 620
            R+M E++   DD +  I L   S+SDI +L G+F G   TPYE GK+ + IE+P  +PFKPPK +F T+V+HPNISSVTG ICL++L+   W   ++L++ L S++ LL + EP++PQDA VA+ YL ++E F KTAA W  +YA   +  +K    E D      D +     +GF KD+ V  L
Sbjct:    6 RIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDTKVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESFNKTAALWTRLYASETSNGQKGNVEESDLYGIDHDLIDEFESQGFEKDKIVEVL 190          
BLAST of Ubiquitin-conjugating enzyme E2 vs. TrEMBL
Match: A0A074ZPD7 (Ubiquitin--protein ligase OS=Opisthorchis viverrini OX=6198 GN=T265_04038 PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 2.876e-50
Identity = 89/194 (45.88%), Postives = 124/194 (63.92%), Query Frame = 3
Query:   69 MSQICHTRV---MGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNI 641
            MS I   R+   + EL R  +   + I++ P+ D DI++L G  NG  +TPY   K+++ I IPSN+PF PPK KF+TR+WHPNISS TG ICL++L+  +W A++SLR VL SI+ LL + EP +PQDA+VA QY      F++TA YW  +YA GP K   TE +  V  L+  GF + E+   LSM  W++
Sbjct:    1 MSSIAAKRIQKELAELLRSDEVAQNQIEIKPSGD-DIMHLQGVINGPPDTPYNGAKFQLEIIIPSNYPFVPPKVKFLTRIWHPNISSATGVICLDVLKD-QWAAAMSLRTVLLSIQALLASPEPDDPQDAVVANQYKSCPAAFDRTAQYWAAIYAGGPFKD--TECNSLVDQLVSMGFDEHESRCALSMKNWDL 190          
BLAST of Ubiquitin-conjugating enzyme E2 vs. TrEMBL
Match: A0A0V0J3I7 (Ubiquitin-conjugating enzyme E2-22 kDa OS=Schistocephalus solidus OX=70667 GN=UBCD4 PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 3.814e-50
Identity = 90/196 (45.92%), Postives = 127/196 (64.80%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF---SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNIDL 647
            MS I   RV  EL  F   +D   + I++ P SD +I+ L G  +G  +TPYE  +Y + I IP N+PF PPK KF+T++WHPNISS TG ICL++L+  +W A++SLR +L SI+ LL + EP +PQDA+VA Q+  N+ +F  TA +W  VYA GP K    + ++KV+ L+  GFS+ EA   LSM  W+I +
Sbjct:    1 MSSIATRRVQKELLEFQKGADAFENPIEIRPLSD-NIMKLEGVISGPPDTPYEGARYILEILIPDNYPFSPPKVKFLTKIWHPNISSATGVICLDILKD-QWAAAMSLRTMLLSIQALLASPEPDDPQDAVVASQFKSNRAIFNLTARHWASVYANGPSKQ--KDCEEKVEKLIQLGFSETEARAALSMKNWDIPM 192          
BLAST of Ubiquitin-conjugating enzyme E2 vs. TrEMBL
Match: A0A4S2LW32 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005899 PE=3 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 9.804e-50
Identity = 88/194 (45.36%), Postives = 124/194 (63.92%), Query Frame = 3
Query:   69 MSQICHTRV---MGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNI 641
            MS I   R+   + EL R  +   + I++ P+ D DI++L G  NG  +TPY   K+++ I IPSN+PF PPK KF+TR+WHPNISS TG ICL++L+  +W A++SLR VL SI+ LL + EP +PQDA+VA QY      F++TA YW  +YA GP K   +E +  V  L+  GF + E+   LSM  W++
Sbjct:    1 MSSIAAKRIQKELAELLRSDEVAQNQIEIKPSGD-DIMHLQGVINGPPDTPYNGAKFQLEIIIPSNYPFVPPKVKFLTRIWHPNISSATGVICLDVLKD-QWAAAMSLRTVLLSIQALLASPEPDDPQDAVVANQYKSCPAAFDRTAQYWAAIYAGGPFKD--SECNSLVDQLVSMGFDEHESRCALSMKNWDL 190          
BLAST of Ubiquitin-conjugating enzyme E2 vs. TrEMBL
Match: G7Y6T1 (Ubiquitin-conjugating enzyme (Huntingtin interacting protein 2) OS=Clonorchis sinensis OX=79923 GN=Ube2k PE=3 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 9.804e-50
Identity = 88/194 (45.36%), Postives = 124/194 (63.92%), Query Frame = 3
Query:   69 MSQICHTRV---MGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNI 641
            MS I   R+   + EL R  +   + I++ P+ D DI++L G  NG  +TPY   K+++ I IPSN+PF PPK KF+TR+WHPNISS TG ICL++L+  +W A++SLR VL SI+ LL + EP +PQDA+VA QY      F++TA YW  +YA GP K   +E +  V  L+  GF + E+   LSM  W++
Sbjct:    1 MSSIAAKRIQKELAELLRSDEVAQNQIEIKPSGD-DIMHLQGVINGPPDTPYNGAKFQLEIIIPSNYPFVPPKVKFLTRIWHPNISSATGVICLDVLKD-QWAAAMSLRTVLLSIQALLASPEPDDPQDAVVANQYKSCPAAFDRTAQYWAAIYAGGPFKD--SECNSLVDQLVSMGFDEHESRCALSMKNWDL 190          
BLAST of Ubiquitin-conjugating enzyme E2 vs. TrEMBL
Match: A0A5E4QBB8 (Uncharacterized protein OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS6309 PE=3 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 5.938e-49
Identity = 84/194 (43.30%), Postives = 130/194 (67.01%), Query Frame = 3
Query:   69 MSQICHTRVMGELKR-FSDDNSDDIKL-VPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M  I   R++ E+K   + D  +D  L +   + + ++L G F G  +TPYE G +++ I++P  +PF PPK +F+T VWHPN+SSVTG ICL++L+  +W A+++LR V+ SI+ LL  AEP++PQDA+VA QY EN ELF KTA +W ++YA GP  ++  E + KV++L+D G  + +A   LS + W+I+
Sbjct:    1 MFNIAAKRIIKEIKEVINGDQVEDAALKLELVNDNWMDLRGEFKGPPDTPYEGGAFKLEIKVPETYPFNPPKVRFMTNVWHPNVSSVTGAICLDILKD-QWAAALTLRTVMLSIQSLLAAAEPNDPQDAVVATQYKENPELFAKTAKHWTNIYAGGP--NHVWEFNRKVEVLIDMGIEEHKARVALSTNDWDIE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Cavefish
Match: ube2kb (ubiquitin conjugating enzyme E2 K [Source:NCBI gene;Acc:103045360])

