SMED30026845

Overview
NameSMED30026845
Smed IDSMED30026845
Length (bp)1583
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30026845 (SMED30026845) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30026845 (SMED30026845) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30026845 (SMED30026845) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30026845 (SMED30026845) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026845

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30026845SMESG000038702.1 SMESG000038692.1 dd_Smed_v4_637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30026845SMESG000038704.1 dd_Smed_v4_555_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026845SMESG000038704.1 dd_Smed_v4_555_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30026845SMESG000038704.1 dd_Smed_v4_555_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30026845SMESG000038702.1 SMESG000038692.1 dd_Smed_v4_637_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026845SMESG000038702.1 SMESG000038692.1 dd_Smed_v4_637_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30026845 vs. Ensembl Human
Match: CTTN (cortactin [Source:HGNC Symbol;Acc:HGNC:3338])

HSP 1 Score: 363.614 bits (932), Expect = 2.261e-119
Identity = 197/359 (54.87%), Postives = 262/359 (72.98%), Query Frame = -2
Query:  419 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEPEAQVEHVTRDVEQLEINEPN 1495
            MWKA+AG  V +       DDW+ DPDF ND+SEKEQRWG+KTV GSG  +++++  L+E+V Q    +K+   +   K S GYGGKFGV++DRMDK A+G++Y   + KH SQ D  +GFGGK+GVQ DR D+SA G++YQ + +KH SQ+DYS GFGGKYGVQ DR DKSAVG++++ + EKH SQ+DYS GFGGKYG+  D+ DKSAV +E++ + +KH SQ+DY KGFGGK+GVQ DRQDK A+GW+H+EK++ H SQ+DY  GFGGKFGVQ++RQD +AV +++KE++ KH SQ D+SKGFGGK+GVQKDR DK+A  +  V    +  Q+  P   VE VT     +  N  N
Sbjct:    1 MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVP---VEAVTSKTSNIRANFEN 356          

HSP 2 Score: 68.5514 bits (166), Expect = 1.552e-11
Identity = 29/57 (50.88%), Postives = 38/57 (66.67%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI AVAL+D+    +DEI+F   + I NIE ID  WW G   GR G+FP+NYV++
Sbjct:  492 DLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVEL 548          
BLAST of SMED30026845 vs. Ensembl Human
Match: CTTN (cortactin [Source:HGNC Symbol;Acc:HGNC:3338])

HSP 1 Score: 363.614 bits (932), Expect = 2.261e-119
Identity = 197/359 (54.87%), Postives = 262/359 (72.98%), Query Frame = -2
Query:  419 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEPEAQVEHVTRDVEQLEINEPN 1495
            MWKA+AG  V +       DDW+ DPDF ND+SEKEQRWG+KTV GSG  +++++  L+E+V Q    +K+   +   K S GYGGKFGV++DRMDK A+G++Y   + KH SQ D  +GFGGK+GVQ DR D+SA G++YQ + +KH SQ+DYS GFGGKYGVQ DR DKSAVG++++ + EKH SQ+DYS GFGGKYG+  D+ DKSAV +E++ + +KH SQ+DY KGFGGK+GVQ DRQDK A+GW+H+EK++ H SQ+DY  GFGGKFGVQ++RQD +AV +++KE++ KH SQ D+SKGFGGK+GVQKDR DK+A  +  V    +  Q+  P   VE VT     +  N  N
Sbjct:    1 MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVP---VEAVTSKTSNIRANFEN 356          

HSP 2 Score: 68.5514 bits (166), Expect = 1.552e-11
Identity = 29/57 (50.88%), Postives = 38/57 (66.67%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI AVAL+D+    +DEI+F   + I NIE ID  WW G   GR G+FP+NYV++
Sbjct:  492 DLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVEL 548          
BLAST of SMED30026845 vs. Ensembl Human
Match: CTTN (cortactin [Source:HGNC Symbol;Acc:HGNC:3338])

HSP 1 Score: 315.849 bits (808), Expect = 2.623e-101
Identity = 167/288 (57.99%), Postives = 221/288 (76.74%), Query Frame = -2
Query:  632 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWE 1495
            MWKA+AG  V +       DDW+ DPDF ND+SEKEQRWG+KTV GSG  +++++  L+E+V Q    +K+   +   K S GYGGKFGV++DRMDK A+G++Y   + KH SQ D  +GFGGK+GVQ DR D+SA G++YQ + +KH SQ+DYS GFGGKYGVQ DR DKSAVG++++ + EKH SQ+DYS GFGGKYG+  D+ DKSAV +E++ + +KH SQ+DY KGFGGK+GVQ DRQDK A+GW+H+EK++ H SQ+DYSKGFGGK+GVQ DR DK+A ++E
Sbjct:    1 MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRMDKNASTFE 288          

HSP 2 Score: 68.1662 bits (165), Expect = 1.542e-11
Identity = 29/57 (50.88%), Postives = 38/57 (66.67%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI AVAL+D+    +DEI+F   + I NIE ID  WW G   GR G+FP+NYV++
Sbjct:  455 DLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVEL 511          
BLAST of SMED30026845 vs. Ensembl Human
Match: CTTN (cortactin [Source:HGNC Symbol;Acc:HGNC:3338])

HSP 1 Score: 315.849 bits (808), Expect = 2.623e-101
Identity = 167/288 (57.99%), Postives = 221/288 (76.74%), Query Frame = -2
Query:  632 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWE 1495
            MWKA+AG  V +       DDW+ DPDF ND+SEKEQRWG+KTV GSG  +++++  L+E+V Q    +K+   +   K S GYGGKFGV++DRMDK A+G++Y   + KH SQ D  +GFGGK+GVQ DR D+SA G++YQ + +KH SQ+DYS GFGGKYGVQ DR DKSAVG++++ + EKH SQ+DYS GFGGKYG+  D+ DKSAV +E++ + +KH SQ+DY KGFGGK+GVQ DRQDK A+GW+H+EK++ H SQ+DYSKGFGGK+GVQ DR DK+A ++E
Sbjct:    1 MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRMDKNASTFE 288          

HSP 2 Score: 68.1662 bits (165), Expect = 1.542e-11
Identity = 29/57 (50.88%), Postives = 38/57 (66.67%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI AVAL+D+    +DEI+F   + I NIE ID  WW G   GR G+FP+NYV++
Sbjct:  455 DLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVEL 511          
BLAST of SMED30026845 vs. Ensembl Human
Match: CTTN (cortactin [Source:HGNC Symbol;Acc:HGNC:3338])

HSP 1 Score: 315.849 bits (808), Expect = 7.036e-100
Identity = 168/293 (57.34%), Postives = 223/293 (76.11%), Query Frame = -2
Query:  617 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEV 1495
            MWKA+AG  V +       DDW+ DPDF ND+SEKEQRWG+KTV GSG  +++++  L+E+V Q    +K+   +   K S GYGGKFGV++DRMDK A+G++Y   + KH SQ D  +GFGGK+GVQ DR D+SA G++YQ + +KH SQ+DYS GFGGKYGVQ DR DKSAVG++++ + EKH SQ+DYS GFGGKYG+  D+ DKSAV +E++ + +KH SQ+DY KGFGGK+GVQ DRQDK A+GW+H+EK++ H SQ+DYSKGFGGK+GVQ DR DK+A ++E   +V
Sbjct:    1 MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRMDKNASTFEDVTQV 293          

HSP 2 Score: 51.9878 bits (123), Expect = 2.520e-6
Identity = 27/64 (42.19%), Postives = 34/64 (53.12%), Query Frame = -2
Query:   83 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQVDE*AILC 274
            D GI AVAL+D+    +DEI+F   + I NIE ID  WW G   GR      + V+V    I C
Sbjct:  455 DLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRFRELAFSCVRVALVPIKC 518          
BLAST of SMED30026845 vs. Ensembl Celegans
Match: sem-5 (Sex muscle abnormal protein 5 [Source:UniProtKB/Swiss-Prot;Acc:P29355])

HSP 1 Score: 59.6918 bits (143), Expect = 7.808e-10
Identity = 27/48 (56.25%), Postives = 33/48 (68.75%), Query Frame = -2
Query:  110 ALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYV 253
            ALFDF+ +E  E+ F  G+ I  I K D  WW G+LN RRG+FPSNYV
Sbjct:  161 ALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYV 208          
BLAST of SMED30026845 vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 56.225 bits (134), Expect = 1.018e-9
Identity = 24/50 (48.00%), Postives = 33/50 (66.00%), Query Frame = -2
Query:  104 ALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 253
            ALFDFD + E E++F  G  I  + +ID  W+ G +NG+ G+FP  YVQV
Sbjct:   48 ALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQV 97          
BLAST of SMED30026845 vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 57.3806 bits (137), Expect = 1.087e-8
Identity = 24/50 (48.00%), Postives = 33/50 (66.00%), Query Frame = -2
Query:  104 ALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 253
            ALFDFD + E E++F  G  I  + +ID  W+ G +NG+ G+FP  YVQV
Sbjct:  323 ALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQV 372          
BLAST of SMED30026845 vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 57.3806 bits (137), Expect = 1.125e-8
Identity = 24/50 (48.00%), Postives = 33/50 (66.00%), Query Frame = -2
Query:  104 ALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 253
            ALFDFD + E E++F  G  I  + +ID  W+ G +NG+ G+FP  YVQV
Sbjct:  325 ALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQV 374          
BLAST of SMED30026845 vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 57.3806 bits (137), Expect = 1.153e-8
Identity = 24/50 (48.00%), Postives = 33/50 (66.00%), Query Frame = -2
Query:  104 ALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 253
            ALFDFD + E E++F  G  I  + +ID  W+ G +NG+ G+FP  YVQV
Sbjct:  327 ALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQV 376          
BLAST of SMED30026845 vs. Ensembl Fly
Match: Cortactin (gene:FBgn0025865 transcript:FBtr0306349)

HSP 1 Score: 259.996 bits (663), Expect = 1.264e-79
Identity = 143/231 (61.90%), Postives = 181/231 (78.35%), Query Frame = -2
Query:  812 MWKATAGSKVKVEMKTNXXXXX-XXXXXXXXDISEKEQRWGSKTVTGSGKTD-YVDLKALKESVKQSDAAIKK-ISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDY 1495
            MWKA+AG +++     + +DD  + DPDF ND+SE+EQRWGSKT+ GSG+T   +D+  L+E  +Q+D   KK +  D+++   +GYGGKFGV+KDRMDK A+G+DY G V KHASQKDYS GFGGK+GVQ DRKDKSA GWD+  +V+KH SQ+DY+ GFGGK+GVQ DR DKSAVGW+H  ++EKH SQKDYS GFGGK+GVQ DR+DKSAV W+HKE  QKHASQ D+
Sbjct:    1 MWKASAGHQIQATSAASAEDDDWETDPDFVNDVSEQEQRWGSKTIDGSGRTAGTIDMDKLREETEQADLDKKKQLLKDQNA--GYGYGGKFGVEKDRMDKSAVGHDYQGKVGKHASQKDYSDGFGGKFGVQEDRKDKSAVGWDHVEKVEKHASQKDYATGFGGKFGVQSDRVDKSAVGWDHIEKVEKHESQKDYSKGFGGKFGVQEDRKDKSAVGWDHKEAPQKHASQVDH 229          

HSP 2 Score: 223.016 bits (567), Expect = 1.637e-65
Identity = 106/151 (70.20%), Postives = 130/151 (86.09%), Query Frame = -2
Query:  590 QDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDH 1042
            Q+   G+GGK+GV+KDR DKSAVG +++ ++ KHASQKDYS GFGGK+GVQ DR+DKSAV W+H E+++KHASQ+DY+ GFGGK+GVQ DR DKSAVGW+H EKVEKH SQ+DYSKGFGGKFGVQ DR+DKSAV W+HKE  +KH+SQ DH
Sbjct:   79 QNAGYGYGGKFGVEKDRMDKSAVGHDYQGKVGKHASQKDYSDGFGGKFGVQEDRKDKSAVGWDHVEKVEKHASQKDYATGFGGKFGVQSDRVDKSAVGWDHIEKVEKHESQKDYSKGFGGKFGVQEDRKDKSAVGWDHKEAPQKHASQVDH 229          

HSP 3 Score: 144.436 bits (363), Expect = 5.817e-37
Identity = 69/103 (66.99%), Postives = 87/103 (84.47%), Query Frame = -2
Query:  512 QDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVE 820
            Q+   G+GGK+GV++DR DKSAVG +++ KV KH+SQ+DYS GFGGKFGVQ DR+DKSAV W+H E+VEKH+SQ D++ GFGGKFGVQ DR DKSAVGW+ +E
Sbjct:   79 QNAGYGYGGKFGVEKDRMDKSAVGHDYQGKVGKHASQKDYSDGFGGKFGVQEDRKDKSAVGWDHVEKVEKHASQKDYATGFGGKFGVQSDRVDKSAVGWDHIE 181          

HSP 4 Score: 67.781 bits (164), Expect = 1.158e-11
Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI A+AL+D+   ++DEI+F   + I +IEKID  WW G    R G+FP+NYVQV
Sbjct:  498 DTGIHAIALYDYQAADDDEISFDPDDVITHIEKIDDGWWRGLCKNRYGLFPANYVQV 554          
BLAST of SMED30026845 vs. Ensembl Fly
Match: Cortactin (gene:FBgn0025865 transcript:FBtr0306347)

HSP 1 Score: 259.996 bits (663), Expect = 1.264e-79
Identity = 143/231 (61.90%), Postives = 181/231 (78.35%), Query Frame = -2
Query:  812 MWKATAGSKVKVEMKTNXXXXX-XXXXXXXXDISEKEQRWGSKTVTGSGKTD-YVDLKALKESVKQSDAAIKK-ISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDY 1495
            MWKA+AG +++     + +DD  + DPDF ND+SE+EQRWGSKT+ GSG+T   +D+  L+E  +Q+D   KK +  D+++   +GYGGKFGV+KDRMDK A+G+DY G V KHASQKDYS GFGGK+GVQ DRKDKSA GWD+  +V+KH SQ+DY+ GFGGK+GVQ DR DKSAVGW+H  ++EKH SQKDYS GFGGK+GVQ DR+DKSAV W+HKE  QKHASQ D+
Sbjct:    1 MWKASAGHQIQATSAASAEDDDWETDPDFVNDVSEQEQRWGSKTIDGSGRTAGTIDMDKLREETEQADLDKKKQLLKDQNA--GYGYGGKFGVEKDRMDKSAVGHDYQGKVGKHASQKDYSDGFGGKFGVQEDRKDKSAVGWDHVEKVEKHASQKDYATGFGGKFGVQSDRVDKSAVGWDHIEKVEKHESQKDYSKGFGGKFGVQEDRKDKSAVGWDHKEAPQKHASQVDH 229          

HSP 2 Score: 223.016 bits (567), Expect = 1.637e-65
Identity = 106/151 (70.20%), Postives = 130/151 (86.09%), Query Frame = -2
Query:  590 QDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDH 1042
            Q+   G+GGK+GV+KDR DKSAVG +++ ++ KHASQKDYS GFGGK+GVQ DR+DKSAV W+H E+++KHASQ+DY+ GFGGK+GVQ DR DKSAVGW+H EKVEKH SQ+DYSKGFGGKFGVQ DR+DKSAV W+HKE  +KH+SQ DH
Sbjct:   79 QNAGYGYGGKFGVEKDRMDKSAVGHDYQGKVGKHASQKDYSDGFGGKFGVQEDRKDKSAVGWDHVEKVEKHASQKDYATGFGGKFGVQSDRVDKSAVGWDHIEKVEKHESQKDYSKGFGGKFGVQEDRKDKSAVGWDHKEAPQKHASQVDH 229          

HSP 3 Score: 144.436 bits (363), Expect = 5.817e-37
Identity = 69/103 (66.99%), Postives = 87/103 (84.47%), Query Frame = -2
Query:  512 QDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVE 820
            Q+   G+GGK+GV++DR DKSAVG +++ KV KH+SQ+DYS GFGGKFGVQ DR+DKSAV W+H E+VEKH+SQ D++ GFGGKFGVQ DR DKSAVGW+ +E
Sbjct:   79 QNAGYGYGGKFGVEKDRMDKSAVGHDYQGKVGKHASQKDYSDGFGGKFGVQEDRKDKSAVGWDHVEKVEKHASQKDYATGFGGKFGVQSDRVDKSAVGWDHIE 181          