HSP 1 Score: 156.377 bits (394), Expect = 2.232e-47
Identity = 84/194 (43.30%), Postives = 121/194 (62.37%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA QY +N E+F++TA  W+HVYA  P  S   E   K+  L   GF K+  +  LS   W+++
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELKGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWSHVYAGAPVSS--PEYTRKIDKLCAMGFDKNAVIVALSSKSWDVE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Cavefish
Match: ube2ka (ubiquitin-conjugating enzyme E2 K-like [Source:NCBI gene;Acc:103027883])

HSP 1 Score: 155.221 bits (391), Expect = 7.180e-47
Identity = 83/194 (42.78%), Postives = 121/194 (62.37%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA QY +N E+F++TA  W+HVYA  P  S   +   K+  L   GF K+  +  LS   W+++
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELKGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWSHVYAGAPVSS--PDYTRKIDKLCAMGFDKNAVIVALSSKSWDVE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Cavefish
Match: ube2kb (ubiquitin conjugating enzyme E2 K [Source:NCBI gene;Acc:103045360])

HSP 1 Score: 116.316 bits (290), Expect = 2.941e-32
Identity = 62/134 (46.27%), Postives = 88/134 (65.67%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQ 464
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA Q
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELKGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQ 133          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Cavefish
Match: ube2ka (ubiquitin-conjugating enzyme E2 K-like [Source:NCBI gene;Acc:103027883])

HSP 1 Score: 116.316 bits (290), Expect = 2.941e-32
Identity = 62/134 (46.27%), Postives = 88/134 (65.67%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQ 464
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA Q
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELKGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQ 133          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Cavefish
Match: ENSAMXT00000053070.1 (ubiquitin-conjugating enzyme E2 D2-like [Source:NCBI gene;Acc:103023842])

HSP 1 Score: 95.1301 bits (235), Expect = 2.665e-24
Identity = 49/145 (33.79%), Postives = 81/145 (55.86%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R+  EL  F+ D        P  D D+ +   +  G  ++PY++G + + I  P+++PFKPPK  F TR++HPNI+S  G ICL++LR  +W  ++++  VL SI  LL    P +P    +A+ Y  +++ + + A  W   YA
Sbjct:    5 RIYKELNDFARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQSGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKADRDKYNRIAREWAQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Sea Lamprey
Match: ube2kb (ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-980605-9])

HSP 1 Score: 152.91 bits (385), Expect = 1.069e-46
Identity = 84/194 (43.30%), Postives = 118/194 (60.82%), Query Frame = 3
Query:   72 SQICHTRVMGELKRFSD---DNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
             +I   R+  E  R S     N   IK V   D +   L G   G  +TPYE G+Y + I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA+QY EN E+F +TA  W H+YA  P  +Y  E   K+  L   GF ++  +  LS   W+++
Sbjct:    1 GEIAVARIKREFIRCSRARRTNKSQIK-VELVDENFTELRGEIAGPPDTPYEGGRYMLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVARQYKENHEMFVQTARLWAHMYAGAP--AYNGEYQRKIDHLCAMGFDRNGVIAALSSHGWDVE 190          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008817.1 (pep scaffold:Pmarinus_7.0:GL476329:1748443:1760143:-1 gene:ENSPMAG00000007968.1 transcript:ENSPMAT00000008817.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 1.819e-24
Identity = 48/145 (33.10%), Postives = 86/145 (59.31%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAA 503
            MS     R+M + KR  +D    +   P S+++I+       G E TP+E+G +++ +E    +P KPP  KF+++++HPN+ +  G ICL++L Q +W  +  + ++LTSI+ LL    P++P +++ A+ Y ENK  +EK  +
Sbjct:    1 MSTPARRRLMRDFKRLQEDPPAGVSGAP-SENNIMLWNAVIFGPEGTPFEDGTFKLTLEFTEEYPNKPPTVKFVSKMFHPNVYA-DGSICLDIL-QNRWSPTYDVSSILTSIQSLLDEPNPNSPANSLAAQLYQENKREYEKKVS 142          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Sea Lamprey
Match: ube2t (ubiquitin-conjugating enzyme E2T (putative) [Source:NCBI gene;Acc:768152])

HSP 1 Score: 86.6557 bits (213), Expect = 1.204e-21
Identity = 46/149 (30.87%), Postives = 79/149 (53.02%), Query Frame = 3
Query:   87 TRVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLR---QGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            +R+  E++R + +    +      D     L     G   TPYE G + + ++IP  +PF+PPK  F+T ++HPNI +  G ICL++L+   +G W  S+++  VLTS++ L+    P +P    ++ ++  NK  F  TA  W   +A
Sbjct:    5 SRLAREVERLASEPPPGVSCW-LCDEASGELRAQILGGAGTPYEGGIFSLEVQIPDRYPFEPPKVTFLTPIYHPNIDTA-GRICLDILKMPPKGAWRPSLNVSTVLTSVQQLMGEPNPDDPLMPDISAEFKYNKPSFVSTAKSWTQKHA 151          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010378.1 (pep scaffold:Pmarinus_7.0:GL477318:26908:31295:-1 gene:ENSPMAG00000009396.1 transcript:ENSPMAT00000010378.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 6.410e-21
Identity = 45/133 (33.83%), Postives = 73/133 (54.89%), Query Frame = 3
Query:  102 ELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTA 500
            EL     D        P  D D+ +   +  G  ++PY+ G + + I  P+++PFKPPK  F TR++HPNI+S  G ICL++LR  +W  ++++  VL SI  LL    P +P    +A+ Y  +++ + K A
Sbjct:   10 ELNDLGRDPPAQCSAGPVGD-DLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILRS-QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNKLA 139          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006211.1 (pep scaffold:Pmarinus_7.0:GL476897:3176:4886:1 gene:ENSPMAG00000005612.1 transcript:ENSPMAT00000006211.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 2.486e-20
Identity = 42/133 (31.58%), Postives = 78/133 (58.65%), Query Frame = 3
Query:  105 LKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAA 503
              R  +D    +   P ++++I+       G E TP+E+G +++ IE    +P KPP  +F+++++HPN+ +  G ICL++L Q +W  +  + ++LTSI+ LL    P++P ++  A+ Y ENK  +EK  +
Sbjct:    1 FSRLQEDPPAGVSGAP-TENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYA-DGSICLDIL-QNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKKVS 130          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Yeast
Match: UBC1 (Ubiquitin-conjugating enzyme; key E2 partner with Ubc4p for the anaphase-promoting complex (APC); mediates selective degradation of short-lived and abnormal proteins; plays a role in vesicle biogenesis and ER-associated protein degradation (ERAD); component of the cellular stress response; protein abundance increases in response to DNA replication stress key E2 partner with Ubc4p for the anaphase-promoting complex (APC) [Source:SGD;Acc:S000002584])

HSP 1 Score: 152.14 bits (383), Expect = 2.372e-46
Identity = 81/186 (43.55%), Postives = 116/186 (62.37%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA---AGPEKSYFTEMD------DKVKLLMDKGFSKDEAVHKL 620
            R+M E++   DD +  I L   S+SDI +L G+F G   TPYE GK+ + IE+P  +PFKPPK +F T+V+HPNISSVTG ICL++L+   W   ++L++ L S++ LL + EP++PQDA VA+ YL ++E F KTAA W  +YA   +  +K    E D      D +     +GF KD+ V  L
Sbjct:    6 RIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDTKVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESFNKTAALWTRLYASETSNGQKGNVEESDLYGIDHDLIDEFESQGFEKDKIVEVL 190          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Yeast
Match: UBC5 (Ubiquitin-conjugating enzyme; mediates selective degradation of short-lived, abnormal, or excess proteins, including histone H3; central component of the cellular stress response; expression is heat inducible; protein abundance increases in response to DNA replication stress; UBC5 has a paralog, UBC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002466])

HSP 1 Score: 95.5153 bits (236), Expect = 2.635e-25
Identity = 52/145 (35.86%), Postives = 80/145 (55.17%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R+  EL     D        P  D D+ +   S  G  ++PY  G + ++I  P+++PFKPPK  F T+++HPNI+S +G ICL++L+  +W  +++L  VL SI  LL  A P +P    +A+ Y  +K  +E TA  W   YA
Sbjct:    6 RIAKELSDLGRDPPASCSAGPVGD-DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTKIYHPNINS-SGNICLDILKD-QWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAKYEATAKEWTKKYA 147          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Yeast
Match: UBC4 (Ubiquitin-conjugating enzyme (E2); key E2 partner with Ubc1p for the anaphase-promoting complex (APC); mediates degradation of abnormal or excess proteins, including calmodulin and histone H3; regulates levels of DNA Polymerase-{alpha} to promote efficient and accurate DNA replication; interacts with many SCF ubiquitin protein ligases; component of the cellular stress response; UBC4 has a paralog, UBC5, that arose from the whole genome duplication [Source:SGD;Acc:S000000286])