HSP 4 Score: 67.781 bits (164), Expect = 1.158e-11
Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI A+AL+D+   ++DEI+F   + I +IEKID  WW G    R G+FP+NYVQV
Sbjct:  498 DTGIHAIALYDYQAADDDEISFDPDDVITHIEKIDDGWWRGLCKNRYGLFPANYVQV 554          
BLAST of SMED30026845 vs. Ensembl Fly
Match: Cortactin (gene:FBgn0025865 transcript:FBtr0084039)

HSP 1 Score: 259.996 bits (663), Expect = 1.264e-79
Identity = 143/231 (61.90%), Postives = 181/231 (78.35%), Query Frame = -2
Query:  812 MWKATAGSKVKVEMKTNXXXXX-XXXXXXXXDISEKEQRWGSKTVTGSGKTD-YVDLKALKESVKQSDAAIKK-ISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDY 1495
            MWKA+AG +++     + +DD  + DPDF ND+SE+EQRWGSKT+ GSG+T   +D+  L+E  +Q+D   KK +  D+++   +GYGGKFGV+KDRMDK A+G+DY G V KHASQKDYS GFGGK+GVQ DRKDKSA GWD+  +V+KH SQ+DY+ GFGGK+GVQ DR DKSAVGW+H  ++EKH SQKDYS GFGGK+GVQ DR+DKSAV W+HKE  QKHASQ D+
Sbjct:    1 MWKASAGHQIQATSAASAEDDDWETDPDFVNDVSEQEQRWGSKTIDGSGRTAGTIDMDKLREETEQADLDKKKQLLKDQNA--GYGYGGKFGVEKDRMDKSAVGHDYQGKVGKHASQKDYSDGFGGKFGVQEDRKDKSAVGWDHVEKVEKHASQKDYATGFGGKFGVQSDRVDKSAVGWDHIEKVEKHESQKDYSKGFGGKFGVQEDRKDKSAVGWDHKEAPQKHASQVDH 229          

HSP 2 Score: 223.016 bits (567), Expect = 1.637e-65
Identity = 106/151 (70.20%), Postives = 130/151 (86.09%), Query Frame = -2
Query:  590 QDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDH 1042
            Q+   G+GGK+GV+KDR DKSAVG +++ ++ KHASQKDYS GFGGK+GVQ DR+DKSAV W+H E+++KHASQ+DY+ GFGGK+GVQ DR DKSAVGW+H EKVEKH SQ+DYSKGFGGKFGVQ DR+DKSAV W+HKE  +KH+SQ DH
Sbjct:   79 QNAGYGYGGKFGVEKDRMDKSAVGHDYQGKVGKHASQKDYSDGFGGKFGVQEDRKDKSAVGWDHVEKVEKHASQKDYATGFGGKFGVQSDRVDKSAVGWDHIEKVEKHESQKDYSKGFGGKFGVQEDRKDKSAVGWDHKEAPQKHASQVDH 229          

HSP 3 Score: 144.436 bits (363), Expect = 5.817e-37
Identity = 69/103 (66.99%), Postives = 87/103 (84.47%), Query Frame = -2
Query:  512 QDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVE 820
            Q+   G+GGK+GV++DR DKSAVG +++ KV KH+SQ+DYS GFGGKFGVQ DR+DKSAV W+H E+VEKH+SQ D++ GFGGKFGVQ DR DKSAVGW+ +E
Sbjct:   79 QNAGYGYGGKFGVEKDRMDKSAVGHDYQGKVGKHASQKDYSDGFGGKFGVQEDRKDKSAVGWDHVEKVEKHASQKDYATGFGGKFGVQSDRVDKSAVGWDHIE 181          

HSP 4 Score: 67.781 bits (164), Expect = 1.158e-11
Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI A+AL+D+   ++DEI+F   + I +IEKID  WW G    R G+FP+NYVQV
Sbjct:  498 DTGIHAIALYDYQAADDDEISFDPDDVITHIEKIDDGWWRGLCKNRYGLFPANYVQV 554          
BLAST of SMED30026845 vs. Ensembl Fly
Match: Cortactin (gene:FBgn0025865 transcript:FBtr0306348)

HSP 1 Score: 259.996 bits (663), Expect = 1.264e-79
Identity = 143/231 (61.90%), Postives = 181/231 (78.35%), Query Frame = -2
Query:  812 MWKATAGSKVKVEMKTNXXXXX-XXXXXXXXDISEKEQRWGSKTVTGSGKTD-YVDLKALKESVKQSDAAIKK-ISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDY 1495
            MWKA+AG +++     + +DD  + DPDF ND+SE+EQRWGSKT+ GSG+T   +D+  L+E  +Q+D   KK +  D+++   +GYGGKFGV+KDRMDK A+G+DY G V KHASQKDYS GFGGK+GVQ DRKDKSA GWD+  +V+KH SQ+DY+ GFGGK+GVQ DR DKSAVGW+H  ++EKH SQKDYS GFGGK+GVQ DR+DKSAV W+HKE  QKHASQ D+
Sbjct:    1 MWKASAGHQIQATSAASAEDDDWETDPDFVNDVSEQEQRWGSKTIDGSGRTAGTIDMDKLREETEQADLDKKKQLLKDQNA--GYGYGGKFGVEKDRMDKSAVGHDYQGKVGKHASQKDYSDGFGGKFGVQEDRKDKSAVGWDHVEKVEKHASQKDYATGFGGKFGVQSDRVDKSAVGWDHIEKVEKHESQKDYSKGFGGKFGVQEDRKDKSAVGWDHKEAPQKHASQVDH 229          

HSP 2 Score: 223.016 bits (567), Expect = 1.637e-65
Identity = 106/151 (70.20%), Postives = 130/151 (86.09%), Query Frame = -2
Query:  590 QDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDH 1042
            Q+   G+GGK+GV+KDR DKSAVG +++ ++ KHASQKDYS GFGGK+GVQ DR+DKSAV W+H E+++KHASQ+DY+ GFGGK+GVQ DR DKSAVGW+H EKVEKH SQ+DYSKGFGGKFGVQ DR+DKSAV W+HKE  +KH+SQ DH
Sbjct:   79 QNAGYGYGGKFGVEKDRMDKSAVGHDYQGKVGKHASQKDYSDGFGGKFGVQEDRKDKSAVGWDHVEKVEKHASQKDYATGFGGKFGVQSDRVDKSAVGWDHIEKVEKHESQKDYSKGFGGKFGVQEDRKDKSAVGWDHKEAPQKHASQVDH 229          

HSP 3 Score: 144.436 bits (363), Expect = 5.817e-37
Identity = 69/103 (66.99%), Postives = 87/103 (84.47%), Query Frame = -2
Query:  512 QDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVE 820
            Q+   G+GGK+GV++DR DKSAVG +++ KV KH+SQ+DYS GFGGKFGVQ DR+DKSAV W+H E+VEKH+SQ D++ GFGGKFGVQ DR DKSAVGW+ +E
Sbjct:   79 QNAGYGYGGKFGVEKDRMDKSAVGHDYQGKVGKHASQKDYSDGFGGKFGVQEDRKDKSAVGWDHVEKVEKHASQKDYATGFGGKFGVQSDRVDKSAVGWDHIE 181          

HSP 4 Score: 67.781 bits (164), Expect = 1.158e-11
Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI A+AL+D+   ++DEI+F   + I +IEKID  WW G    R G+FP+NYVQV
Sbjct:  498 DTGIHAIALYDYQAADDDEISFDPDDVITHIEKIDDGWWRGLCKNRYGLFPANYVQV 554          
BLAST of SMED30026845 vs. Ensembl Fly
Match: Abp1 (gene:FBgn0036372 transcript:FBtr0075819)

HSP 1 Score: 56.225 bits (134), Expect = 4.353e-8
Identity = 26/62 (41.94%), Postives = 40/62 (64.52%), Query Frame = -2
Query:  104 QAVGDEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGE-LNGRRGMFPSNYVQV 286
            + +GD G  A AL+D+   +E EI F  G+ I +I++ID  WW G   +G  G+FP+NYV++
Sbjct:  468 ETLGDLGQRARALYDYQAADETEITFDPGDVITHIDQIDEGWWQGLGPDGTYGLFPANYVEI 529          
BLAST of SMED30026845 vs. Ensembl Zebrafish
Match: hcls1 (hematopoietic cell-specific Lyn substrate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7191])

HSP 1 Score: 355.91 bits (912), Expect = 1.442e-116
Identity = 173/335 (51.64%), Postives = 262/335 (78.21%), Query Frame = -2
Query:  491 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQ 1495
            MWK+  G  V VE ++  DD         + +SE+EQRWG+KT+ GSG+ +++ +  L+++V +    +KK   D+  K S+GYGGKFGV+KDRMDK ALG+ YV  V++H+SQ D ++GFGGK+GVQ DR DKSA  ++Y+++VQ+H SQ+DY++GFGGKYGVQK+R DK+A+G+++K E EKH SQKDY+ GFGGKYGV+ ++ DK+A+ +++K E +KH SQ+DY+KGFGGKYGV++++ DK+A+G++++ + EKH SQ+DY+KGFGGK+GV+ ++ DK+A+ +++K E EKH SQ D++KGFGG++GVQ+DR DK+A  +N +E+P ++ +
Sbjct:    1 MWKSVVGHDVTVETESQGDDWETDPNFEND-VSEQEQRWGAKTIEGSGRKEHISIADLRQNVSREHEVVKKKELDQGPKASYGYGGKFGVEKDRMDKGALGHSYVAEVEQHSSQTDAAKGFGGKFGVQKDRVDKSAMSYEYKAQVQQHASQKDYAQGFGGKYGVQKERVDKAAMGYDYKGETEKHQSQKDYAKGFGGKYGVEKEKVDKAAMGYDYKGETEKHQSQKDYAKGFGGKYGVEKEKVDKAALGYDYKGETEKHQSQKDYAKGFGGKYGVEKEKVDKAALGYDYKGETEKHQSQKDYAKGFGGRYGVQEDRMDKNASSFNKMESPSSSYE 334          

HSP 2 Score: 68.5514 bits (166), Expect = 7.766e-12
Identity = 26/59 (44.07%), Postives = 41/59 (69.49%), Query Frame = -2
Query:  104 VGDEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 280
            +G  G  A A++D+ GE+ DEI+F+  + I NIE +D  WW G  NGR G+FP+++V++
Sbjct:  489 LGGGGTTARAIYDYQGEDSDEISFMPDDIITNIEMVDEGWWKGMCNGRTGLFPASFVEL 547          
BLAST of SMED30026845 vs. Ensembl Zebrafish
Match: hcls1 (hematopoietic cell-specific Lyn substrate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7191])

HSP 1 Score: 355.525 bits (911), Expect = 2.620e-116
Identity = 173/335 (51.64%), Postives = 262/335 (78.21%), Query Frame = -2
Query:  491 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQ 1495
            MWK+  G  V VE ++  DD         + +SE+EQRWG+KT+ GSG+ +++ +  L+++V +    +KK   D+  K S+GYGGKFGV+KDRMDK ALG+ YV  V++H+SQ D ++GFGGK+GVQ DR DKSA  ++Y+++VQ+H SQ+DY++GFGGKYGVQK+R DK+A+G+++K E EKH SQKDY+ GFGGKYGV+ ++ DK+A+ +++K E +KH SQ+DY+KGFGGKYGV++++ DK+A+G++++ + EKH SQ+DY+KGFGGK+GV+ ++ DK+A+ +++K E EKH SQ D++KGFGG++GVQ+DR DK+A  +N +E+P ++ +
Sbjct:    1 MWKSVVGHDVTVETESQGDDWETDPNFEND-VSEQEQRWGAKTIEGSGRKEHISIADLRQNVSREHEVVKKKELDQGPKASYGYGGKFGVEKDRMDKGALGHSYVAEVEQHSSQTDAAKGFGGKFGVQKDRVDKSAMSYEYKAQVQQHASQKDYAQGFGGKYGVQKERVDKAAMGYDYKGETEKHQSQKDYAKGFGGKYGVEKEKVDKAAMGYDYKGETEKHQSQKDYAKGFGGKYGVEKEKVDKAALGYDYKGETEKHQSQKDYAKGFGGKYGVEKEKVDKAALGYDYKGETEKHQSQKDYAKGFGGRYGVQEDRMDKNASSFNKMESPSSSYE 334          

HSP 2 Score: 68.9366 bits (167), Expect = 7.139e-12
Identity = 26/59 (44.07%), Postives = 41/59 (69.49%), Query Frame = -2
Query:  104 VGDEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 280
            +G  G  A A++D+ GE+ DEI+F+  + I NIE +D  WW G  NGR G+FP+++V++
Sbjct:  491 LGGGGTTARAIYDYQGEDSDEISFMPDDIITNIEMVDEGWWKGMCNGRTGLFPASFVEL 549          
BLAST of SMED30026845 vs. Ensembl Zebrafish
Match: cttn (cortactin [Source:ZFIN;Acc:ZDB-GENE-040715-3])

HSP 1 Score: 311.997 bits (798), Expect = 1.043e-99
Identity = 163/299 (54.52%), Postives = 221/299 (73.91%), Query Frame = -2
Query:  602 IMWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSS 1498
             MWKA AG  V + +    DD         + +SEKEQRWG+KTV GSG  +++++  L+++V    + +K+       K S GYGGKFG+Q+DRMDK A+G++Y   + KH SQ D S+GFGGKYG+Q DR D+SA G++Y  + +KH SQ+DYS GFGG+YGVQ DR D+SAVG+E++ + EKH SQKDY+ GFGGK+GV+ D+ DKSA+ +E++ + +KH SQ+DY KGFGGK+GVQ DRQDKSAVGW+H+EK++ H SQ+DYSKGFGGK+GVQ DR DKSA ++   EEV+K S+
Sbjct:   69 TMWKAAAGQSVSMSVDEGADDWETDPDFEND-VSEKEQRWGAKTVQGSGHQEHINIHKLRQTVSTEHSDLKQKELATMPKASHGYGGKFGLQQDRMDKSAVGHEYQSKLSKHCSQTDTSKGFGGKYGLQEDRVDQSAVGFEYVGKTEKHASQKDYSTGFGGRYGVQADRVDQSAVGFEYQGKTEKHESQKDYAKGFGGKFGVETDKVDKSAMGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKSAVGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRMDKSAGTF---EEVQKPSA 363          

HSP 2 Score: 66.6254 bits (161), Expect = 3.492e-11
Identity = 29/57 (50.88%), Postives = 37/57 (64.91%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI AVAL+D+    +DEI+F   + I NIE ID  WW G   G  G+FP+NYV+V
Sbjct:  478 DVGITAVALYDYQAAGDDEISFDPDDIITNIEMIDEGWWRGVCRGAYGLFPANYVEV 534          
BLAST of SMED30026845 vs. Ensembl Zebrafish
Match: cttn (cortactin [Source:ZFIN;Acc:ZDB-GENE-040715-3])

HSP 1 Score: 109.383 bits (272), Expect = 4.007e-27
Identity = 63/150 (42.00%), Postives = 90/150 (60.00%), Query Frame = -2
Query: 1061 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTD-----RKDKSAAGWDYQSEV 1495
            MWKA AG  V + +    DD         + +SEKEQRWG+KTV GSG  +++++  L+++V    + +K+       K S GYGGKFG+Q+DRMDK A+G++Y   + KH SQ D S+GFGGKYG+Q D       D  A  ++Y  +V
Sbjct:    1 MWKAAAGQSVSMSVDEGADDWETDPDFEND-VSEKEQRWGAKTVQGSGHQEHINIHKLRQTVSTEHSDLKQKELATMPKASHGYGGKFGLQQDRMDKSAVGHEYQSKLSKHCSQTDTSKGFGGKYGLQEDLYQNTEPDTGAESYEYAEDV 149          