HSP 1 Score: 91.2781 bits (225), Expect = 1.033e-23
Identity = 50/145 (34.48%), Postives = 78/145 (53.79%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R+  EL     D        P  D D+ +   S  G  ++PY  G + ++I  P+++PFKPPK  F T+++HPNI++  G ICL++L+  +W  +++L  VL SI  LL  A P +P    +A  Y  ++  +E TA  W   YA
Sbjct:    6 RIAKELSDLERDPPTSCSAGPVGD-DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINA-NGNICLDILKD-QWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAREWTKKYA 147          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Yeast
Match: UBC13 (E2 ubiquitin-conjugating enzyme; involved in the error-free DNA postreplication repair pathway; interacts with Mms2p to assemble ubiquitin chains at the Ub Lys-63 residue; DNA damage triggers redistribution from the cytoplasm to the nucleus [Source:SGD;Acc:S000002499])

HSP 1 Score: 89.3521 bits (220), Expect = 7.789e-23
Identity = 45/145 (31.03%), Postives = 85/145 (58.62%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R++ E ++   D    I   P  D ++     +  G E +PYE+G +E+ + +P ++P + PK +F+T+++HPNI  + G ICL++L+   W  ++ +R VL SI+ LL +  P++P    VA+ +++N++  +  A  W  +YA
Sbjct:    7 RIIKETEKLVSDPVPGITAEP-HDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTN-WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKLYA 148          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Yeast
Match: UBC11 (Ubiquitin-conjugating enzyme; most similar in sequence to Xenopus ubiquitin-conjugating enzyme E2-C, but not a true functional homolog of this E2; unlike E2-C, not required for the degradation of mitotic cyclin Clb2 [Source:SGD;Acc:S000005866])

HSP 1 Score: 88.5817 bits (218), Expect = 1.501e-22
Identity = 47/141 (33.33%), Postives = 84/141 (59.57%), Query Frame = 3
Query:   81 CHT-RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHN--PQDAMVAKQYLENKELFEK 494
            C T R+  EL +     ++ I   P  D+D+   +G   G ++TPY   K++++++ P N+PF PP  KF++ +WHPN+   +G ICL++L++ KW A  ++  +L S++ LL   EP+N  P +A+ A+ +  + E + K
Sbjct:    8 CVTKRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFLSPMWHPNVDK-SGNICLDILKE-KWSAVYNVETILLSLQSLL--GEPNNRSPLNAVAAELWDADMEEYRK 144          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Nematostella
Match: EDO39550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9Q6])

HSP 1 Score: 158.303 bits (399), Expect = 1.585e-48
Identity = 79/195 (40.51%), Postives = 119/195 (61.03%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF---SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ I  +RV  E +      +D    IK V   D     L G   G   TP+E G Y + I IP  +PF PPK KF T++WHPNISSVTG ICL++L+  +W A+++LR V+ SI+ LL + EP +PQDA+VA+Q+ EN+  +  TA +W  V+A    + +  E ++K++ LMD GF+++++   LS   WN++
Sbjct:    1 MTNIAVSRVKREFREIITSEEDQKSGIK-VELVDETFTKLKGEIRGPPETPFEGGTYNLDIVIPETYPFNPPKVKFTTKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVMLSIQALLASPEPDDPQDAVVARQFKENRSAYLLTARHWAQVHAGAKSQGH-NECEEKIRQLMDMGFAENQSRVALSSHSWNVE 192          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Nematostella
Match: EDO47887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL90])

HSP 1 Score: 96.6709 bits (239), Expect = 1.149e-24
Identity = 50/153 (32.68%), Postives = 86/153 (56.21%), Query Frame = 3
Query:   84 HTRVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLR---QGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGP 533
            + R+  EL+  ++D        P  ++ I  L     G E TPY  G +++ I+IP  +PF+PPK +F+T ++HPNI S +G ICL+ L+   +G W  ++++ +VL++I IL+    P +P  A ++ ++  NK  F + A  W   +A  P
Sbjct:    4 NARMKRELRLLAEDPPHGASCWPVDENRIDKLEAKLIGAEGTPYHKGIFKLDIQIPERYPFEPPKVRFVTPIYHPNIDS-SGRICLDTLKMPPKGMWKPALNISSVLSTILILMAEPNPDDPLMAEISNEFKYNKAQFLEKAKEWTLKFAMDP 155          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Nematostella
Match: EDO40595 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Q0])

HSP 1 Score: 88.9669 bits (219), Expect = 2.412e-22
Identity = 48/145 (33.10%), Postives = 84/145 (57.93%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R++ E +R   +    I+ VP  +S+      + NG +++PYE G +++ + +P  +P   PK +F+T+++HPNI  + G ICL++L+  KW  ++ +R VL SI+ LL    P +P    VA+Q+  N+    +TA  W  +YA
Sbjct:    9 RIIKETQRLVAEPVAGIQAVP-DESNARYFHVTVNGPKDSPYEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNIDKL-GRICLDILKD-KWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKVNEVQAIETAKAWTRLYA 150          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Nematostella
Match: EDO31327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Q0])

HSP 1 Score: 88.9669 bits (219), Expect = 2.412e-22
Identity = 48/145 (33.10%), Postives = 84/145 (57.93%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R++ E +R   +    I+ VP  +S+      + NG +++PYE G +++ + +P  +P   PK +F+T+++HPNI  + G ICL++L+  KW  ++ +R VL SI+ LL    P +P    VA+Q+  N+    +TA  W  +YA
Sbjct:    9 RIIKETQRLVAEPVAGIQAVP-DESNARYFHVTVNGPKDSPYEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNIDKL-GRICLDILKD-KWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKVNEVQAIETAKAWTRLYA 150          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Nematostella
Match: EDO43669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXR8])