HSP 2 Score: 78.5666 bits (192), Expect = 2.498e-16
Identity = 55/135 (40.74%), Postives = 76/135 (56.30%), Query Frame = -2
Query:  617 DKSAVGWEHKAELEKHASQKDY-----SVGFGGKYGVQNDRQDKSAVNWEHKEEMQKH-ASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQAD-----RQDKSAVSWEHKEEV 988
            D+ A  WE   + E   S+K+      +V   G     N  + +  V+ EH +  QK  A+    S G+GGK+G+QQDR DKSAVG E++ K+ KH SQ D SKGFGGK+G+Q D       D  A S+E+ E+V
Sbjct:   15 DEGADDWETDPDFENDVSEKEQRWGAKTVQGSGHQEHINIHKLRQTVSTEHSDLKQKELATMPKASHGYGGKFGLQQDRMDKSAVGHEYQSKLSKHCSQTDTSKGFGGKYGLQEDLYQNTEPDTGAESYEYAEDV 149          

HSP 3 Score: 70.0922 bits (170), Expect = 2.196e-13
Identity = 36/70 (51.43%), Postives = 50/70 (71.43%), Query Frame = -2
Query:  839 SKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGV-----QNDRQDKSAVNWEHKEEM 1033
            S G+GGK+G+Q+DR DKSAVG E++++L KH SQ D S GFGGKYG+     QN   D  A ++E+ E++
Sbjct:   80 SHGYGGKFGLQQDRMDKSAVGHEYQSKLSKHCSQTDTSKGFGGKYGLQEDLYQNTEPDTGAESYEYAEDV 149          

HSP 4 Score: 68.9366 bits (167), Expect = 5.314e-13
Identity = 36/72 (50.00%), Postives = 50/72 (69.44%), Query Frame = -2
Query:  551 KSAVGWEHREKVEKH-SSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKD 763
            +  V  EH +  +K  ++    S G+GGKFG+Q DR DKSAV  E++ ++ KH SQTD SKGFGGK+G+Q+D
Sbjct:   58 RQTVSTEHSDLKQKELATMPKASHGYGGKFGLQQDRMDKSAVGHEYQSKLSKHCSQTDTSKGFGGKYGLQED 129          

HSP 5 Score: 65.4698 bits (158), Expect = 8.817e-12
Identity = 29/57 (50.88%), Postives = 37/57 (64.91%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI AVAL+D+    +DEI+F   + I NIE ID  WW G   G  G+FP+NYV+V
Sbjct:  148 DVGITAVALYDYQAAGDDEISFDPDDIITNIEMIDEGWWRGVCRGAYGLFPANYVEV 204          
BLAST of SMED30026845 vs. Ensembl Zebrafish
Match: grap2a (GRB2 related adaptor protein 2a [Source:ZFIN;Acc:ZDB-GENE-050417-275])

HSP 1 Score: 61.2326 bits (147), Expect = 5.679e-10
Identity = 24/53 (45.28%), Postives = 36/53 (67.92%), Query Frame = -2
Query:  107 IVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQ 265
            I   A++DF  EE+DE+ F +G+ I  +++ DA WW G L GR G+FP+NY +
Sbjct:  230 IQVRAIYDFTAEEDDELGFNSGDIIEVLDRSDASWWKGRLRGRSGLFPANYTE 282          
BLAST of SMED30026845 vs. Ensembl Xenopus
Match: cttn (cortactin [Source:NCBI gene;Acc:100038122])

HSP 1 Score: 356.681 bits (914), Expect = 9.410e-117
Identity = 190/339 (56.05%), Postives = 256/339 (75.52%), Query Frame = -2
Query:  479 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEP 1495
            MWK+ AG  + +   T++ DDW+ DPDF NDI+EKEQRWG+KTV GSG  +++++  L+E V      IK+   +   K S GYGGKFGV+KDRMDK A+G++Y   + KH SQ D ++GFGGK+GVQTDR D+SA  +DY+ + +KH SQ+DY+ GFGGKYGVQ DR DKSA G+++KA+ EKH SQ DY+ GFGGK+GVQ DR DKSAV ++++ + +KH SQ+DYSKGFGGKYGV ++  DKSA+G++++ K EKH SQ+DY KGFGGKFGVQ DRQD  A+ W+H+E+++ H SQ D+SKGFGGK+GVQKDR DK+A  +  +E   ++ Q+  P
Sbjct:    8 MWKSAAGHSLSI--STDETDDWETDPDFVNDINEKEQRWGAKTVEGSGHQEHINIHKLREKVSHEHQEIKEKELEIGPKASHGYGGKFGVEKDRMDKMAVGHEYQTKLSKHCSQLDATKGFGGKFGVQTDRVDQSAVNFDYKGKTEKHASQKDYATGFGGKYGVQADRVDKSAHGFDYKAKTEKHESQIDYTTGFGGKFGVQADRVDKSAVGYDYQGKTEKHESQKDYSKGFGGKYGVDKENVDKSALGFDYQGKTEKHESQKDYVKGFGGKFGVQTDRQDACALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRMDKAAASFEDIEKVSSSYQKTRP 344          
BLAST of SMED30026845 vs. Ensembl Xenopus
Match: cttn (cortactin [Source:NCBI gene;Acc:100038122])

HSP 1 Score: 357.451 bits (916), Expect = 1.164e-116
Identity = 191/341 (56.01%), Postives = 257/341 (75.37%), Query Frame = -2
Query:  479 IIMWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEP 1501
            I MWK+ AG  + +   T++ DDW+ DPDF NDI+EKEQRWG+KTV GSG  +++++  L+E V      IK+   +   K S GYGGKFGV+KDRMDK A+G++Y   + KH SQ D ++GFGGK+GVQTDR D+SA  +DY+ + +KH SQ+DY+ GFGGKYGVQ DR DKSA G+++KA+ EKH SQ DY+ GFGGK+GVQ DR DKSAV ++++ + +KH SQ+DYSKGFGGKYGV ++  DKSA+G++++ K EKH SQ+DY KGFGGKFGVQ DRQD  A+ W+H+E+++ H SQ D+SKGFGGK+GVQKDR DK+A  +  +E   ++ Q+  P
Sbjct:   33 IGMWKSAAGHSLSI--STDETDDWETDPDFVNDINEKEQRWGAKTVEGSGHQEHINIHKLREKVSHEHQEIKEKELEIGPKASHGYGGKFGVEKDRMDKMAVGHEYQTKLSKHCSQLDATKGFGGKFGVQTDRVDQSAVNFDYKGKTEKHASQKDYATGFGGKYGVQADRVDKSAHGFDYKAKTEKHESQIDYTTGFGGKFGVQADRVDKSAVGYDYQGKTEKHESQKDYSKGFGGKYGVDKENVDKSALGFDYQGKTEKHESQKDYVKGFGGKFGVQTDRQDACALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRMDKAAASFEDIEKVSSSYQKTRP 371          
BLAST of SMED30026845 vs. Ensembl Xenopus
Match: cttn (cortactin [Source:NCBI gene;Acc:100038122])

HSP 1 Score: 355.91 bits (912), Expect = 1.441e-116
Identity = 194/362 (53.59%), Postives = 264/362 (72.93%), Query Frame = -2
Query:  440 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEP----------EAQVEHVTRDVEQ 1495
            MWK+ AG  + +   T++ DDW+ DPDF NDI+EKEQRWG+KTV GSG  +++++  L+E V      IK+   +   K S GYGGKFGV+KDRMDK A+G++Y   + KH SQ D ++GFGGK+GVQTDR D+SA  +DY+ + +KH SQ+DY+ GFGGKYGVQ DR DKSA G+++KA+ EKH SQ DY+ GFGGK+GVQ DR DKSAV ++++ + +KH SQ+DYSKGFGGKYGV ++  DKSA+G++++ K EKH SQ+DY KGFGGKFGVQ DRQD  A+ W+H+E+++ H SQ D+SKGFGGK+GVQKDR DK+A  +  +E   ++ Q+  P           A  E++ +D E+
Sbjct:   14 MWKSAAGHSLSIS--TDETDDWETDPDFVNDINEKEQRWGAKTVEGSGHQEHINIHKLREKVSHEHQEIKEKELEIGPKASHGYGGKFGVEKDRMDKMAVGHEYQTKLSKHCSQLDATKGFGGKFGVQTDRVDQSAVNFDYKGKTEKHASQKDYATGFGGKYGVQADRVDKSAHGFDYKAKTEKHESQIDYTTGFGGKFGVQADRVDKSAVGYDYQGKTEKHESQKDYSKGFGGKYGVDKENVDKSALGFDYQGKTEKHESQKDYVKGFGGKFGVQTDRQDACALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRMDKAAASFEDIEKVSSSYQKTRPVEVGSKASSIRANFENLAKDKEE 373          

HSP 2 Score: 60.4622 bits (145), Expect = 4.726e-9
Identity = 26/57 (45.61%), Postives = 36/57 (63.16%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI A+AL+D+    +DEI+F   + I NIE ID  WW G      G+FP+NYV++
Sbjct:  473 DVGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGFCKECYGLFPANYVEL 529          
BLAST of SMED30026845 vs. Ensembl Xenopus
Match: cttn (cortactin [Source:NCBI gene;Acc:100038122])

HSP 1 Score: 348.206 bits (892), Expect = 2.093e-113
Identity = 186/319 (58.31%), Postives = 246/319 (77.12%), Query Frame = -2
Query:  539 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDK 1495
            MWK+ AG  + +   T++ DDW+ DPDF NDI+EKEQRWG+KTV GSG  +++++  L+E V      IK+   +   K S GYGGKFGV+KDRMDK A+G++Y   + KH SQ D ++GFGGK+GVQTDR D+SA  +DY+ + +KH SQ+DY+ GFGGKYGVQ DR DKSA G+++KA+ EKH SQ DY+ GFGGK+GVQ DR DKSAV ++++ + +KH SQ+DYSKGFGGKYGV ++  DKSA+G++++ K EKH SQ+DY KGFGGKFGVQ DRQD  A+ W+H+E+++ H SQ D+SKGFGGK+GVQKDR DK
Sbjct:   29 MWKSAAGHSLSI--STDETDDWETDPDFVNDINEKEQRWGAKTVEGSGHQEHINIHKLREKVSHEHQEIKEKELEIGPKASHGYGGKFGVEKDRMDKMAVGHEYQTKLSKHCSQLDATKGFGGKFGVQTDRVDQSAVNFDYKGKTEKHASQKDYATGFGGKYGVQADRVDKSAHGFDYKAKTEKHESQIDYTTGFGGKFGVQADRVDKSAVGYDYQGKTEKHESQKDYSKGFGGKYGVDKENVDKSALGFDYQGKTEKHESQKDYVKGFGGKFGVQTDRQDACALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRMDK 345          
BLAST of SMED30026845 vs. Ensembl Xenopus
Match: cttn (cortactin [Source:NCBI gene;Acc:100038122])

HSP 1 Score: 339.347 bits (869), Expect = 1.696e-110
Identity = 218/504 (43.25%), Postives = 306/504 (60.71%), Query Frame = -2
Query:  104 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKF--------GVQKDRQDK-------------------------------SAVGWNTVEAPKANVQEKEPEAQV-EHVTRDVEQLEINEPNRNDDSNEHEQQHIPIVXXXXXXXXXXXXXXXXXXXXXXXXXKVVQAVGDEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 1495
            MWK+ AG  + +   T++ DDW+ DPDF NDI+EKEQRWG+KTV GSG  +++++  L+E V      IK+   +   K S GYGGKFGV+KDRMDK A+G++Y   + KH SQ D ++GFGGK+GVQTDR D+SA  +DY+ + +KH SQ+DY+ GFGGKYGVQ DR DKSA G+++KA+ EKH SQ DY+ GFGGK+GVQ DR DKSAV ++++ + +KH SQ+DYSKGFGGKYGV ++  DKSA+G++++ K EKH SQ+DYSKGFGGK+GVQ DR DK+A S+E  E+V     +T   +  G K          + KD++++                               SA       +PKA +  K PE+ + E  T + E    +EP+R     E      P  +  E H +  ++   +   + + E    +   D GI A+AL+D+    +DEI+F   + I NIE ID  WW G      G+FP+NYV++
Sbjct:    8 MWKSAAGHSLSI--STDETDDWETDPDFVNDINEKEQRWGAKTVEGSGHQEHINIHKLREKVSHEHQEIKEKELEIGPKASHGYGGKFGVEKDRMDKMAVGHEYQTKLSKHCSQLDATKGFGGKFGVQTDRVDQSAVNFDYKGKTEKHASQKDYATGFGGKYGVQADRVDKSAHGFDYKAKTEKHESQIDYTTGFGGKFGVQADRVDKSAVGYDYQGKTEKHESQKDYSKGFGGKYGVDKENVDKSALGFDYQGKTEKHESQKDYSKGFGGKYGVQKDRMDKAAASFEDIEKVSSSYQKTRPVEVEGSKASSIRANFENLAKDKEEEDRKKAEAERAQRMERERREQEQARRRQEEQESAKPPTPPASPKAPI--KVPESPIYEDATPEYE----SEPHRAPPVAEPVYAEEPDYQDAEMHKEAAQEAVYESADYQEAENTYDEYNEDVGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGFCKECYGLFPANYVEL 503          
BLAST of SMED30026845 vs. Ensembl Mouse
Match: Cttn (cortactin [Source:MGI Symbol;Acc:MGI:99695])

HSP 1 Score: 362.459 bits (929), Expect = 5.130e-119
Identity = 196/359 (54.60%), Postives = 261/359 (72.70%), Query Frame = -2
Query:  419 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEPEAQVEHVTRDVEQLEINEPN 1495
            MWKA+AG  V +       DDW+ DPDF ND+SEKEQRWG+KTV GSG  +++++  L+E+V Q    +K+   +   K S GYGGKFGV++DRMD+ A+G++Y   + KH SQ D  +GFGGK+GVQ DR D+SA G++YQ + +KH SQ+DYS GFGGKYGVQ DR DKSAVG++++ + EKH SQKDYS GFGGKYG+  D+ DKSAV +E++ + +KH SQ+DY KGFGGK+GVQ DRQDK A+GW+H+EK++ H SQ+DY  GFGGKFGVQ++RQD SAV +++KE + KH SQ D++KGFGGK+GVQKDR DK+A  +  V    +  Q+  P   +E VT     +  N  N
Sbjct:    1 MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDRSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSSAVGFDYKERLAKHESQQDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVP---IEAVTSKTSNIRANFEN 356          

HSP 2 Score: 67.781 bits (164), Expect = 1.668e-11
Identity = 28/57 (49.12%), Postives = 38/57 (66.67%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI A+AL+D+    +DEI+F   + I NIE ID  WW G   GR G+FP+NYV++
Sbjct:  488 DLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVEL 544          
BLAST of SMED30026845 vs. Ensembl Mouse
Match: Cttn (cortactin [Source:MGI Symbol;Acc:MGI:99695])

HSP 1 Score: 315.079 bits (806), Expect = 3.512e-101
Identity = 166/288 (57.64%), Postives = 221/288 (76.74%), Query Frame = -2
Query:  632 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWE 1495
            MWKA+AG  V +       DDW+ DPDF ND+SEKEQRWG+KTV GSG  +++++  L+E+V Q    +K+   +   K S GYGGKFGV++DRMD+ A+G++Y   + KH SQ D  +GFGGK+GVQ DR D+SA G++YQ + +KH SQ+DYS GFGGKYGVQ DR DKSAVG++++ + EKH SQKDYS GFGGKYG+  D+ DKSAV +E++ + +KH SQ+DY KGFGGK+GVQ DRQDK A+GW+H+EK++ H SQ+DY+KGFGGK+GVQ DR DK+A ++E
Sbjct:    1 MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDRSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYAKGFGGKYGVQKDRMDKNASTFE 288          

HSP 2 Score: 67.781 bits (164), Expect = 1.614e-11
Identity = 28/57 (49.12%), Postives = 38/57 (66.67%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI A+AL+D+    +DEI+F   + I NIE ID  WW G   GR G+FP+NYV++
Sbjct:  451 DLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVEL 507          
BLAST of SMED30026845 vs. Ensembl Mouse
Match: Hcls1 (hematopoietic cell specific Lyn substrate 1 [Source:MGI Symbol;Acc:MGI:104568])

HSP 1 Score: 230.72 bits (587), Expect = 4.762e-69
Identity = 115/217 (53.00%), Postives = 160/217 (73.73%), Query Frame = -2
Query:  845 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKE 1495
            MWK+  G  V V ++T  DD         + ISEKEQRWG+KT+ GSG+T+++++  L+  V +    +KK   +   K S GYGG+FGV++DRMDK A+G++YV  V+KH+SQ D ++GFGGKYGV+ DR DKSA G+DY+ EV+KH SQ+DYS GFGG+YGV+KD++DK+A+G+++K E EKH SQ+DY+ GFGG+YG+Q DR DKSAV +   E
Sbjct:    1 MWKSVVGHDVSVSVETQGDDWDTDPDFVND-ISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDILKKKELESGPKASHGYGGRFGVERDRMDKSAVGHEYVADVEKHSSQTDAARGFGGKYGVERDRADKSAVGFDYKGEVEKHASQKDYSHGFGGRYGVEKDKRDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEME 216          

HSP 2 Score: 55.8398 bits (133), Expect = 9.545e-8
Identity = 21/49 (42.86%), Postives = 33/49 (67.35%), Query Frame = -2
Query:  104 LFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 250
            L+D+ GE  DE++F   + I +IE +D  WW G+  G  G+FP+NYV++
Sbjct:  437 LYDYQGEGSDELSFDPDDIITDIEMVDEGWWRGQCRGHFGLFPANYVKL 485          
BLAST of SMED30026845 vs. Ensembl Mouse
Match: Hcls1 (hematopoietic cell specific Lyn substrate 1 [Source:MGI Symbol;Acc:MGI:104568])

HSP 1 Score: 122.479 bits (306), Expect = 1.441e-32
Identity = 64/134 (47.76%), Postives = 91/134 (67.91%), Query Frame = -2
Query: 1094 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDK 1495
            MWK+  G  V V ++T  DD         + ISEKEQRWG+KT+ GSG+T+++++  L+  V +    +KK   +   K S GYGG+FGV++DRMDK A+G++YV  V+KH+SQ D ++GFGGKYGV+ DR DK
Sbjct:    1 MWKSVVGHDVSVSVETQGDDWDTDPDFVND-ISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDILKKKELESGPKASHGYGGRFGVERDRMDKSAVGHEYVADVEKHSSQTDAARGFGGKYGVERDRADK 133          

HSP 2 Score: 75.0998 bits (183), Expect = 1.240e-15
Identity = 35/57 (61.40%), Postives = 46/57 (80.70%), Query Frame = -2
Query:  530 SKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAV 700
            S G+GG+FGV+ DR DKSAV  E+  +VEKHSSQTD ++GFGGK+GV++DR DK  +
Sbjct:   80 SHGYGGRFGVERDRMDKSAVGHEYVADVEKHSSQTDAARGFGGKYGVERDRADKITL 136          

HSP 3 Score: 74.3294 bits (181), Expect = 2.587e-15
Identity = 34/57 (59.65%), Postives = 46/57 (80.70%), Query Frame = -2
Query:  863 SKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAV 1033
            S G+GG++GV++DR DKSAVG E+ A++EKH+SQ D + GFGGKYGV+ DR DK  +
Sbjct:   80 SHGYGGRFGVERDRMDKSAVGHEYVADVEKHSSQTDAARGFGGKYGVERDRADKITL 136          

HSP 4 Score: 73.1738 bits (178), Expect = 6.119e-15
Identity = 42/87 (48.28%), Postives = 59/87 (67.82%), Query Frame = -2
Query:  641 NDRQDKSAVNWEH----KEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAV 889
            N  Q ++ V+ EH    K+E++   S    S G+GG++GV++DR DKSAVG E+   VEKHSSQ D ++GFGGK+GV+ DR DK  +
Sbjct:   53 NIHQLRNKVSEEHDILKKKELE---SGPKASHGYGGRFGVERDRMDKSAVGHEYVADVEKHSSQTDAARGFGGKYGVERDRADKITL 136          
BLAST of SMED30026845 vs. Ensembl Mouse
Match: Sh3d19 (SH3 domain protein D19 [Source:MGI Symbol;Acc:MGI:1350923])

HSP 1 Score: 68.9366 bits (167), Expect = 8.645e-12
Identity = 30/49 (61.22%), Postives = 35/49 (71.43%), Query Frame = -2
Query:  107 ALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQ 253
            AL+DF GE EDE++F AG+ I  +E ID  W  GEL GR GMFP NYVQ
Sbjct:  736 ALYDFLGENEDELSFKAGDVITELEPIDDAWMRGELMGRAGMFPKNYVQ 784          

HSP 2 Score: 58.5362 bits (140), Expect = 1.647e-8
Identity = 24/52 (46.15%), Postives = 37/52 (71.15%), Query Frame = -2
Query:  104 AVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 259
            AVAL DF  E+ D+++  +GE +  +EKIDA W+ G+   + G+FP+NYV+V
Sbjct:  499 AVALHDFPAEQADDLSLTSGEIVYLLEKIDAEWYRGKCRNQTGVFPANYVKV 550          
BLAST of SMED30026845 vs. UniProt/SwissProt
Match: sp|Q01406|SRC8_CHICK (Src substrate protein p85 OS=Gallus gallus OX=9031 GN=CTTN1 PE=1 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 1.182e-123
Identity = 204/362 (56.35%), Postives = 268/362 (74.03%), Query Frame = -2
Query:  419 IIIMWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEPEAQVEHVTRDVEQLEINEPN 1504
            ++ MWKATAG  + V  + +  DDW+ DPDF ND+SEKEQRWG+KTV GSG  +++++  L+E+V Q    IK+   +   K S GYGGKFGV++DRMDK A+G++Y   + KH SQ D  +GFGGK+GVQTDR D+SA G++YQ + +KH SQ+DYS GFGGKYGVQ DR DKSAVG++++ + EKH SQKDYS GFGGKYGV  D+ DKSAV +E++ + +KH SQ+DY KGFGGK+GVQ DRQDK A+GW+H+EKV+ H SQ+DY  GFGGKFGVQ +RQD SAV +++KE++ KH SQ D+SKGFGGK+GVQKDR DK+A  +  +E P +  Q+ +P   VE V      +  N  N
Sbjct:    8 VLQMWKATAGHSIAVS-QDDGADDWETDPDFVNDVSEKEQRWGAKTVKGSGHQEHINIHQLRENVFQEHQTIKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVKGFGGKFGVQTDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGVDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKVQLHESQKDYKSGFGGKFGVQTERQDPSAVGFDYKEKLAKHESQQDYSKGFGGKYGVQKDRMDKNAATFEDIEKPTSTYQKTKP---VERVANKTSSIRANLEN 365          

HSP 2 Score: 67.0106 bits (162), Expect = 2.211e-10
Identity = 27/55 (49.09%), Postives = 37/55 (67.27%), Query Frame = -2
Query:  104 GIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 268
            GI A+AL+D+    +DEI+F   + I NIE ID  WW G   GR G+FP+NYV++
Sbjct:  507 GITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVEL 561          
BLAST of SMED30026845 vs. UniProt/SwissProt
Match: sp|Q14247|SRC8_HUMAN (Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2)

HSP 1 Score: 363.614 bits (932), Expect = 1.086e-118
Identity = 197/359 (54.87%), Postives = 262/359 (72.98%), Query Frame = -2
Query:  419 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEPEAQVEHVTRDVEQLEINEPN 1495
            MWKA+AG  V +       DDW+ DPDF ND+SEKEQRWG+KTV GSG  +++++  L+E+V Q    +K+   +   K S GYGGKFGV++DRMDK A+G++Y   + KH SQ D  +GFGGK+GVQ DR D+SA G++YQ + +KH SQ+DYS GFGGKYGVQ DR DKSAVG++++ + EKH SQ+DYS GFGGKYG+  D+ DKSAV +E++ + +KH SQ+DY KGFGGK+GVQ DRQDK A+GW+H+EK++ H SQ+DY  GFGGKFGVQ++RQD +AV +++KE++ KH SQ D+SKGFGGK+GVQKDR DK+A  +  V    +  Q+  P   VE VT     +  N  N
Sbjct:    1 MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVP---VEAVTSKTSNIRANFEN 356          

HSP 2 Score: 68.5514 bits (166), Expect = 7.451e-11
Identity = 29/57 (50.88%), Postives = 38/57 (66.67%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI AVAL+D+    +DEI+F   + I NIE ID  WW G   GR G+FP+NYV++
Sbjct:  492 DLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVEL 548          
BLAST of SMED30026845 vs. UniProt/SwissProt
Match: sp|Q60598|SRC8_MOUSE (Src substrate cortactin OS=Mus musculus OX=10090 GN=Cttn PE=1 SV=2)

HSP 1 Score: 362.459 bits (929), Expect = 3.588e-118
Identity = 196/359 (54.60%), Postives = 261/359 (72.70%), Query Frame = -2
Query:  419 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEPEAQVEHVTRDVEQLEINEPN 1495
            MWKA+AG  V +       DDW+ DPDF ND+SEKEQRWG+KTV GSG  +++++  L+E+V Q    +K+   +   K S GYGGKFGV++DRMD+ A+G++Y   + KH SQ D  +GFGGK+GVQ DR D+SA G++YQ + +KH SQ+DYS GFGGKYGVQ DR DKSAVG++++ + EKH SQKDYS GFGGKYG+  D+ DKSAV +E++ + +KH SQ+DY KGFGGK+GVQ DRQDK A+GW+H+EK++ H SQ+DY  GFGGKFGVQ++RQD SAV +++KE + KH SQ D++KGFGGK+GVQKDR DK+A  +  V    +  Q+  P   +E VT     +  N  N
Sbjct:    1 MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDRSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSSAVGFDYKERLAKHESQQDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVP---IEAVTSKTSNIRANFEN 356          

HSP 2 Score: 67.781 bits (164), Expect = 1.167e-10
Identity = 28/57 (49.12%), Postives = 38/57 (66.67%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI A+AL+D+    +DEI+F   + I NIE ID  WW G   GR G+FP+NYV++
Sbjct:  488 DLGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVEL 544          
BLAST of SMED30026845 vs. UniProt/SwissProt
Match: sp|Q66HL2|SRC8_RAT (Src substrate cortactin OS=Rattus norvegicus OX=10116 GN=Cttn PE=1 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 1.391e-100
Identity = 167/288 (57.99%), Postives = 221/288 (76.74%), Query Frame = -2
Query:  632 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWE 1495
            MWKA+AG  V +       DDW+ DPDF ND+SEKEQRWG+KTV GSG  +++++  L+E+V Q    +K+   +   K S GYGGKFGV++DRMDK A+G++Y   + KH SQ D  +GFGGK+GVQ DR D+SA G++YQ + +KH SQ+DYS GFGGKYGVQ DR DKSAVG++++ + EKH SQKDYS GFGGKYG+  D+ DKSAV +E++ + +KH SQ+DY KGFGGK+GVQ DRQDK A+GW+H+EK++ H SQ+DY+KGFGGK+GVQ DR DK+A ++E
Sbjct:    1 MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYAKGFGGKYGVQKDRMDKNASTFE 288          

HSP 2 Score: 67.781 bits (164), Expect = 9.900e-11
Identity = 28/57 (49.12%), Postives = 38/57 (66.67%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D GI A+AL+D+    +DEI+F   + I NIE ID  WW G   GR G+FP+NYV++
Sbjct:  451 DLGITAIALYDYQAAGDDEISFDPDDVITNIEMIDDGWWRGVCKGRYGLFPANYVEL 507          
BLAST of SMED30026845 vs. UniProt/SwissProt
Match: sp|P49710|HCLS1_MOUSE (Hematopoietic lineage cell-specific protein OS=Mus musculus OX=10090 GN=Hcls1 PE=1 SV=2)

HSP 1 Score: 230.72 bits (587), Expect = 3.331e-68
Identity = 115/217 (53.00%), Postives = 160/217 (73.73%), Query Frame = -2
Query:  845 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKE 1495
            MWK+  G  V V ++T  DD         + ISEKEQRWG+KT+ GSG+T+++++  L+  V +    +KK   +   K S GYGG+FGV++DRMDK A+G++YV  V+KH+SQ D ++GFGGKYGV+ DR DKSA G+DY+ EV+KH SQ+DYS GFGG+YGV+KD++DK+A+G+++K E EKH SQ+DY+ GFGG+YG+Q DR DKSAV +   E
Sbjct:    1 MWKSVVGHDVSVSVETQGDDWDTDPDFVND-ISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDILKKKELESGPKASHGYGGRFGVERDRMDKSAVGHEYVADVEKHSSQTDAARGFGGKYGVERDRADKSAVGFDYKGEVEKHASQKDYSHGFGGRYGVEKDKRDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEME 216          

HSP 2 Score: 55.8398 bits (133), Expect = 6.676e-7
Identity = 21/49 (42.86%), Postives = 33/49 (67.35%), Query Frame = -2
Query:  104 LFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 250
            L+D+ GE  DE++F   + I +IE +D  WW G+  G  G+FP+NYV++
Sbjct:  437 LYDYQGEGSDELSFDPDDIITDIEMVDEGWWRGQCRGHFGLFPANYVKL 485          
BLAST of SMED30026845 vs. TrEMBL
Match: A0A267FDR7 (SH3 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008004g1 PE=4 SV=1)

HSP 1 Score: 430.639 bits (1106), Expect = 3.257e-143
Identity = 249/481 (51.77%), Postives = 327/481 (67.98%), Query Frame = -2
Query:  107 MWKATAGSKVKVEMKTNXXXXX-XXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEPEAQVEHVTRDVEQLEINEPNRNDDSNEHEQQHIPIVXXXXXXXXXXXXXXXXXXXXXXXXXKVVQ-----------------AVGDEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQ 1495
            +WKA AG  V +    N+DDD  + + DF+ND+SEKEQRWGSKTV GSG+   V++  L++ V   D+A KK   D   K S+GYGG+FGV+KDRMDK A+ N+Y      H SQ D ++GFGGKYGVQ+DRKDKSA GW+YQ + Q H+SQ D +KGFGGKYGVQ DR+DKSAVGW++K + E H SQ D + GFGGKYGVQ+DR+DKSAV W++KE+ + H SQ D +KGFGGKYGVQ DR+DKSAVGW+H+EK + H SQ D +KGFGGK+GVQ+DRQDKSAV W+H+E+++ H+SQTD SKGFGGK+GVQ DRQDKSAVGW   EAP    +E +P+ + E V +   + E+ +P    +  + + Q+ P V+ +E     EE     EE     EE  VQ                           AL+D+  E++DE++F AG+ I  ++KID  WW+G +  R+GMFP+NYVQ
Sbjct:    4 LWKAQAGYNVNMAAGDNNDDDDWETEADFENDVSEKEQRWGSKTVAGSGRQSDVNVAQLRDQVIHDDSAEKKRQLDSGPKASYGYGGQFGVEKDRMDKSAVTNEYQAQRQLHQSQTDAAKGFGGKYGVQSDRKDKSAVGWEYQEKRQLHESQTDAAKGFGGKYGVQSDRKDKSAVGWDYKEKRELHESQTDAAKGFGGKYGVQSDRRDKSAVGWDYKEKRELHESQTDAAKGFGGKYGVQSDRKDKSAVGWDHQEKSKLHESQTDAAKGFGGKYGVQSDRQDKSAVGWDHREQLQPHASQTDASKGFGGKYGVQSDRQDKSAVGW---EAPAKPQEEPQPQYEPE-VPQPQYEPEVPQPQYEPEVPQPQPQYEPEVQYEEPEVRYEEPEVRYEEPEVRYEEPEVQYGEPEPEPEPQYQQEEQQQAAPAGTCTALYDYTAEDDDELSFAAGDLINLVQKIDDGWWLGTIEDRQGMFPANYVQ 480          
BLAST of SMED30026845 vs. TrEMBL
Match: A0A267E6A1 (SH3 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028842g1 PE=4 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 1.273e-141
Identity = 252/481 (52.39%), Postives = 325/481 (67.57%), Query Frame = -2
Query:  107 MWKATAGSKVKVEMKTNXXXXX-XXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEPEAQVEHVTRDVEQLEINEPNRNDDSNEHEQQHIPIVXXXXXXXXXXXXXXXXXXXXXXXXXKVVQ-----------------AVGDEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQ 1495
            +WKA AG  V +    N+DDD  + + DF+ND+SEKEQRWGSKTV GSG+   V++  L++ V   D+A KK   D   K S+GYGG+FGV+KDRMDK A+ N+Y      H SQ D ++GFGGKYGVQ+DRKDKSA GW+YQ + Q H+SQ D +KGFGGKYGVQ DR+DKSAVGW++K + E H SQ D + GFGGKYGVQ+DR+DKSAV W++KE+ + H SQ D +KGFGGKYGVQ DR+DKSAVGW+H+EK + H SQ D +KGFGGK+GVQ+DRQDKSAV W+H+E+++ H+SQTD SKGFGGK+GVQ DRQDKSAVGW   EAP A  QE EP+ Q E         E+ +P    +  + + Q+ P V+ +E     EE     EE     EE  VQ                           AL+D+  E++DE++F AG+ I  ++KID  WW+G +  R+GMFP+NYVQ
Sbjct:    4 LWKAQAGYNVNMAAGDNNDDDDWETEADFENDVSEKEQRWGSKTVAGSGRQSDVNVAQLRDQVIHDDSAEKKRQLDSGPKASYGYGGQFGVEKDRMDKSAVTNEYQAQRQLHQSQTDAAKGFGGKYGVQSDRKDKSAVGWEYQEKRQLHESQTDAAKGFGGKYGVQSDRKDKSAVGWDYKEKRELHESQTDAAKGFGGKYGVQSDRRDKSAVGWDYKEKRELHESQTDSAKGFGGKYGVQSDRKDKSAVGWDHQEKSKLHESQTDAAKGFGGKYGVQSDRQDKSAVGWDHREQLQPHASQTDASKGFGGKYGVQSDRQDKSAVGW---EAP-AKPQE-EPQPQYE--------PEVPQPKYEPEVPQPQPQYEPEVQYEEPEVRYEEPEVRYEEPEVRYEEPEVQYGEPEPEPEPQYQQEEQQQAAPAGTCTALYDYTAEDDDELSFAAGDLINLVQKIDDGWWLGTIEDRQGMFPANYVQ 471          
BLAST of SMED30026845 vs. TrEMBL
Match: A0A267FX63 (SH3 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001183g1 PE=4 SV=1)