HSP 1 Score: 87.8113 bits (216), Expect = 5.469e-22
Identity = 45/145 (31.03%), Postives = 78/145 (53.79%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R+  EL+    D        P  D D+ +   +  G  ++PY+ G + + I  P+++PFKPPK  F T+++HPNI+S  G ICL++LR  +W  ++++  VL SI  L+    P +P    +A+ +  +++ +   A  W   YA
Sbjct:    5 RINKELQDLGRDPPAQCSAGPVGD-DLFHWQATIMGPADSPYQGGVFFLTIHFPTDYPFKPPKVSFTTKIYHPNINS-NGSICLDILR-SQWSPALTISKVLLSICSLMDDPNPDDPLVPEIARSFKTDRKKYNDMAKEWTRKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Medaka
Match: ube2kb (ubiquitin conjugating enzyme E2 K [Source:NCBI gene;Acc:101166933])

HSP 1 Score: 154.836 bits (390), Expect = 1.009e-46
Identity = 82/194 (42.27%), Postives = 121/194 (62.37%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNID 644
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA Q+ +N E+F++TA  W+HVYA  P  S   +   K+  L   GF K+  +  LS   W+++
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQFKQNPEMFKQTARLWSHVYAGAPASS--PDYTRKIDKLCAMGFDKNAVIAALSSKSWDVE 191          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Medaka
Match: ube2kb (ubiquitin conjugating enzyme E2 K [Source:NCBI gene;Acc:101166933])

HSP 1 Score: 147.132 bits (370), Expect = 3.086e-43
Identity = 82/202 (40.59%), Postives = 120/202 (59.41%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNIDLIE*NMKF 668
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA Q+ +N E+F++TA  W+HVYA  P  S   +   K+  L   GF K      L +      ++  N +F
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQFKQNPEMFKQTARLWSHVYAGAPASS--PDYTRKIDKLCAMGFDKVRHTALLLLHITIYTMVRVNTRF 199          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Medaka
Match: ube2ka (ubiquitin-conjugating enzyme E2 K [Source:NCBI gene;Acc:101174511])

HSP 1 Score: 116.316 bits (290), Expect = 2.923e-32
Identity = 62/134 (46.27%), Postives = 88/134 (65.67%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRF--SDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQ 464
            M+ I   R+  E K    S++ S +   V   D +   L G   G  +TPYE G+Y++ I+IP  +PF PPK +FIT++WHPNISSVTG ICL++L+  +W A+++LR VL S++ LL  AEP +PQDA+VA Q
Sbjct:    1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELKGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKD-QWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQ 133          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Medaka
Match: ube2d2 (ubiquitin conjugating enzyme E2 D2 [Source:NCBI gene;Acc:101162378])

HSP 1 Score: 95.5153 bits (236), Expect = 1.946e-24
Identity = 50/145 (34.48%), Postives = 80/145 (55.17%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R+  EL   + D        P  D D+ +   +  G  ++PY++G + + I  P+++PFKPPK  F TR++HPNI+S  G ICL++LR  +W  ++++  VL SI  LL    P +P    +A+ Y  ++E + K A  W   YA
Sbjct:    5 RIHKELNDLARDPPAQCSAGPVGD-DMFHWQATIMGPNDSPYQSGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILR-SQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNKIAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Medaka
Match: ube2d4 (ubiquitin-conjugating enzyme E2 D4 [Source:NCBI gene;Acc:101172587])

HSP 1 Score: 93.9745 bits (232), Expect = 7.182e-24
Identity = 49/145 (33.79%), Postives = 78/145 (53.79%), Query Frame = 3
Query:   90 RVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYA 524
            R+  EL     D        P  D D+ +   +  G  ++PY++G + + I  P+++PFKPPK  F T+++HPNI+S  G ICL++LR  +W  ++++  VL SI  LL    P +P    +A  Y  ++E + K A  W   YA
Sbjct:    5 RIQKELSDLQRDPPAQCSAGPVGD-DLFHWQATIMGPSDSPYQSGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINS-NGSICLDILR-SQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNKLAREWTQKYA 146          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Planmine SMEST
Match: SMESG000030285.1 (SMESG000030285.1)

HSP 1 Score: 406.371 bits (1043), Expect = 3.692e-146
Identity = 195/195 (100.00%), Postives = 195/195 (100.00%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNIDLIE 653
            MSQICHTRVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNIDLIE
Sbjct:    1 MSQICHTRVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNIDLIE 195          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Planmine SMEST
Match: SMESG000023146.1 (SMESG000023146.1)