HSP 1 Score: 419.083 bits (1076), Expect = 1.373e-138
Identity = 254/501 (50.70%), Postives = 330/501 (65.87%), Query Frame = -2
Query:  107 MWKATAGSKVKVEM-KTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKD--------YSV-----------------------------GFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEPEAQVEHVTRDVEQLEINEPNRNDDSNEHEQQHIPIVXXXXXXXXXXXXXXXXXXXXXXXXXKVVQAVGDEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQ 1495
            +WKA AG  V +     NDDDDW+ + DF+ND+SEKEQRWGSKTV GSG+   V++  L++ V   D+A KK   D   K S+GYGG+FGV+KDRMDK A+ N+Y      H SQ D ++GFGGKYGVQ+DRKDKSA GWDY+ + + H+SQ D +KGFGGKYGVQ DR+DKSAVGW++K + E H SQ D        Y V                             GFGGKYGVQ+DRQDKSAV W+H+E+ + H SQ D +KGFGGKYGVQ DRQDKSAVGW+H+EK + H SQ D +KGFGGK+GVQ+DRQDKSAV W+H+E+++ H+SQTD SKGFGGK+GVQ DRQDKSAVGW   EAP A  QE EP+ Q E         E+ +P    +  + + Q+ P V+ +E     EE   + E ++  +E++     G       AL+D+  E++DE++F AG+ I  ++KID  WW+G +  R+GMFP+NYVQ
Sbjct:    4 LWKAQAGYNVNMATGDNNDDDDWETEADFENDVSEKEQRWGSKTVAGSGRQSDVNVAQLRDQVIHDDSAEKKRQLDSGPKASYGYGGQFGVEKDRMDKSAVTNEYQAQRQLHQSQTDAAKGFGGKYGVQSDRKDKSAVGWDYKEKRELHESQTDAAKGFGGKYGVQSDRRDKSAVGWDYKEKRELHESQTDAAKGFGGKYGVQSDRKDKSAVGWDHQEKSKLHESQTDAAKGFGGKYGVQSDRQDKSAVGWDHQEKSKLHESQTDAAKGFGGKYGVQSDRQDKSAVGWDHQEKSKLHESQTDAAKGFGGKYGVQSDRQDKSAVGWDHREQLQPHASQTDASKGFGGKYGVQSDRQDKSAVGW---EAP-AKPQE-EPQPQYE--------PEVPQPQYEPEVPQPQPQYEPEVQYEEPEVRYEEPEPEPEPQYQQEEQQQAAPAG----TCTALYDYTAEDDDELSFAAGDLINLVQKIDDGWWLGTIEDRQGMFPANYVQ 487          
BLAST of SMED30026845 vs. TrEMBL
Match: A0A3P8RJU8 (Cortactin OS=Amphiprion percula OX=161767 PE=4 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 2.401e-131
Identity = 211/452 (46.68%), Postives = 299/452 (66.15%), Query Frame = -2
Query:  104 ISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEP-----------EAQVEHVTRDVEQLE---INEPNRNDDSNEHEQQHIPIVXXXXXXXXXXXXXXXXXXXXXXXXXKVVQAVG-----DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 1402
            +SEKEQRWG+KTV GSG  +++D+  L+E+V     ++K+   +   K S GYGGKFGVQ+DRMDK A+G+DY   + KH SQ D S+GFGGK+GVQ DR D+SA G++Y  + +KH SQ+DY+ GFGG+YGVQ DR D+SAVG++++ + EKH SQKDY+ GFGGK+GV+ D+ DKSAV +E++ + ++H SQ+DY KGFGGK+GVQ DRQDKSA+GW+H+EK++ H SQ+DY +GFGG++GV+ ++QD+ A+ +EHKE + KH SQ D+SKGFGGKFGVQ DR DKSA  ++ VE P ++ Q+ +P           +A+ E++ +  E+ +     E      + E ++Q     + +E                      V  A       D G+ AVAL+D+    +DEI+F   + I NIE ID  WW G   G  G+FP+NYV+V
Sbjct:   31 LSEKEQRWGAKTVAGSGHQEHIDIHRLRETVSTEHTSLKQKELETMPKASHGYGGKFGVQQDRMDKSAVGHDYQSKLSKHCSQTDTSKGFGGKFGVQADRVDQSAVGFEYAGKTEKHASQKDYATGFGGRYGVQADRVDQSAVGFDYQGKTEKHESQKDYAKGFGGKFGVETDKVDKSAVGFEYQGKTERHESQKDYVKGFGGKFGVQTDRQDKSALGWDHQEKLQLHESQKDYKRGFGGQYGVEVEKQDQCALGYEHKERLAKHESQKDYSKGFGGKFGVQNDRMDKSAGTFDDVEKPTSSYQKTKPVEAAGSSTGSIKARFENIAKQKEEEDRKRAEEERARRQAKERQEQEEARRKIEETPKAPSPAPAASPSPTPSPTPPVQPATQYEYGEDLGVTAVALYDYQAAGDDEISFDPDDIITNIEMIDEGWWRGVCRGAYGLFPANYVEV 482          
BLAST of SMED30026845 vs. TrEMBL
Match: A0A1U7SIY1 (src substrate cortactin-like isoform X2 OS=Alligator sinensis OX=38654 GN=LOC102378837 PE=4 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 7.467e-131
Identity = 195/339 (57.52%), Postives = 268/339 (79.06%), Query Frame = -2
Query:  479 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEP 1495
            MWK+  G  V V+++   DD         + ISEKEQRWG+KT+ GSG+T+++++  L+  V Q    +KK   D   K S+GYGGKFG ++DRMDK ALG++YV  ++KH+SQ D ++GFGGKYGVQ DR DKSA G++Y+ EV+KH SQ+DY+KGFGG+YGV+KD+ DK+AVG+++KA+ EKH SQKDY+VGFGGK+GVQ DRQDK A+ WEH+EE++ H SQ DYSKGFGG+YGV++D+ DK+AVG++++ + EKH SQ+DY+ GFGGKFGVQ DRQDK A+ WEH+EE+++H SQTD++KGFGG++GVQKDR DKSA G+  +EAP ++ ++ +P
Sbjct:    1 MWKSVVGHDVSVKVEAQGDDWDTDPDFVND-ISEKEQRWGAKTIEGSGRTEHINIHQLRSKVSQEHEVLKKKELDTGPKASYGYGGKFGTERDRMDKSALGHEYVAELEKHSSQTDAAKGFGGKYGVQRDRADKSALGFEYKGEVEKHSSQKDYAKGFGGRYGVEKDKVDKAAVGFDYKAQAEKHESQKDYAVGFGGKFGVQKDRQDKCALGWEHQEELKLHESQTDYSKGFGGRYGVEKDKVDKAAVGFDYKAQAEKHESQKDYAVGFGGKFGVQKDRQDKCALGWEHQEELKQHESQTDYAKGFGGRYGVQKDRVDKSAAGFGEMEAPTSSYEKTKP 338          

HSP 2 Score: 67.781 bits (164), Expect = 4.112e-8
Identity = 27/57 (47.37%), Postives = 41/57 (71.93%), Query Frame = -2
Query:   98 GIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQVDE 268
            GI A+AL+D+ GE +DEI+F   + I +IE +D  WW G+  G+ G+FP+NYV++ E
Sbjct:  550 GICAIALYDYQGEGDDEISFDPNDTITHIEMVDEGWWRGQSRGKVGLFPANYVKLLE 606          
BLAST of SMED30026845 vs. Ensembl Cavefish
Match: hcls1 (src substrate cortactin-like [Source:NCBI gene;Acc:103037311])

HSP 1 Score: 308.145 bits (788), Expect = 3.501e-98
Identity = 162/291 (55.67%), Postives = 228/291 (78.35%), Query Frame = -2
Query:  623 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKE 1495
            MWK+  G  V V++  ++ DDW+ DPDF+ND+SE+EQRWGSKT+ GSG+ +++ +  L++ V      +KK   D   K S+GYGGKFGV+KDRMDK A+G+ YV  VD+H+SQ D ++GFGGK+GVQ DR DKSA  ++Y+ EV +H SQ+DY+KGFGGKYGVQK+R DK+A+G+++K E EKH SQKDYS GFGGK+GV+ ++ DK+A  +++K E +KH SQ+DYSKGFGGK+GV++++ DK+A+G++++ + EKH SQ+DY+KGFGG++GVQ DR DKSA S+   E
Sbjct:    1 MWKSVVGHDVNVKV-ASEGDDWETDPDFENDVSEQEQRWGSKTIEGSGRKEHISVADLRQKVSHEHEVVKKKELDSGPKASYGYGGKFGVEKDRMDKGAVGHSYVAQVDQHSSQTDAAKGFGGKFGVQKDRVDKSAMNYEYKGEVDQHASQKDYAKGFGGKYGVQKERVDKAALGYDYKGETEKHQSQKDYSKGFGGKFGVEKEKVDKAAHGYDYKGETEKHQSQKDYSKGFGGKFGVEKEKVDKAALGYDYKGETEKHESQKDYAKGFGGRYGVQEDRMDKSAASFSEME 290          

HSP 2 Score: 63.1586 bits (152), Expect = 3.152e-10
Identity = 24/55 (43.64%), Postives = 39/55 (70.91%), Query Frame = -2
Query:  104 GIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 268
            G  A A++D++G  +DEI+F+  + I NIE +D  WW G  +GR G+FPS++V++
Sbjct:  483 GQAARAIYDYEGGADDEISFMPDDIITNIEMVDEGWWKGTCHGRTGLFPSSFVEL 537          
BLAST of SMED30026845 vs. Ensembl Cavefish
Match: hcls1 (src substrate cortactin-like [Source:NCBI gene;Acc:103037311])

HSP 1 Score: 267.7 bits (683), Expect = 3.711e-83
Identity = 142/254 (55.91%), Postives = 196/254 (77.17%), Query Frame = -2
Query:  734 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHRE 1495
            MWK+  G  V V++  ++ DDW+ DPDF+ND+SE+EQRWGSKT+ GSG+ +++ +  L++ V      +KK   D   K S+GYGGKFGV+KDRMDK A+G+ YV  VD+H+SQ D ++GFGGK+GVQ DR DKSA  ++Y+ EV +H SQ+DY+KGFGGKYGVQK+R DK+A+G+++K E EKH SQKDYS GFGGK+GV+ ++ DK+A+ +++K E +KH SQ+DY+KGFGG+YGVQ+DR DKSA  +   E
Sbjct:    1 MWKSVVGHDVNVKV-ASEGDDWETDPDFENDVSEQEQRWGSKTIEGSGRKEHISVADLRQKVSHEHEVVKKKELDSGPKASYGYGGKFGVEKDRMDKGAVGHSYVAQVDQHSSQTDAAKGFGGKFGVQKDRVDKSAMNYEYKGEVDQHASQKDYAKGFGGKYGVQKERVDKAALGYDYKGETEKHQSQKDYSKGFGGKFGVEKEKVDKAALGYDYKGETEKHESQKDYAKGFGGRYGVQEDRMDKSAASFSEME 253          

HSP 2 Score: 219.935 bits (559), Expect = 7.392e-65
Identity = 104/185 (56.22%), Postives = 153/185 (82.70%), Query Frame = -2
Query:  479 SKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEP 1033
            S G+GGK+GV+KDR DK AVG  + A++++H+SQ D + GFGGK+GVQ DR DKSA+N+E+K E+ +HASQ+DY+KGFGGKYGVQ++R DK+A+G++++ + EKH SQ+DYSKGFGGKFGV+ ++ DK+A+ +++K E EKH SQ D++KGFGG++GVQ+DR DKSA  ++ +E+P ++ ++  P
Sbjct:   80 SYGYGGKFGVEKDRMDKGAVGHSYVAQVDQHSSQTDAAKGFGGKFGVQKDRVDKSAMNYEYKGEVDQHASQKDYAKGFGGKYGVQKERVDKAALGYDYKGETEKHQSQKDYSKGFGGKFGVEKEKVDKAALGYDYKGETEKHESQKDYAKGFGGRYGVQEDRMDKSAASFSEMESPTSSYEKTLP 264          

HSP 3 Score: 63.1586 bits (152), Expect = 3.722e-10
Identity = 24/55 (43.64%), Postives = 39/55 (70.91%), Query Frame = -2
Query:  104 GIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 268
            G  A A++D++G  +DEI+F+  + I NIE +D  WW G  +GR G+FPS++V++
Sbjct:  446 GQAARAIYDYEGGADDEISFMPDDIITNIEMVDEGWWKGTCHGRTGLFPSSFVEL 500          
BLAST of SMED30026845 vs. Ensembl Cavefish
Match: hcls1 (src substrate cortactin-like [Source:NCBI gene;Acc:103037311])

HSP 1 Score: 265.388 bits (677), Expect = 2.916e-82
Identity = 142/254 (55.91%), Postives = 195/254 (76.77%), Query Frame = -2
Query:  734 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHRE 1495
            MWK+  G  V V++  ++ DDW+ DPDF+ND+SE+EQRWGSKT+ GSG+ +++ +  L++ V      +KK   D   K S+GYGGKFGV+KDRMDK A+G+ YV  VD+H+SQ D ++GFGGK+GVQ DR DKSA  ++Y+ EV +H SQ+DY+KGFGGKYGVQK+R DK+A+G+++K E EKH SQKDYS GFGGK+GV+ ++ DK+A  +++K E +KH SQ+DY+KGFGG+YGVQ+DR DKSA  +   E
Sbjct:    1 MWKSVVGHDVNVKV-ASEGDDWETDPDFENDVSEQEQRWGSKTIEGSGRKEHISVADLRQKVSHEHEVVKKKELDSGPKASYGYGGKFGVEKDRMDKGAVGHSYVAQVDQHSSQTDAAKGFGGKFGVQKDRVDKSAMNYEYKGEVDQHASQKDYAKGFGGKYGVQKERVDKAALGYDYKGETEKHQSQKDYSKGFGGKFGVEKEKVDKAAHGYDYKGETEKHQSQKDYAKGFGGRYGVQEDRMDKSAASFSEME 253          

HSP 2 Score: 217.238 bits (552), Expect = 5.850e-64
Identity = 104/185 (56.22%), Postives = 152/185 (82.16%), Query Frame = -2
Query:  479 SKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEP 1033
            S G+GGK+GV+KDR DK AVG  + A++++H+SQ D + GFGGK+GVQ DR DKSA+N+E+K E+ +HASQ+DY+KGFGGKYGVQ++R DK+A+G++++ + EKH SQ+DYSKGFGGKFGV+ ++ DK+A  +++K E EKH SQ D++KGFGG++GVQ+DR DKSA  ++ +E+P ++ ++  P
Sbjct:   80 SYGYGGKFGVEKDRMDKGAVGHSYVAQVDQHSSQTDAAKGFGGKFGVQKDRVDKSAMNYEYKGEVDQHASQKDYAKGFGGKYGVQKERVDKAALGYDYKGETEKHQSQKDYSKGFGGKFGVEKEKVDKAAHGYDYKGETEKHQSQKDYAKGFGGRYGVQEDRMDKSAASFSEMESPTSSYEKTLP 264          

HSP 3 Score: 63.1586 bits (152), Expect = 3.235e-10
Identity = 24/55 (43.64%), Postives = 39/55 (70.91%), Query Frame = -2
Query:  104 GIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 268
            G  A A++D++G  +DEI+F+  + I NIE +D  WW G  +GR G+FPS++V++
Sbjct:  446 GQAARAIYDYEGGADDEISFMPDDIITNIEMVDEGWWKGTCHGRTGLFPSSFVEL 500          
BLAST of SMED30026845 vs. Ensembl Cavefish
Match: ENSAMXT00000050977.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000316.1:172048:186345:1 gene:ENSAMXG00000037856.1 transcript:ENSAMXT00000050977.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.865 bits (307), Expect = 4.397e-32
Identity = 76/141 (53.90%), Postives = 99/141 (70.21%), Query Frame = -2
Query: 1073 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDY 1495
            MWKATAG  V V +  +  DDW+ DPDF+NDI+EKEQRWG+KTV GSG  +++++  L+E V    + +K+   D   K S GYGGKFGVQ+DRMDK A+G++Y   + KH SQ D S+GFGGK+GVQTDR D+   G  Y
Sbjct:    1 MWKATAGRSVSVTVD-DGGDDWETDPDFENDITEKEQRWGAKTVEGSGHQEHINIHKLREKVSTEHSELKQKELDGMPKASHGYGGKFGVQQDRMDKSAVGHEYQSKLSKHCSQTDTSKGFGGKFGVQTDRVDQPNTGLLY 140          

HSP 2 Score: 80.8777 bits (198), Expect = 3.684e-17
Identity = 45/81 (55.56%), Postives = 54/81 (66.67%), Query Frame = -2
Query:  650 NDRQDKSAVNWEHKEEMQKHA-SQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDK 889
            N  + +  V+ EH E  QK        S G+GGK+GVQQDR DKSAVG E++ K+ KH SQ D SKGFGGKFGVQ DR D+
Sbjct:   53 NIHKLREKVSTEHSELKQKELDGMPKASHGYGGKFGVQQDRMDKSAVGHEYQSKLSKHCSQTDTSKGFGGKFGVQTDRVDQ 133          

HSP 3 Score: 78.1814 bits (191), Expect = 3.301e-16
Identity = 42/88 (47.73%), Postives = 51/88 (57.95%), Query Frame = -2
Query:  437 SKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEPEAQVEHVTRDVEQL 700
            S G+GGKFGVQ DR DKSAV  E++ ++ KH SQTD SKGFGGKFGVQ DR D+   G       K N       +  + V  +   L
Sbjct:   80 SHGYGGKFGVQQDRMDKSAVGHEYQSKLSKHCSQTDTSKGFGGKFGVQTDRVDQPNTGLLYYYISKFNTHTYSFASLFQSVVFNRHTL 167          

HSP 4 Score: 74.3294 bits (181), Expect = 6.956e-15
Identity = 35/54 (64.81%), Postives = 44/54 (81.48%), Query Frame = -2
Query:  872 SKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDK 1033
            S G+GGK+GVQ+DR DKSAVG E++++L KH SQ D S GFGGK+GVQ DR D+
Sbjct:   80 SHGYGGKFGVQQDRMDKSAVGHEYQSKLSKHCSQTDTSKGFGGKFGVQTDRVDQ 133          

HSP 5 Score: 72.7886 bits (177), Expect = 2.227e-14
Identity = 35/58 (60.34%), Postives = 43/58 (74.14%), Query Frame = -2
Query:  749 SVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVG 922
            S G+GGK+GVQ DR DKSAV  E++ ++ KH SQ D SKGFGGK+GVQ DR D+   G
Sbjct:   80 SHGYGGKFGVQQDRMDKSAVGHEYQSKLSKHCSQTDTSKGFGGKFGVQTDRVDQPNTG 137          
BLAST of SMED30026845 vs. Ensembl Cavefish
Match: grap2b (GRB2 related adaptor protein 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1485])

HSP 1 Score: 67.781 bits (164), Expect = 1.694e-12
Identity = 26/48 (54.17%), Postives = 39/48 (81.25%), Query Frame = -2
Query:  110 ALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYV 253
            ALFDF  EE+DE++F AG+ I  ++++D+ WW+G+L GRRG+FP+NY 
Sbjct:  182 ALFDFRAEEKDELDFNAGDIIEVVDRVDSYWWMGQLRGRRGLFPANYT 229          
BLAST of SMED30026845 vs. Ensembl Sea Lamprey
Match: cttn (cortactin [Source:ZFIN;Acc:ZDB-GENE-040715-3])

HSP 1 Score: 196.823 bits (499), Expect = 2.004e-56
Identity = 129/327 (39.45%), Postives = 178/327 (54.43%), Query Frame = -2
Query:  623 MWKATAGSKVKV-EMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEH-----------------------------------KAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKE 1495
            MWK+  G KV   +++    DDW+ DPDF+ND++EKEQRWG+KTV GSG+  ++ L  L+E+V +   AIK        K S GYGGKFGV++DRMDK A+ + Y+    KHASQ D ++GFGGK+GVQTDR DKSA  +DY++    H SQ+      G +  +       +A    +                                     +L  H SQ+ +S  F     +   RQ  +A+ W     +  H    D + GFGGK+GVQ+DR D +A+GW+H+E    H SQ D++KGFGGKFGVQ DR D SA S++  E
Sbjct:    1 MWKSATGHKVSAAKVEETGADDWETDPDFENDVTEKEQRWGAKTVEGSGRQGHISLDKLRENVSKDHQAIKVSEQKAGPKASHGYGGKFGVERDRMDKSAVDHTYMAETTKHASQTDAAKGFGGKFGVQTDRIDKSAERFDYKAAAAAHSSQKAVFVTIGARLPLPLLPHSVAACELYYCTSIASPICLHSLARSSMSFAQLMHISESSSHPSSILKLACHRSQR-FSYSFHPVRCLAV-RQTLNALGWCVMCTVCCHVPHTDCAHGFGGKFGVQRDRMDTAALGWDHKEAASTHESQTDHAKGFGGKFGVQTDRVDTSAASFQDME 325          

HSP 2 Score: 80.8777 bits (198), Expect = 1.651e-16
Identity = 40/71 (56.34%), Postives = 51/71 (71.83%), Query Frame = -2
Query:  599 SKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQ 811
            S G+GGK+GV++DR DKSAV   +  +  KH+SQ D +KGFGGKFGVQ DR DKSA  +++K     HSSQ
Sbjct:   82 SHGYGGKFGVERDRMDKSAVDHTYMAETTKHASQTDAAKGFGGKFGVQTDRIDKSAERFDYKAAAAAHSSQ 152          

HSP 3 Score: 77.7962 bits (190), Expect = 1.817e-15
Identity = 40/67 (59.70%), Postives = 47/67 (70.15%), Query Frame = -2
Query:  533 KVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSA 733
            KV +  +    S G+GGKFGV+ DR DKSAV   +  E  KH+SQTD +KGFGGKFGVQ DR DKSA
Sbjct:   71 KVSEQKAGPKASHGYGGKFGVERDRMDKSAVDHTYMAETTKHASQTDAAKGFGGKFGVQTDRIDKSA 137          

HSP 4 Score: 62.3882 bits (150), Expect = 1.182e-10
Identity = 26/55 (47.27%), Postives = 38/55 (69.09%), Query Frame = -2
Query:  104 GIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 268
            G  AVA++D+    +DEI+F   + I NIE +D  WW GE NG+ G+FP+NYV++
Sbjct:  504 GATAVAIYDYQKAGDDEISFEPDDIITNIECLDEGWWRGECNGQVGIFPANYVEL 558          
BLAST of SMED30026845 vs. Ensembl Sea Lamprey
Match: DBNL (drebrin like [Source:HGNC Symbol;Acc:HGNC:2696])

HSP 1 Score: 60.077 bits (144), Expect = 4.505e-10
Identity = 28/58 (48.28%), Postives = 39/58 (67.24%), Query Frame = -2
Query:   98 GIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGE-LNGRRGMFPSNYVQVDE 268
            G  A AL+D+   ++ EI+F  G+ I NIE+ID  WW G   +G RGMFP+NYV++ E
Sbjct:  299 GQCARALYDYQAADDTEISFDPGDLISNIEQIDDGWWNGSGPDGSRGMFPANYVELVE 356          
BLAST of SMED30026845 vs. Ensembl Sea Lamprey
Match: grb2a (growth factor receptor-bound protein 2a [Source:ZFIN;Acc:ZDB-GENE-041121-1])

HSP 1 Score: 53.9138 bits (128), Expect = 1.672e-8
Identity = 23/50 (46.00%), Postives = 32/50 (64.00%), Query Frame = -2
Query:  104 ALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 253
            ALFDF+ +E+ E+ F  G+ I  ++  D  WW G  +GR GMFP NYV +
Sbjct:  164 ALFDFEPQEDGELGFRRGDFITVVDSSDPNWWKGSCHGRAGMFPRNYVTL 213          

HSP 2 Score: 46.9802 bits (110), Expect = 3.714e-6
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = -2
Query:  104 AVALFDFDGEEEDEINFVAGE--KIVNIEKIDACWWVGELNGRRGMFPSNYVQV 259
            AVA +DF+   EDE++F  G+  K++N E  D  W+  ELNGR G  P NY+ +
Sbjct:    3 AVAKYDFNATAEDELSFKRGDVLKVLN-EDCDQNWYKAELNGRDGFIPKNYIDM 55          
BLAST of SMED30026845 vs. Ensembl Sea Lamprey
Match: stam (signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 [Source:ZFIN;Acc:ZDB-GENE-031118-123])

HSP 1 Score: 55.0694 bits (131), Expect = 1.756e-8
Identity = 23/51 (45.10%), Postives = 33/51 (64.71%), Query Frame = -2
Query:  101 ALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQVD 253
            AL+DF+  E++E+ F AGE +  ++  DA WW GE     G+FPSN+V  D
Sbjct:  217 ALYDFEAAEDNELTFRAGEILTVLDDSDANWWKGETESGLGLFPSNFVTAD 267          
BLAST of SMED30026845 vs. Ensembl Sea Lamprey
Match: ABI1 (abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:11320])

HSP 1 Score: 53.1434 bits (126), Expect = 9.189e-8
Identity = 22/50 (44.00%), Postives = 36/50 (72.00%), Query Frame = -2
Query:  107 VALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQ 256
            VA++D++ ++EDE++F  G  I  I+K D  W+ G +NG+ G+FP NYV+
Sbjct:  398 VAVYDYNKDKEDELSFQEGSIIYVIKKNDDGWYEGTMNGQTGLFPGNYVE 447          
BLAST of SMED30026845 vs. Ensembl Yeast
Match: ABP1 (Actin-binding protein of the cortical actin cytoskeleton; important for activation of the Arp2/3 complex that plays a key role actin in cytoskeleton organization; inhibits barbed-end actin filament elongation; phosphorylation within its Proline-Rich Regio, mediated by Cdc28p and Pho85p, protects Abp1p from proteolysis mediated by its own PEST sequences; mammalian homolog of HIP-55 (hematopoietic progenitor kinase 1 [HPK1]-interacting protein of 55 kDa) [Source:SGD;Acc:S000000684])

HSP 1 Score: 66.2402 bits (160), Expect = 4.907e-12
Identity = 27/54 (50.00%), Postives = 40/54 (74.07%), Query Frame = -2
Query:  104 AVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGEL--NGRRGMFPSNYVQV 259
            A A +D+D  E++E+ FV  +KI+NIE +D  WW+GEL  +G +G+FPSNYV +
Sbjct:  537 ATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSL 590          
BLAST of SMED30026845 vs. Ensembl Yeast
Match: LSB3 (Protein containing a C-terminal SH3 domain; binds Las17p, which is a homolog of human Wiskott-Aldrich Syndrome protein involved in actin patch assembly and actin polymerization; protein abundance increases in response to DNA replication stress; LSB3 has a paralog, YSC84, that arose from the whole genome duplication [Source:SGD;Acc:S000002968])

HSP 1 Score: 57.7658 bits (138), Expect = 1.901e-9
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = -2
Query:  104 AVALFDFDGEEEDEINFVAGEKIVNIEKIDAC--WWVGELNGRRGMFPSNYVQV 259
            AVAL+ F GEE  ++ F  G+ I  ++K D+   WW G +NGR G+FP+NYV++
Sbjct:  405 AVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVEL 458          
BLAST of SMED30026845 vs. Ensembl Yeast
Match: YSC84 (Actin-binding protein; involved in bundling of actin filaments and endocytosis of actin cortical patches; activity stimulated by Las17p; contains SH3 domain similar to Rvs167p; YSC84 has a paralog, LSB3, that arose from the whole genome duplication [Source:SGD;Acc:S000001058])

HSP 1 Score: 55.4546 bits (132), Expect = 1.131e-8
Identity = 24/55 (43.64%), Postives = 37/55 (67.27%), Query Frame = -2
Query:  104 VAVALFDFDGEEEDEINFVAGEKIVNIEKIDAC--WWVGELNGRRGMFPSNYVQV 262
             AVAL++F GE+  ++ F  G+ I  ++K D+   WW G  NG+ G+FP+NYV+V
Sbjct:  413 TAVALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVRV 467          
BLAST of SMED30026845 vs. Ensembl Yeast
Match: PIN3 (Negative regulator of actin nucleation-promoting factor activity; interacts with Las17p, a homolog of human Wiskott-Aldrich Syndrome protein (WASP), via an N-terminal SH3 domain, and along with LSB1 cooperatively inhibits the nucleation of actin filaments; short-lived protein whose levels increase in response to thermal stress; induces the formation of the [PIN+] and [RNQ+] prions when overproduced; PIN3 has a paralog, LSB1, that arose from the whole genome duplication [Source:SGD;Acc:S000006358])

HSP 1 Score: 50.8322 bits (120), Expect = 9.131e-8
Identity = 19/49 (38.78%), Postives = 33/49 (67.35%), Query Frame = -2
Query:  107 ALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQ 253
            AL+ FD +++ ++    G+K+  +EK+   W+ G  NGR G+FP+NYV+
Sbjct:   61 ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVK 109          
BLAST of SMED30026845 vs. Ensembl Yeast
Match: HSE1 (Subunit of the endosomal Vps27p-Hse1p complex; complex is required for sorting of ubiquitinated membrane proteins into intralumenal vesicles prior to vacuolar degradation, as well as for recycling of Golgi proteins and formation of lumenal membranes [Source:SGD;Acc:S000000994])

HSP 1 Score: 51.6026 bits (122), Expect = 2.002e-7
Identity = 21/48 (43.75%), Postives = 29/48 (60.42%), Query Frame = -2
Query:  110 ALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYV 253
            AL+D    E DE++F  G+ I  +E++   WW G L G  G+FP NYV
Sbjct:  224 ALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYV 271          
BLAST of SMED30026845 vs. Ensembl Nematostella
Match: EDO50032 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF47])