HSP 1 Score: 277.715 bits (709), Expect = 3.058e-95
Identity = 127/194 (65.46%), Postives = 156/194 (80.41%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNIDLI 650
            M  IC  RV+ ELK+FS+D +DD+ L P  DSD+  LIGSF GFENTPY+ G+YEI+ +IPSNFPFKPPKAKFITRVWHPN+SS +G+ICL+LLR+ KW   +SL+NVLTSIKILLI A+P +PQDA VA Q++ N ELFEKTA YWNHV+A GPEK  F EM +KV LL+  G+ K EAVH+LS++ WNID+I
Sbjct:    1 MLNICEKRVIMELKKFSNDKADDMTLAPVDDSDVTKLIGSFVGFENTPYDGGRYEISFDIPSNFPFKPPKAKFITRVWHPNVSSASGYICLDLLREDKWAPGLSLKNVLTSIKILLILAQPDDPQDAAVASQFIGNHELFEKTAMYWNHVFAIGPEKPEFVEMTEKVNLLVSNGWDKTEAVHQLSIANWNIDMI 194          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Planmine SMEST
Match: SMESG000023116.1 (SMESG000023116.1)

HSP 1 Score: 268.47 bits (685), Expect = 9.481e-92
Identity = 122/183 (66.67%), Postives = 150/183 (81.97%), Query Frame = 3
Query:  102 ELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNIDLI 650
            ELK+FS+D +DD+ L P  DSD+  LIGSF GFENTPY+ G+YEI+ +IPSNFPFKPPKAKFITRVWHPN+SS +G+ICL+LLR+ KW A +SL+NVLTSIK LLI A+P +PQDA VA Q++ N ELFEKTA YWNHV+A GPEK  F EM +KV LL+  G+ K EAVH+LS++ WNID+I
Sbjct:    2 ELKKFSNDKADDMTLAPVDDSDVTKLIGSFVGFENTPYDGGRYEISFDIPSNFPFKPPKAKFITRVWHPNVSSASGYICLDLLREDKWAAGLSLKNVLTSIKTLLILAQPDDPQDAAVASQFIGNHELFEKTAMYWNHVFAGGPEKPEFVEMTEKVNLLVSNGWDKTEAVHQLSIANWNIDMI 184          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Planmine SMEST
Match: SMESG000023146.1 (SMESG000023146.1)

HSP 1 Score: 266.929 bits (681), Expect = 3.846e-91
Identity = 122/183 (66.67%), Postives = 150/183 (81.97%), Query Frame = 3
Query:  102 ELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNIDLI 650
            ELK+FS+D +DD+ L P  DSD+  LIGSF GFENTPY+ G+YEI+ +IPSNFPFKPPKAKFITRVWHPN+SS +G+ICL+LLR+ KW   +SL+NVLTSIKILLI A+P +PQDA VA Q++ N ELFEKTA YWNHV+A GPEK  F EM +KV LL+  G+ K EAVH+LS++ WNID+I
Sbjct:    2 ELKKFSNDKADDMTLAPVDDSDVTKLIGSFVGFENTPYDGGRYEISFDIPSNFPFKPPKAKFITRVWHPNVSSASGYICLDLLREDKWAPGLSLKNVLTSIKILLILAQPDDPQDAAVASQFIGNHELFEKTAMYWNHVFAIGPEKPEFVEMTEKVNLLVSNGWDKTEAVHQLSIANWNIDMI 184          
BLAST of Ubiquitin-conjugating enzyme E2 vs. Planmine SMEST
Match: SMESG000072498.1 (SMESG000072498.1)