HSP 1 Score: 361.688 bits (927), Expect = 1.878e-119
Identity = 185/308 (60.06%), Postives = 239/308 (77.60%), Query Frame = -2
Query:  479 ISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEP 1402
            +SE+EQRWG+KTV GSG  + +++K L++ V+     +KK   +   K S+GYGGKFGVQKDRMDK  +G DY G VDKHASQ+DYS+GFGGKYGVQ DR DK+A G+ Y+ + + HQS +D+SKGFGGKYGVQKDR DKSAVG+E++ + E H SQKDYS GFGGK+GVQ DR DKSAV ++++ + + H SQ+DYSKGFGGKYGVQ+DR DKSAVG+++  K E H SQ+DYSKGFGGKFGVQ+D  DK+AV ++++ +V +H SQ D+SKGFGGK+GVQKD  DKSA G+  +E    + Q  +P
Sbjct:   29 VSEQEQRWGAKTVEGSGHQESLNIKQLRKEVESDHQKVKKEEMESGPKASYGYGGKFGVQKDRMDKNVVGFDYEGKVDKHASQQDYSKGFGGKYGVQKDRVDKAAVGYQYEGKTEAHQSTKDFSKGFGGKYGVQKDRVDKSAVGFEYQGKTEAHESQKDYSKGFGGKFGVQKDRVDKSAVGYDYEGKTEAHDSQKDYSKGFGGKYGVQKDRVDKSAVGFDYEGKTEAHDSQKDYSKGFGGKFGVQSDHMDKAAVGYDYEGKVGEHESQKDYSKGFGGKYGVQKDHMDKSAKGYEDMEEASGSYQPAKP 336          

HSP 2 Score: 74.3294 bits (181), Expect = 3.551e-14
Identity = 31/60 (51.67%), Postives = 42/60 (70.00%), Query Frame = -2
Query:  107 QAVGDEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQ 286
            +A G  G+ AVAL+D+    EDEI F   + I +IEKID  WW+G  NG+RG+FP+NYV+
Sbjct:  472 EASGATGVSAVALYDYQAAGEDEITFDPDDIITDIEKIDDGWWMGTCNGQRGLFPANYVE 531          
BLAST of SMED30026845 vs. Ensembl Nematostella
Match: EDO31290 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYD1])

HSP 1 Score: 60.077 bits (144), Expect = 3.603e-10
Identity = 27/58 (46.55%), Postives = 39/58 (67.24%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGE-LNGRRGMFPSNYVQV 274
            D G+ A AL+D+   +++EI F   + I NIE+ID  WW G   +GR GMFP+NYV++
Sbjct:  186 DTGVTATALYDYQQADDNEITFDPDDIITNIEQIDEGWWRGTGPDGRHGMFPANYVEI 243          
BLAST of SMED30026845 vs. Ensembl Nematostella
Match: EDO49750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFM9])

HSP 1 Score: 53.5286 bits (127), Expect = 6.188e-9
Identity = 23/52 (44.23%), Postives = 34/52 (65.38%), Query Frame = -2
Query:  104 AVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 259
             +AL+ F GE EDE+   AG+ I  +E ++  W  G LNG  G+FPS+YV++
Sbjct:    3 VIALYSFTGESEDELTMWAGDTIQLLEIVNDDWLKGSLNGNTGIFPSSYVEL 54          
BLAST of SMED30026845 vs. Ensembl Nematostella
Match: EDO38710 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC74])

HSP 1 Score: 55.0694 bits (131), Expect = 1.031e-8
Identity = 22/52 (42.31%), Postives = 37/52 (71.15%), Query Frame = -2
Query:  104 AVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 259
            A  LFD++ E  DE++ V G +I  I +++  WW G ++GR+G+FPSN+V++
Sbjct:   82 ACVLFDYEAENADELSLVTGIEINVIREVEDGWWEGTVDGRKGVFPSNFVKL 133          
BLAST of SMED30026845 vs. Ensembl Nematostella
Match: EDO29744 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2S0])

HSP 1 Score: 55.0694 bits (131), Expect = 2.497e-8
Identity = 24/50 (48.00%), Postives = 33/50 (66.00%), Query Frame = -2
Query:  107 VALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQ 256
            +A+F +  ++ DE+ F  G  + N+   D  WW GELNG+ GMFPSNYVQ
Sbjct:  156 LAMFPYTAQKGDELTFYKGS-VFNVMSKDGEWWKGELNGQVGMFPSNYVQ 204          
BLAST of SMED30026845 vs. Ensembl Medaka
Match: cttn (cortactin [Source:NCBI gene;Acc:101157843])

HSP 1 Score: 316.235 bits (809), Expect = 8.119e-102
Identity = 174/316 (55.06%), Postives = 234/316 (74.05%), Query Frame = -2
Query:  548 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDR 1495
            MW++  G  VKV +  +  DDW+ DPDF+ND+SEKEQRWG+KTV GSG  +++D+  L+E+V     ++K+   +   K S GYGGKFGVQ+DRMDK A+G+DY   + KH SQ D S+GFGGK+GVQ DR D+SA G++Y  + +KH SQ+DYS GFGG+YGVQ DR D+SAVG+++  + EKH SQKDY+ GFGGK+GV++D+ DKSA+ +E++ + +KH SQ+DY KGFGGK+GVQ DRQDKSA+GW+H+EK++ H SQ+DYSKGFGGKFGVQ DR DKSA ++E  E+      +T   +  G   G  K R
Sbjct:    1 MWRSAVGQNVKVNVD-DGGDDWETDPDFENDVSEKEQRWGAKTVAGSGHQEHIDIHHLREAVSTEHTSLKQKELETMPKASHGYGGKFGVQQDRMDKSAVGHDYQSQLSKHCSQTDTSKGFGGKFGVQADRVDQSAMGFEYAGKTEKHASQKDYSTGFGGRYGVQADRVDRSAVGFDYHGKTEKHESQKDYAKGFGGKFGVESDKVDKSAMGFEYQGKTEKHESQKDYVKGFGGKFGVQSDRQDKSALGWDHQEKLQLHESQKDYSKGFGGKFGVQNDRMDKSAGTFEDVEKPAPTYQKTKPVEAAGSSTGSIKAR 315          

HSP 2 Score: 65.4698 bits (158), Expect = 6.346e-11
Identity = 28/57 (49.12%), Postives = 37/57 (64.91%), Query Frame = -2
Query:  104 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 274
            D G+ AVAL+D+    +DEI+F   + I NIE ID  WW G   G  G+FP+NYV+V
Sbjct:  439 DLGVTAVALYDYQAAGDDEISFDPDDIITNIEMIDEGWWRGVCRGAYGLFPANYVEV 495          
BLAST of SMED30026845 vs. Ensembl Medaka
Match: hcls1 (hematopoietic lineage cell-specific protein [Source:NCBI gene;Acc:101155648])

HSP 1 Score: 221.09 bits (562), Expect = 9.598e-66
Identity = 112/227 (49.34%), Postives = 167/227 (73.57%), Query Frame = -2
Query:  818 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKT-DYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQ 1495
            MWK+  G  V +++    DD         + +SE+EQRWG+KT+ GSG+  +++ +  L+  V      +K+  Y  + K S+GYGGKFGV+KDRMDK A+G+DYV  V++H+SQKD ++GFGGK+GVQ DR DKSA G++Y+ EV++H SQ+DY+KGFGGKYGV+K++ DK+++G+++K E EKH SQKDYS GFGGK+G++ D+ DK+ V ++++ E +KH SQ+
Sbjct:    1 MWKSVVGHNVSMKVAAEGDDWETDPDFEND-VSEQEQRWGAKTIEGSGRAKEHISVAELRNKVAVEHEQVKQKEY--TPKTSYGYGGKFGVEKDRMDKAAVGHDYVAQVEQHSSQKDMAKGFGGKFGVQKDRVDKSALGFEYKGEVERHTSQKDYAKGFGGKYGVEKEKVDKASLGYDYKGETEKHQSQKDYSKGFGGKFGIEKDKVDKAVVGYDYRGETEKHQSQK 224          
BLAST of SMED30026845 vs. Ensembl Medaka
Match: grap2a (growth factor receptor-bound protein 2 [Source:NCBI gene;Acc:101165394])

HSP 1 Score: 59.6918 bits (143), Expect = 1.958e-9
Identity = 23/48 (47.92%), Postives = 31/48 (64.58%), Query Frame = -2
Query:  110 ALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYV 253
            AL+DF  EE DE+ F  G+ I  +++ D  WW G L GR G+FP+NY 
Sbjct:  233 ALYDFTAEEADELGFCVGDVIEVMDRSDPSWWRGRLQGRTGLFPANYT 280          
BLAST of SMED30026845 vs. Ensembl Medaka
Match: ENSORLT00000029133.1 (pep primary_assembly:ASM223467v1:15:615592:625392:1 gene:ENSORLG00000023954.1 transcript:ENSORLT00000029133.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 2.102e-9
Identity = 23/52 (44.23%), Postives = 35/52 (67.31%), Query Frame = -2
Query:  104 AVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQV 259
             + ++D+  + +DE+ F+ G+ I  + K D  WW GELNGR G+FPSNY+ V
Sbjct:  130 VIGMYDYVAQNDDELAFLKGQVITVLNKEDCDWWKGELNGREGLFPSNYLPV 181          
BLAST of SMED30026845 vs. Ensembl Medaka
Match: nck1b (NCK adaptor protein 1 [Source:NCBI gene;Acc:101169073])

HSP 1 Score: 57.3806 bits (137), Expect = 1.449e-8
Identity = 25/58 (43.10%), Postives = 34/58 (58.62%), Query Frame = -2
Query:  101 DEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQVD 274
            D  + A+  F +  E EDE++ V G ++V +EK    WW G  +GR G FPSNYV  D
Sbjct:   70 DLNVPALVKFSYTAEREDELSLVKGTRVVVMEKCSDGWWRGSYSGRSGWFPSNYVTED 127          
BLAST of SMED30026845 vs. Planmine SMEST
Match: SMESG000038704.1 (SMESG000038704.1)

HSP 1 Score: 496.123 bits (1276), Expect = 9.205e-176
Identity = 259/285 (90.88%), Postives = 267/285 (93.68%), Query Frame = -2
Query:   98 LEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEPEAQVEHVTRDVEQLEINEPNRNDDSNEHEQQHIPIVXXXXXXXXXXXXXXXXXXXXXXXXXKVVQAVGDEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQVDE 952
            ++KHASQ+DYS GFGGKYGVQNDRQDKSAV W+HKEE++KHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQ DRQDKSAVGWNTVEAPKANVQEKEPEAQVEHVTRDVEQLEINEPNRNDDSNEHEQQHIPIV              +KEEKHHDKEE VVQAVG+EGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQVDE
Sbjct:    1 MQKHASQQDYSKGFGGKYGVQNDRQDKSAVGWDHKEELEKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQNDRQDKSAVGWNTVEAPKANVQEKEPEAQVEHVTRDVEQLEINEPNRNDDSNEHEQQHIPIV--------------EKEEKHHDKEENVVQAVGNEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGELNGRRGMFPSNYVQVDE 271          

HSP 2 Score: 234.572 bits (597), Expect = 1.943e-73
Identity = 112/143 (78.32%), Postives = 133/143 (93.01%), Query Frame = -2
Query:  746 VDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGW 1174
            + KHASQ+DYS+GFGGKYGVQ DR+DKSA GWD++ E++KH SQQDYSKGFGGKYGVQ+DRQDKSAVGWEH+ ++EKH+SQ+DYS GFGGK+GVQ DRQDKSAV+WEHKEE++KH+SQ D+SKGFGGK+GVQ DRQDKSAVGW
Sbjct:    1 MQKHASQQDYSKGFGGKYGVQNDRQDKSAVGWDHKEELEKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQNDRQDKSAVGW 143          

HSP 3 Score: 197.208 bits (500), Expect = 3.983e-59
Identity = 96/133 (72.18%), Postives = 115/133 (86.47%), Query Frame = -2
Query:  857 SFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNW 1255
            S G+GGK+GVQ DR DK A+G D+   ++KHASQ+DYS+GFGGKYGVQ DR+DKSA GW+++ +V+KH SQQDYSKGFGGK+GVQ DRQDKSAV WEHK E+EKH+SQ D+S GFGGK+GVQNDRQDKSAV W
Sbjct:   11 SKGFGGKYGVQNDRQDKSAVGWDHKEELEKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQNDRQDKSAVGW 143          
BLAST of SMED30026845 vs. Planmine SMEST
Match: SMESG000038702.1 (SMESG000038702.1)

HSP 1 Score: 348.591 bits (893), Expect = 4.339e-118
Identity = 190/190 (100.00%), Postives = 190/190 (100.00%), Query Frame = -2
Query:  926 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKD 1495
            MWKATAGSKVKVEMKTNDDDDWDIDPDFQNDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKD
Sbjct:    1 MWKATAGSKVKVEMKTNDDDDWDIDPDFQNDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKD 190          

HSP 2 Score: 163.31 bits (412), Expect = 1.541e-46
Identity = 78/110 (70.91%), Postives = 96/110 (87.27%), Query Frame = -2
Query:  704 SKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQD 1033
            S G+GGK+GVQKDR DK A+G ++   ++KHASQKDYS GFGGKYGVQ DR+DKSA  W+++ E+QKH SQQDYSKGFGGKYGVQ+DRQDKSAVGWEH+ ++EKH+SQ+D
Sbjct:   81 SFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKD 190          

HSP 3 Score: 156.377 bits (394), Expect = 5.952e-44
Identity = 75/110 (68.18%), Postives = 92/110 (83.64%), Query Frame = -2
Query:  593 SVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTD 922
            S G+GGK+GVQ DR DK A+  ++   + KHASQ+DYS+GFGGKYGVQ DR+DKSA GW+++ +V+KH SQQDYSKGFGGK+GVQ DRQDKSAV WEHK E+EKH+SQ D
Sbjct:   81 SFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKD 190          

HSP 4 Score: 137.887 bits (346), Expect = 4.498e-37
Identity = 65/96 (67.71%), Postives = 83/96 (86.46%), Query Frame = -2
Query:  524 SKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGW 811
            S G+GGK+GVQ+DR DK A+G ++   V+KH+SQ+DYS+GFGGK+GVQ DR+DKSA  W+++ EV+KH SQ D+SKGFGGK+GVQKDRQDKSAVGW
Sbjct:   81 SFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGW 176          
BLAST of SMED30026845 vs. Planmine SMEST
Match: SMESG000038702.1 (SMESG000038702.1)

HSP 1 Score: 342.428 bits (877), Expect = 1.471e-116
Identity = 189/189 (100.00%), Postives = 189/189 (100.00%), Query Frame = -2
Query:  929 MWKATAGSKVKVEMKTNXXXXXXXXXXXXXDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQK 1495
            MWKATAGSKVKVEMKTNDDDDWDIDPDFQNDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQK
Sbjct:    1 MWKATAGSKVKVEMKTNDDDDWDIDPDFQNDISEKEQRWGSKTVTGSGKTDYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQK 189          

HSP 2 Score: 158.688 bits (400), Expect = 1.267e-45
Identity = 77/109 (70.64%), Postives = 95/109 (87.16%), Query Frame = -2
Query:  707 SKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQ 1033
            S G+GGK+GVQKDR DK A+G ++   ++KHASQKDYS GFGGKYGVQ DR+DKSA  W+++ E+QKH SQQDYSKGFGGKYGVQ+DRQDKSAVGWEH+ ++EKH+SQ+
Sbjct:   81 SFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQK 189          

HSP 3 Score: 152.525 bits (384), Expect = 3.011e-43
Identity = 74/108 (68.52%), Postives = 91/108 (84.26%), Query Frame = -2
Query:  599 SVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQ 922
            S G+GGK+GVQ DR DK A+  ++   + KHASQ+DYS+GFGGKYGVQ DR+DKSA GW+++ +V+KH SQQDYSKGFGGK+GVQ DRQDKSAV WEHK E+EKH+SQ
Sbjct:   81 SFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQ 188          

HSP 4 Score: 135.191 bits (339), Expect = 9.005e-37
Identity = 65/96 (67.71%), Postives = 83/96 (86.46%), Query Frame = -2
Query:  524 SKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGW 811
            S G+GGK+GVQ+DR DK A+G ++   V+KH+SQ+DYS+GFGGK+GVQ DR+DKSA  W+++ EV+KH SQ D+SKGFGGK+GVQKDRQDKSAVGW
Sbjct:   81 SFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGW 176          