HSP 1 Score: 260.381 bits (664), Expect = 1.956e-88
Identity = 121/195 (62.05%), Postives = 154/195 (78.97%), Query Frame = 3
Query:   69 MSQICHTRVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYENGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWVASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHVYAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNIDLIE 653
            MS     R+M ELKRF+ D   ++KL P +D D+ NLIGSF GFENTPYE G+Y+I  +IPS+FPFK PKA FITRVWHPNISSVTG ICL+LL+  KW  S+SL+N+LTSI+ LL+ AEP +PQDA+VA Q + NKEL+E+TA+YWN+++A GPEK YF EMD KV LL+ KG  K EA+HKLSM+ WNI++++
Sbjct:    1 MSNTSERRIMAELKRFNGDK--EMKLAPINDGDLRNLIGSFIGFENTPYEGGEYQIRFQIPSDFPFKVPKATFITRVWHPNISSVTGCICLDLLKGEKWQPSISLKNILTSIQTLLLLAEPDDPQDAVVASQLINNKELYEQTASYWNYIFANGPEKPYFKEMDMKVNLLVAKGLDKTEAIHKLSMADWNIEMVD 193          
The following BLAST results are available for this feature:
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UBE2K1.038e-4642.78ubiquitin conjugating enzyme E2 K [Source:HGNC Sym... [more]
UBE2K5.514e-3246.27ubiquitin conjugating enzyme E2 K [Source:HGNC Sym... [more]
UBE2K1.125e-2945.67ubiquitin conjugating enzyme E2 K [Source:HGNC Sym... [more]
UBE2D28.768e-2433.79ubiquitin conjugating enzyme E2 D2 [Source:HGNC Sy... [more]
UBE2D28.768e-2433.79ubiquitin conjugating enzyme E2 D2 [Source:HGNC Sy... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubc-214.973e-4841.33Probable ubiquitin-conjugating enzyme E2 21 [Sour... [more]
ubc-203.105e-4540.00UBiquitin Conjugating enzyme [Source:UniProtKB/Tr... [more]
C28G1.103.625e-3233.85pep chromosome:WBcel235:X:8847122:8848482:1 gene:W... [more]
let-702.977e-2433.79Ubiquitin-conjugating enzyme E2 2 [Source:UniProt... [more]
ubc-12.446e-2232.39Ubiquitin-conjugating enzyme E2 1 [Source:UniProt... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ubc41.650e-4242.56gene:FBgn0015321 transcript:FBtr0345603[more]
Ubc41.650e-4242.56gene:FBgn0015321 transcript:FBtr0076395[more]
Ubc41.650e-4242.56gene:FBgn0015321 transcript:FBtr0345604[more]
eff1.214e-2333.79gene:FBgn0011217 transcript:FBtr0310554[more]
eff1.214e-2333.79gene:FBgn0011217 transcript:FBtr0336876[more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2kb2.633e-4743.30ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, y... [more]
ube2kb2.633e-4743.30ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, y... [more]
ube2kb2.633e-4743.30ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, y... [more]
ube2kb3.557e-4546.91ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, y... [more]
ube2ka1.283e-4445.25ubiquitin-conjugating enzyme E2Ka (UBC1 homolog, y... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
orai14.272e-4742.78ORAI calcium release-activated calcium modulator 1... [more]
ube2d37.948e-2433.79ubiquitin conjugating enzyme E2 D3 [Source:NCBI ge... [more]
ube2d31.072e-2334.03ubiquitin conjugating enzyme E2 D3 [Source:NCBI ge... [more]
chmp2b2.321e-2333.79charged multivesicular body protein 2B [Source:Xen... [more]
ube2a2.508e-2333.10ubiquitin conjugating enzyme E2 A [Source:NCBI gen... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ube2k7.129e-4742.78ubiquitin-conjugating enzyme E2K [Source:MGI Symbo... [more]
Ube2k3.785e-3246.27ubiquitin-conjugating enzyme E2K [Source:MGI Symbo... [more]
Ube2k7.726e-3045.67ubiquitin-conjugating enzyme E2K [Source:MGI Symbo... [more]
Ube2d2b4.332e-2432.41ubiquitin-conjugating enzyme E2D 2B [Source:MGI Sy... [more]
Ube2d2a6.020e-2433.79ubiquitin-conjugating enzyme E2D 2A [Source:MGI Sy... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P52484|UBC21_CAEEL6.326e-4741.33Probable ubiquitin-conjugating enzyme E2 21 OS=Cae... [more]
sp|P61087|UBE2K_MOUSE4.987e-4642.78Ubiquitin-conjugating enzyme E2 K OS=Mus musculus ... [more]
sp|P61086|UBE2K_HUMAN4.987e-4642.78Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens ... [more]
sp|P61085|UBE2K_BOVIN4.987e-4642.78Ubiquitin-conjugating enzyme E2 K OS=Bos taurus OX... [more]
sp|P21734|UBC1_YEAST1.647e-4443.55Ubiquitin-conjugating enzyme E2 1 OS=Saccharomyces... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074ZPD72.876e-5045.88Ubiquitin--protein ligase OS=Opisthorchis viverrin... [more]
A0A0V0J3I73.814e-5045.92Ubiquitin-conjugating enzyme E2-22 kDa OS=Schistoc... [more]
A0A4S2LW329.804e-5045.36Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7Y6T19.804e-5045.36Ubiquitin-conjugating enzyme (Huntingtin interacti... [more]
A0A5E4QBB85.938e-4943.30Uncharacterized protein OS=Leptidea sinapis OX=189... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2kb2.232e-4743.30ubiquitin conjugating enzyme E2 K [Source:NCBI gen... [more]
ube2ka7.180e-4742.78ubiquitin-conjugating enzyme E2 K-like [Source:NCB... [more]
ube2kb2.941e-3246.27ubiquitin conjugating enzyme E2 K [Source:NCBI gen... [more]
ube2ka2.941e-3246.27ubiquitin-conjugating enzyme E2 K-like [Source:NCB... [more]
ENSAMXT00000053070.12.665e-2433.79ubiquitin-conjugating enzyme E2 D2-like [Source:NC... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2kb1.069e-4643.30ubiquitin-conjugating enzyme E2Kb (UBC1 homolog, y... [more]
ENSPMAT00000008817.11.819e-2433.10pep scaffold:Pmarinus_7.0:GL476329:1748443:1760143... [more]
ube2t1.204e-2130.87ubiquitin-conjugating enzyme E2T (putative) [Sourc... [more]
ENSPMAT00000010378.16.410e-2133.83pep scaffold:Pmarinus_7.0:GL477318:26908:31295:-1 ... [more]
ENSPMAT00000006211.12.486e-2031.58pep scaffold:Pmarinus_7.0:GL476897:3176:4886:1 gen... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
UBC12.372e-4643.55Ubiquitin-conjugating enzyme; key E2 partner with ... [more]
UBC52.635e-2535.86Ubiquitin-conjugating enzyme; mediates selective d... [more]
UBC41.033e-2334.48Ubiquitin-conjugating enzyme (E2); key E2 partner ... [more]
UBC137.789e-2331.03E2 ubiquitin-conjugating enzyme; involved in the e... [more]
UBC111.501e-2233.33Ubiquitin-conjugating enzyme; most similar in sequ... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO395501.585e-4840.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478871.149e-2432.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405952.412e-2233.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313272.412e-2233.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436695.469e-2231.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2kb1.009e-4642.27ubiquitin conjugating enzyme E2 K [Source:NCBI gen... [more]
ube2kb3.086e-4340.59ubiquitin conjugating enzyme E2 K [Source:NCBI gen... [more]
ube2ka2.923e-3246.27ubiquitin-conjugating enzyme E2 K [Source:NCBI gen... [more]
ube2d21.946e-2434.48ubiquitin conjugating enzyme E2 D2 [Source:NCBI ge... [more]
ube2d47.182e-2433.79ubiquitin-conjugating enzyme E2 D4 [Source:NCBI ge... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030285.13.692e-146100.00SMESG000030285.1[more]
SMESG000023146.13.058e-9565.46SMESG000023146.1[more]
SMESG000023116.19.481e-9266.67SMESG000023116.1[more]
SMESG000023146.13.846e-9166.67SMESG000023146.1[more]
SMESG000072498.11.956e-8862.05SMESG000072498.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026849 ID=SMED30026849|Name=Ubiquitin-conjugating enzyme E2|organism=Schmidtea mediterranea sexual|type=transcript|length=731bp
CTTGTTTAAATATGTAGAACGTTTAAAACGCTTTTAATTATTAAATTAAA
TTGTAATTCTTATACATTATGTCTCAAATATGCCATACAAGAGTTATGGG
AGAACTGAAAAGGTTTTCCGATGATAATTCTGATGATATCAAACTTGTTC
CAGCATCTGATTCAGATATTTTAAATCTTATTGGGTCTTTTAATGGATTT
GAAAACACACCCTATGAAAATGGAAAGTATGAAATCGCCATTGAAATTCC
TTCAAATTTTCCATTTAAACCACCGAAAGCCAAGTTTATTACTCGAGTTT
GGCATCCTAATATTAGTTCGGTAACTGGATTTATATGTTTAGAGTTACTT
AGGCAAGGAAAATGGGTTGCAAGTGTTTCGTTGAGAAATGTTCTCACATC
TATTAAGATACTTTTAATAACAGCAGAACCACATAACCCACAGGATGCTA
TGGTAGCCAAACAATATCTTGAAAATAAAGAGTTATTTGAAAAAACCGCT
GCGTATTGGAACCATGTTTATGCAGCGGGACCTGAGAAGTCATATTTTAC
CGAAATGGATGATAAAGTTAAATTGTTAATGGACAAAGGTTTTAGTAAAG
ATGAAGCTGTTCATAAGTTATCCATGTCATTCTGGAATATCGATTTGATT
GAATAAAATATGAAATTTATTCAGATAGACTTAATTTTTTATTAAATTGT
CATATTGAGATAGTTTTAACTTTTGTGCAAA
back to top

protein sequence of SMED30026849-orf-1

>SMED30026849-orf-1 ID=SMED30026849-orf-1|Name=SMED30026849-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=196bp
MSQICHTRVMGELKRFSDDNSDDIKLVPASDSDILNLIGSFNGFENTPYE
NGKYEIAIEIPSNFPFKPPKAKFITRVWHPNISSVTGFICLELLRQGKWV
ASVSLRNVLTSIKILLITAEPHNPQDAMVAKQYLENKELFEKTAAYWNHV
YAAGPEKSYFTEMDDKVKLLMDKGFSKDEAVHKLSMSFWNIDLIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR016135UBQ-conjugating_enzyme/RWD
IPR000608UBQ-conjugat_E2
IPR023313UBQ-conjugating_AS
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004842ubiquitin-protein transferase activity
GO:0005524ATP binding
GO:0016740transferase activity
GO:0031625ubiquitin protein ligase binding
GO:0034450ubiquitin-ubiquitin ligase activity
GO:0061630ubiquitin protein ligase activity
GO:0061631ubiquitin conjugating enzyme activity
Vocabulary: biological process
TermDefinition
GO:0000209protein polyubiquitination
GO:0010800positive regulation of peptidyl-threonine phosphorylation
GO:0010994free ubiquitin chain polymerization
GO:0016567protein ubiquitination
GO:0032434regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0035458cellular response to interferon-beta
GO:0060340positive regulation of type I interferon-mediated signaling pathway
GO:0070059intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
GO:0070936protein K48-linked ubiquitination
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0032433filopodium tip
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00212ubc_7coord: 7..153
e-value: 4.2E-38
score: 142.6
NoneNo IPR availablePANTHERPTHR24068FAMILY NOT NAMEDcoord: 1..154
NoneNo IPR availablePANTHERPTHR24068:SF164UBIQUITIN-CONJUGATING ENZYME E2 21-RELATEDcoord: 1..154
IPR016135Ubiquitin-conjugating enzyme/RWD-likeGENE3DG3DSA:3.10.110.10coord: 2..155
e-value: 1.7E-42
score: 146.6
IPR016135Ubiquitin-conjugating enzyme/RWD-likeSUPERFAMILYSSF54495UBC-likecoord: 1..153
IPR000608Ubiquitin-conjugating enzyme E2PFAMPF00179UQ_concoord: 8..146
e-value: 3.2E-35
score: 120.8
IPR000608Ubiquitin-conjugating enzyme E2PROSITEPS50127UBIQUITIN_CONJUGAT_2coord: 7..142
score: 32.795
IPR000608Ubiquitin-conjugating enzyme E2CDDcd00195UBCccoord: 8..147
e-value: 1.13039E-43
score: 140.415
IPR023313Ubiquitin-conjugating enzyme, active sitePROSITEPS00183UBIQUITIN_CONJUGAT_1coord: 78..94