HSP 5 Score: 77.0258 bits (188), Expect = 4.464e-16
Identity = 37/60 (61.67%), Postives = 48/60 (80.00%), Query Frame = -2
Query:  521 SKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQTDHSKGFGGKFGVQKDRQDKSAVGWN 700
            S G+GGKFGVQ DR DK A+  ++   V+KH+SQ D+S+GFGGK+GVQ DR+DKSA GW+
Sbjct:   81 SFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWD 140          
BLAST of SMED30026845 vs. Planmine SMEST
Match: SMESG000038692.1 (SMESG000038692.1)

HSP 1 Score: 278.1 bits (710), Expect = 5.245e-88
Identity = 141/183 (77.05%), Postives = 151/183 (82.51%), Query Frame = -2
Query:  428 DYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQT----------------DHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEPEAQVEHVTRDVEQLEIN 928
            +YSVGFGGKYGVQNDRQDKSA NWEHKEE++KHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHRE+VEKHSSQQD SKGFGGKFGVQADRQDKSAVSWEHKEEV++HSSQT                DHSKGF GKFGVQ DRQDKS VGWNTVEAPKANVQEK+      H+   ++ L IN
Sbjct:  121 NYSVGFGGKYGVQNDRQDKSAFNWEHKEELEKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREEVEKHSSQQDNSKGFGGKFGVQADRQDKSAVSWEHKEEVKRHSSQTGNEWRYWLYLLDILFSDHSKGFCGKFGVQNDRQDKSEVGWNTVEAPKANVQEKDSSF---HIINSIKILYIN 300          

HSP 2 Score: 206.838 bits (525), Expect = 7.877e-61
Identity = 106/181 (58.56%), Postives = 131/181 (72.38%), Query Frame = -2
Query:  698 NDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQ----------------QDYSKGFGGKYGVQQDRQDKSAVGWEHREKVEKHSSQQDYS 1192
            N+   A        +YS GFGGKYGVQ DR+DKSA  W+++ E++KH SQQDYSKGFGGKYGVQ+DRQDKSAVGWEH+ E+EKH+SQ+D S GFGGK+GVQ DRQDKSAV+WEHKEE+++H+SQ                 D+SKGF GK+GVQ DRQDKS VGW   E  + +  ++D S
Sbjct:  107 NNSTLAATPSTVPSNYSVGFGGKYGVQNDRQDKSAFNWEHKEELEKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREEVEKHSSQQDNSKGFGGKFGVQADRQDKSAVSWEHKEEVKRHSSQTGNEWRYWLYLLDILFSDHSKGFCGKFGVQNDRQDKSEVGWNTVEAPKANVQEKDSS 287          

HSP 3 Score: 179.874 bits (455), Expect = 9.071e-51
Identity = 98/189 (51.85%), Postives = 126/189 (66.67%), Query Frame = -2
Query:  809 ALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCALGNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQSQQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQK----------------DYSVGFGGKYGVQNDRQDKSAVNWEHKEEMQKHASQQDYS 1327
            A ++S+  S  A    +    S  S G+GGK+GVQ DR DK A   ++   ++KHASQ+DYS+GFGGKYGVQ DR+DKSA GW+++ EV+KH SQQD SKGFGGK+GVQ DRQDKSAV WEHK E+++H+SQ                 D+S GF GK+GVQNDRQDKS V W   E  + +  ++D S
Sbjct:  101 AYRDSINNSTLAATPSTV--PSNYSVGFGGKYGVQNDRQDKSAFNWEHKEELEKHASQQDYSKGFGGKYGVQQDRQDKSAVGWEHREEVEKHSSQQDNSKGFGGKFGVQADRQDKSAVSWEHKEEVKRHSSQTGNEWRYWLYLLDILFSDHSKGFCGKFGVQNDRQDKSEVGWNTVEAPKANVQEKDSS 287          
BLAST of SMED30026845 vs. Planmine SMEST
Match: SMESG000073128.1 (SMESG000073128.1)

HSP 1 Score: 63.1586 bits (152), Expect = 3.377e-10
Identity = 27/53 (50.94%), Postives = 41/53 (77.36%), Query Frame = -2
Query:  104 AVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVG-ELNGRRGMFPSNYVQV 259
            A A+F+++ ++ DEI+F  GE I +IE+ID  WW+G   +G+RGMFPSNYV++
Sbjct:  559 AKAVFEYECQDSDEIDFEVGEIITDIEEIDEGWWIGCNKSGKRGMFPSNYVEL 611          

HSP 2 Score: 58.9214 bits (141), Expect = 6.431e-9
Identity = 25/59 (42.37%), Postives = 39/59 (66.10%), Query Frame = -2
Query:  104 GDEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGEL-NGRRGMFPSNYVQV 277
             ++ +  VA++ +   ++DEI+F  GE I N+ +ID  WW GE  +G +GMFPSNYV +
Sbjct:  639 AEKSLTVVAVYSYHALQDDEISFEEGEHIYNVNQIDEGWWQGETKDGDKGMFPSNYVMI 697          
The following BLAST results are available for this feature:
BLAST of SMED30026845 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTTN2.261e-11954.87cortactin [Source:HGNC Symbol;Acc:HGNC:3338][more]
CTTN2.261e-11954.87cortactin [Source:HGNC Symbol;Acc:HGNC:3338][more]
CTTN2.623e-10157.99cortactin [Source:HGNC Symbol;Acc:HGNC:3338][more]
CTTN2.623e-10157.99cortactin [Source:HGNC Symbol;Acc:HGNC:3338][more]
CTTN7.036e-10057.34cortactin [Source:HGNC Symbol;Acc:HGNC:3338][more]
back to top
BLAST of SMED30026845 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sem-57.808e-1056.25Sex muscle abnormal protein 5 [Source:UniProtKB/S... [more]
unc-571.018e-948.00Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
unc-571.087e-848.00Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
unc-571.125e-848.00Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
unc-571.153e-848.00Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of SMED30026845 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cortactin1.264e-7961.90gene:FBgn0025865 transcript:FBtr0306349[more]
Cortactin1.264e-7961.90gene:FBgn0025865 transcript:FBtr0306347[more]
Cortactin1.264e-7961.90gene:FBgn0025865 transcript:FBtr0084039[more]
Cortactin1.264e-7961.90gene:FBgn0025865 transcript:FBtr0306348[more]
Abp14.353e-841.94gene:FBgn0036372 transcript:FBtr0075819[more]
back to top
BLAST of SMED30026845 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcls11.442e-11651.64hematopoietic cell-specific Lyn substrate 1 [Sourc... [more]
hcls12.620e-11651.64hematopoietic cell-specific Lyn substrate 1 [Sourc... [more]
cttn1.043e-9954.52cortactin [Source:ZFIN;Acc:ZDB-GENE-040715-3][more]
cttn4.007e-2742.00cortactin [Source:ZFIN;Acc:ZDB-GENE-040715-3][more]
grap2a5.679e-1045.28GRB2 related adaptor protein 2a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SMED30026845 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cttn9.410e-11756.05cortactin [Source:NCBI gene;Acc:100038122][more]
cttn1.164e-11656.01cortactin [Source:NCBI gene;Acc:100038122][more]
cttn1.441e-11653.59cortactin [Source:NCBI gene;Acc:100038122][more]
cttn2.093e-11358.31cortactin [Source:NCBI gene;Acc:100038122][more]
cttn1.696e-11043.25cortactin [Source:NCBI gene;Acc:100038122][more]
back to top
BLAST of SMED30026845 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cttn5.130e-11954.60cortactin [Source:MGI Symbol;Acc:MGI:99695][more]
Cttn3.512e-10157.64cortactin [Source:MGI Symbol;Acc:MGI:99695][more]
Hcls14.762e-6953.00hematopoietic cell specific Lyn substrate 1 [Sourc... [more]
Hcls11.441e-3247.76hematopoietic cell specific Lyn substrate 1 [Sourc... [more]
Sh3d198.645e-1261.22SH3 domain protein D19 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of SMED30026845 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01406|SRC8_CHICK1.182e-12356.35Src substrate protein p85 OS=Gallus gallus OX=9031... [more]
sp|Q14247|SRC8_HUMAN1.086e-11854.87Src substrate cortactin OS=Homo sapiens OX=9606 GN... [more]
sp|Q60598|SRC8_MOUSE3.588e-11854.60Src substrate cortactin OS=Mus musculus OX=10090 G... [more]
sp|Q66HL2|SRC8_RAT1.391e-10057.99Src substrate cortactin OS=Rattus norvegicus OX=10... [more]
sp|P49710|HCLS1_MOUSE3.331e-6853.00Hematopoietic lineage cell-specific protein OS=Mus... [more]
back to top
BLAST of SMED30026845 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FDR73.257e-14351.77SH3 domain-containing protein OS=Macrostomum ligna... [more]
A0A267E6A11.273e-14152.39SH3 domain-containing protein OS=Macrostomum ligna... [more]
A0A267FX631.373e-13850.70SH3 domain-containing protein OS=Macrostomum ligna... [more]
A0A3P8RJU82.401e-13146.68Cortactin OS=Amphiprion percula OX=161767 PE=4 SV=... [more]
A0A1U7SIY17.467e-13157.52src substrate cortactin-like isoform X2 OS=Alligat... [more]
back to top
BLAST of SMED30026845 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcls13.501e-9855.67src substrate cortactin-like [Source:NCBI gene;Acc... [more]
hcls13.711e-8355.91src substrate cortactin-like [Source:NCBI gene;Acc... [more]
hcls12.916e-8255.91src substrate cortactin-like [Source:NCBI gene;Acc... [more]
ENSAMXT00000050977.14.397e-3253.90pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
grap2b1.694e-1254.17GRB2 related adaptor protein 2b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SMED30026845 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cttn2.004e-5639.45cortactin [Source:ZFIN;Acc:ZDB-GENE-040715-3][more]
DBNL4.505e-1048.28drebrin like [Source:HGNC Symbol;Acc:HGNC:2696][more]
grb2a1.672e-846.00growth factor receptor-bound protein 2a [Source:ZF... [more]
stam1.756e-845.10signal transducing adaptor molecule (SH3 domain an... [more]
ABI19.189e-844.00abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:1132... [more]
back to top
BLAST of SMED30026845 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ABP14.907e-1250.00Actin-binding protein of the cortical actin cytosk... [more]
LSB31.901e-946.30Protein containing a C-terminal SH3 domain; binds ... [more]
YSC841.131e-843.64Actin-binding protein; involved in bundling of act... [more]
PIN39.131e-838.78Negative regulator of actin nucleation-promoting f... [more]
HSE12.002e-743.75Subunit of the endosomal Vps27p-Hse1p complex; com... [more]
back to top
BLAST of SMED30026845 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO500321.878e-11960.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312903.603e-1046.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497506.188e-944.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387101.031e-842.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297442.497e-848.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30026845 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cttn8.119e-10255.06cortactin [Source:NCBI gene;Acc:101157843][more]
hcls19.598e-6649.34hematopoietic lineage cell-specific protein [Sourc... [more]
grap2a1.958e-947.92growth factor receptor-bound protein 2 [Source:NCB... [more]
ENSORLT00000029133.12.102e-944.23pep primary_assembly:ASM223467v1:15:615592:625392:... [more]
nck1b1.449e-843.10NCK adaptor protein 1 [Source:NCBI gene;Acc:101169... [more]
back to top
BLAST of SMED30026845 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038704.19.205e-17690.88SMESG000038704.1[more]
SMESG000038702.14.339e-118100.00SMESG000038702.1[more]
SMESG000038702.11.471e-116100.00SMESG000038702.1[more]
SMESG000038692.15.245e-8877.05SMESG000038692.1[more]
SMESG000073128.13.377e-1050.94SMESG000073128.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026845 ID=SMED30026845|Name=SMED30026845|organism=Schmidtea mediterranea sexual|type=transcript|length=1583bp
TTTTTTTTTATAAAAAAATCAATTTATTGAAATATAAATGGATCGAAAAT
TATTACAATCAAATTTTCACCAATAAAAATCAACAAAGAATCGCTTATTC
ATCGACTTGAACATAATTAGAGGGAAACATGCCTCTGCGACCATTTAGCT
CACCAACCCACCAGCAAGCATCTATCTTTTCTATGTTCACGATTTTTTCA
CCAGCGACAAAATTGATCTCATCTTCCTCCTCGCCATCAAAATCAAACAA
TGCAACTGCCACTATGCCTTCATCTCCAACAGCTTGTACAACCTTTTCCT
CTTTATCATGATGCTTTTCCTCTTTATCATGATGCTTTTCCTCTTTATCA
TGATGCTTTTCATCCTTCTCAACAATTGGAATATGCTGCTGTTCATGCTC
ATTCGAATCATCATTTCGATTAGGTTCATTAATTTCTAATTGTTCTACAT
CTCTTGTGACATGCTCCACCTGTGCTTCAGGCTCTTTTTCCTGGACGTTG
GCTTTTGGCGCCTCAACAGTATTCCAACCGACAGCTGATTTATCTTGACG
ATCCTTTTGAACTCCAAATTTACCACCGAATCCTTTAGAATGATCTGTTT
GAGATGAATGCTTTTCGACTTCTTCCTTATGCTCCCAGCTGACAGCTGAT
TTATCCTGTCGATCTGCCTGGACACCGAATTTACCACCAAATCCTTTACT
ATAGTCTTGTTGAGAAGAATGTTTTTCAACTTTTTCTCTGTGTTCCCAAC
CAACTGCTGATTTATCTTGCCTATCCTGTTGTACCCCATATTTACCACCG
AATCCTTTACTATAATCTTGCTGAGAAGCATGCTTTTGCATTTCTTCTTT
ATGCTCCCAGTTGACAGCAGATTTATCCTGTCGATCATTTTGAACACCGT
ATTTTCCACCAAATCCAACGGAGTAATCTTTTTGAGAAGCATGCTTCTCC
AATTCTGCCTTATGTTCCCAGCCAACAGCAGATTTATCTTGCCGGTCTTT
CTGAACTCCATATTTACCCCCGAAACCCTTTGAGTAATCTTGTTGTGACT
GATGCTTTTGAACTTCTGACTGATAATCCCAACCTGCTGCTGATTTATCT
TTTCTATCAGTTTGAACGCCGTATTTCCCACCAAATCCTTGAGAGTAATC
TTTCTGTGAAGCATGCTTATCAACCGCTCCAACATAATCATTTCCAAGTG
CACACTTATCCATTCTATCTTTCTGAACACCGAATTTCCCTCCATAACCA
AATGATGGCTTGGAAGATCGATCATAAGAAATTTTTTTAATTGCAGCGTC
AGACTGCTTAACACTTTCTTTAAGAGCTTTCAAGTCAACATAATCAGTTT
TCCCAGAACCGGTTACTGTTTTAGAACCCCATCGTTGTTCTTTTTCACTT
ATGTCATTTTGAAAATCTGGATCAATATCCCAGTCATCATCATCATTAGT
TTTCATTTCAACTTTAACTTTACTTCCGGCTGTAGCTTTCCACATTATAA
TTATATTTTTATTAAAATAATTTCAAAAATATTAATAATTAGACAAGGAA
AGATTTTCAAATTATTGTTACTTATGCAAAATT
back to top

protein sequence of SMED30026845-orf-1

>SMED30026845-orf-1 ID=SMED30026845-orf-1|Name=SMED30026845-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=467bp
MWKATAGSKVKVEMKTNDDDDWDIDPDFQNDISEKEQRWGSKTVTGSGKT
DYVDLKALKESVKQSDAAIKKISYDRSSKPSFGYGGKFGVQKDRMDKCAL
GNDYVGAVDKHASQKDYSQGFGGKYGVQTDRKDKSAAGWDYQSEVQKHQS
QQDYSKGFGGKYGVQKDRQDKSAVGWEHKAELEKHASQKDYSVGFGGKYG
VQNDRQDKSAVNWEHKEEMQKHASQQDYSKGFGGKYGVQQDRQDKSAVGW
EHREKVEKHSSQQDYSKGFGGKFGVQADRQDKSAVSWEHKEEVEKHSSQT
DHSKGFGGKFGVQKDRQDKSAVGWNTVEAPKANVQEKEPEAQVEHVTRDV
EQLEINEPNRNDDSNEHEQQHIPIVEKDEKHHDKEEKHHDKEEKHHDKEE
KVVQAVGDEGIVAVALFDFDGEEEDEINFVAGEKIVNIEKIDACWWVGEL
NGRRGMFPSNYVQVDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001452SH3_domain
IPR003134Hs1_Cortactin
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding