slc16a-10

Overview
Nameslc16a-10 (AKN21505.1)
Smed IDSMED30026842
Length (bp)1609
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc16a-10 (SMED30026842) t-SNE clustered cells

Violin plots show distribution of expression levels for slc16a-10 (SMED30026842) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc16a-10 (SMED30026842) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc16a-10 (SMED30026842) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026842

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30026842SMESG000061393.1 dd_Smed_v4_9842_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc16a-10 vs. Ensembl Celegans
Match: Y59A8B.21 (pep chromosome:WBcel235:V:17986260:17994546:1 gene:WBGene00013353.1 transcript:Y59A8B.21.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y59A8B.21)

HSP 1 Score: 105.531 bits (262), Expect = 3.880e-24
Identity = 97/394 (24.62%), Postives = 178/394 (45.18%), Query Frame = 1
Query:  166 VAVFGGFLVHISLGGIFTYGSMFPYILQYM-NLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFIDD----DITNSTLVNPS---RVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIF---------------GETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVL 1278
            V +FG   +H+++G   T+G+M PY+  YM N    +VR+ H   +    G   F    +M +GG          +   G F+++    L+ + I        + YGL+ G+G+GIAY  A++    W P   G++SGI+ +GFG+ S  F  I +  ++        +   + P    RVP  F  +  IY ++Q +A  ++  P   +    ++ L                   E T I++   +++    F+ ++ +    S ++ +F  L K +G+     D+ + +A     + +   RI WGYLTDR  ++I + T+T L ++   T  +  E+GK++          +L W++  F  +    ++F     K FG +H   N+G L
Sbjct:   26 VILFGAVSIHLTIGTYHTFGNMLPYMASYMRNFTDPSVRIEHMMWIPTFQGCFPF----AMVIGGLTSSTFSPRVSAFIGCFLVTSSVALSAYAIQHSFALFFIVYGLLFGLGSGIAYVTAVSTAINWAPDKIGVISGIVAAGFGLSSSIFAPIQTMIVNPLNLPATKDGYFLQPELLHRVPALFTKLAVIYGIMQAMALIVVCDPPFRKSRSTESILEEDDEDMDEDYERPVFDNDEDTTIQMTSSEMLKSPTFYCLFASLFCCSFYANMFYNLYKTYGESFIEDDMFMAMAFSIASVANAIARIGWGYLTDRTSFQIALSTATCLASVFLLTMPMTRELGKMA----------FLFWLVGTFICMGATHALFITATVKCFGNRHKANNYGYL 405          
BLAST of slc16a-10 vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693414:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 92.8189 bits (229), Expect = 6.438e-20
Identity = 104/421 (24.70%), Postives = 181/421 (42.99%), Query Frame = 1
Query:  133 LKILNSKYACYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSL--GGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFID------DD---ITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETTKIELKPHQL---IFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICS--EVGKLSTP--NGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFAD 1341
            LK L      +  + GG +  ++ G ++T G++ PY++ Y        ++      G +I + T   G  M +  GG +E + G     + G  I + G   T+++I        ++ G I  +G+ IAY   +    +WFP + GL  GII+ G+G G+     + + FI+      +D    T   L+   RVP  FI M   + + Q I    I +PE     ++    N+ G  ++I ++  ++   +    F +++++   N+ +  L   L K +G+    SD  L +      IF+   R+ WG + D   Y+             FS   +CS   V   S P     +   ++L  V +MF  I G FSIFP I  K F   +F+  +G L    S   +I  +I     ++
Sbjct:   22 LKRLPRGARPWAVLVGGVMCMVTFGIVYTCGNLLPYLVSYFRW-----KMYPDMRTGQLIWLQTLLSGLPMGMVIGGLVERKFGGRAGALLGSIIYTIGVGSTFYSIQHSYAATLLTMGGIASVGSSIAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYRVNDQGFFTQEDLLE--RVPYVFIVMSIFFTVFQSIGLIFIGQPEG---DIHVETENLIGTNSEIRVEQARVWPQLRTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQ-------------FSMSIVCSLGAVLAFSMPLVKMVSNDVLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTHALSE 419          
BLAST of slc16a-10 vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693414:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 92.8189 bits (229), Expect = 7.297e-20
Identity = 104/421 (24.70%), Postives = 181/421 (42.99%), Query Frame = 1
Query:  133 LKILNSKYACYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSL--GGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFID------DD---ITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETTKIELKPHQL---IFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICS--EVGKLSTP--NGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFAD 1341
            LK L      +  + GG +  ++ G ++T G++ PY++ Y        ++      G +I + T   G  M +  GG +E + G     + G  I + G   T+++I        ++ G I  +G+ IAY   +    +WFP + GL  GII+ G+G G+     + + FI+      +D    T   L+   RVP  FI M   + + Q I    I +PE     ++    N+ G  ++I ++  ++   +    F +++++   N+ +  L   L K +G+    SD  L +      IF+   R+ WG + D   Y+             FS   +CS   V   S P     +   ++L  V +MF  I G FSIFP I  K F   +F+  +G L    S   +I  +I     ++
Sbjct:    8 LKRLPRGARPWAVLVGGVMCMVTFGIVYTCGNLLPYLVSYFRW-----KMYPDMRTGQLIWLQTLLSGLPMGMVIGGLVERKFGGRAGALLGSIIYTIGVGSTFYSIQHSYAATLLTMGGIASVGSSIAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYRVNDQGFFTQEDLLE--RVPYVFIVMSIFFTVFQSIGLIFIGQPEG---DIHVETENLIGTNSEIRVEQARVWPQLRTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQ-------------FSMSIVCSLGAVLAFSMPLVKMVSNDVLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTHALSE 405          
BLAST of slc16a-10 vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693542:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 92.8189 bits (229), Expect = 7.297e-20
Identity = 104/421 (24.70%), Postives = 181/421 (42.99%), Query Frame = 1
Query:  133 LKILNSKYACYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSL--GGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFID------DD---ITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETTKIELKPHQL---IFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICS--EVGKLSTP--NGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFAD 1341
            LK L      +  + GG +  ++ G ++T G++ PY++ Y        ++      G +I + T   G  M +  GG +E + G     + G  I + G   T+++I        ++ G I  +G+ IAY   +    +WFP + GL  GII+ G+G G+     + + FI+      +D    T   L+   RVP  FI M   + + Q I    I +PE     ++    N+ G  ++I ++  ++   +    F +++++   N+ +  L   L K +G+    SD  L +      IF+   R+ WG + D   Y+             FS   +CS   V   S P     +   ++L  V +MF  I G FSIFP I  K F   +F+  +G L    S   +I  +I     ++
Sbjct:    8 LKRLPRGARPWAVLVGGVMCMVTFGIVYTCGNLLPYLVSYFRW-----KMYPDMRTGQLIWLQTLLSGLPMGMVIGGLVERKFGGRAGALLGSIIYTIGVGSTFYSIQHSYAATLLTMGGIASVGSSIAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYRVNDQGFFTQEDLLE--RVPYVFIVMSIFFTVFQSIGLIFIGQPEG---DIHVETENLIGTNSEIRVEQARVWPQLRTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQ-------------FSMSIVCSLGAVLAFSMPLVKMVSNDVLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTHALSE 405          
BLAST of slc16a-10 vs. UniProt/SwissProt
Match: sp|P37662|YHJX_ECOLI (Uncharacterized MFS-type transporter YhjX OS=Escherichia coli (strain K12) OX=83333 GN=yhjX PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.193e-7
Identity = 82/400 (20.50%), Postives = 174/400 (43.50%), Query Frame = 1
Query:  145 NSKYACYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHP-TDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFIDD---DITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETTKIE--LKPHQLIFYVNFWIIWITYALNSAFSLLFIL-LQKMWGKYLEISDL-RLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPII 1320
            N +   ++ + G  +   +LG ++T+ S+F   L        + ++  P + V +  G+ + G   S S+ G ++ R G     +  G ++  G+ LT  + +L ++ +  S G++VG+  G  Y + ++   +WFP+  GL+S                I SY +        ++ L+    +  +F+  G I  ++ +  A L+K  +  ++ V  +N  +  + T  E   KP        +W++ + + L +  S L+++ + K   + L   D+     A     I ++ GR++ G L+D+     VI           +   + S VG  +          +   +  + F   G  ++FP++ ++ FG+ +   N+GV+Y G+   ++   II
Sbjct:    5 NYQRTRWLTLIGTIITQFALGSVYTW-SLFNGAL--------SAKLDAPVSQVAFSFGLLSLGLAISSSVAGKLQERFGVKRVTMASGILLGLGFFLTAHSDNLMMLWL--SAGVLVGLADGAGYLLTLSNCVKWFPERKGLISAFA-------------IGSYGLGSLGFKFIDTQLLETVGLEKTFVIWGAIALLMIVFGATLMK--DAPKQEVKTSNGVVEKDYTLAESMRKPQ-------YWMLAVMF-LTACMSGLYVIGVAKDIAQSLAHLDVVSAANAVTVISIANLSGRLVLGILSDKIARIRVI-----------TIGQVISLVGMAALLFAPLNAVTFFAAIACVAFNFGGTITVFPSLVSEFFGLNNLAKNYGVIYLGFGIGSICGSII 359          
BLAST of slc16a-10 vs. TrEMBL
Match: A0A0H3YF10 (Slc16a-10 OS=Schmidtea mediterranea OX=79327 GN=slc16a-10 PE=2 SV=1)

HSP 1 Score: 817.379 bits (2110), Expect = 0.000e+0
Identity = 453/453 (100.00%), Postives = 453/453 (100.00%), Query Frame = 1
Query:  127 MDLKILNSKYACYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFIDDDITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFADQDTKXXXXXXXXXXXXXXXXXXXXXXXYNQSYHKKIFFGKTTKVSQAN 1485
            MDLKILNSKYACYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPGLLSGIILSGFGIGSVGFDLIHSYFIDDDITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFADQDTKTLFLTTFIIGSIISILSLLVSLFYNQSYHKKIFFGKTTKVSQAN
Sbjct:    1 MDLKILNSKYACYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPGLLSGIILSGFGIGSVGFDLIHSYFIDDDITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFADQDTKTLFLTTFIIGSIISILSLLVSLFYNQSYHKKIFFGKTTKVSQAN 453          
BLAST of slc16a-10 vs. TrEMBL
Match: A0A1I8HL50 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.057e-62
Identity = 143/425 (33.65%), Postives = 234/425 (55.06%), Query Frame = 1
Query:  169 AVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFIDDDITNSTLV---------NPS---RVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETT----------------------------KIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQ-KMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPII 1320
            AV GGFL+H +LG ++T+G+M PY++ YM L+  +  + +P D  WI G++ FG+GASM+ GG IE R+GA  T + G +IMS G +L+YF +  H+  + V+YGL+ G+GTGIAY VA+     WFP   GL+ GI+++GFG GS+ FD   + +I+ D   + +           P+   RVP  F+ +G IY ++Q +   L++RP   E    Q  +   G+ T                            +++  P Q++    FW++W T+ +NS  S+++I  Q K +G    ++D  L I       F+   R++WG+L DR  Y+ +++  +   A++ STF          T +G   +  YL+WV  MF L +GNF++FPA CAK++G  + T N+G+L+T  + + +I  ++
Sbjct:   10 AVIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSHSKWIGYP-DATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALLRRPTAAELEERQELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRGGELDSTPGQMVRKPQFWLLWATFLVNSQ-SVVYINTQYKSFGLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTF----------TLSGAPWY--YLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALL 420          
BLAST of slc16a-10 vs. TrEMBL
Match: A0A267H5U2 (MFS domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000477g2 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 1.356e-62
Identity = 143/425 (33.65%), Postives = 234/425 (55.06%), Query Frame = 1
Query:  169 AVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFIDDDITNSTLV---------NPS---RVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETT----------------------------KIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQ-KMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPII 1320
            AV GGFL+H +LG ++T+G+M PY++ YM L+  +  + +P D  WI G++ FG+GASM+ GG IE R+GA  T + G +IMS G +L+YF +  H+  + V+YGL+ G+GTGIAY VA+     WFP   GL+ GI+++GFG GS+ FD   + +I+ D   + +           P+   RVP  F+ +G IY ++Q +   L++RP   E    Q  +   G+ T                            +++  P Q++    FW++W T+ +NS  S+++I  Q K +G    ++D  L I       F+   R++WG+L DR  Y+ +++  +   A++ STF          T +G   +  YL+WV  MF L +GNF++FPA CAK++G  + T N+G+L+T  + + +I  ++
Sbjct:   12 AVIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSHSKWIGYP-DATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALLRRPTAAELEERQELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRGGELDSTPGQMVRKPQFWLLWATFLVNSQ-SVVYINTQYKSFGLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTF----------TLSGAPWY--YLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALL 422          
BLAST of slc16a-10 vs. TrEMBL
Match: A0A1I8HYG0 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 3.571e-62
Identity = 143/425 (33.65%), Postives = 233/425 (54.82%), Query Frame = 1
Query:  169 AVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFIDDDITNSTLV---------NPS---RVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETT----------------------------KIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQ-KMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPII 1320
            AV GGFL+H +LG ++T+G+M PY++ YM L+  +  + +P D  WI G++ FG+GASM+ GG IE R+GA  T + G +IMS G +L+YF +  H+  + V+YGL+ G+GTGIAY VA+     WFP   GL+ GI+++GFG GS+ FD   + +I+ D   + +           P+   RVP  F+ +G IY ++Q +   L++RP   E    Q  +   G+ T                            + +  P Q++    FW++W T+ +NS  S+++I  Q K +G    ++D  L I       F+   R++WG+L DR  Y+ +++  +   A++ STF          T +G   +  YL+WV  MF L +GNF++FPA CAK++G  + T N+G+L+T  + + +I  ++
Sbjct:   10 AVIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSHSKWIGYP-DATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALLRRPTAAELEERQELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRGGESDSTPGQMVRKPQFWLLWATFLVNSQ-SVVYINTQYKSFGLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTF----------TLSGAPWY--YLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALL 420          
BLAST of slc16a-10 vs. TrEMBL
Match: A0A1I8H205 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 5.280e-62
Identity = 143/419 (34.13%), Postives = 234/419 (55.85%), Query Frame = 1
Query:  169 AVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFIDDDITNSTLV---------NPS---RVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETT----------------------KIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQ-KMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPII 1320
            AV GGFL+H +LG ++T+G+M PY++ YM L+  +  + +P D  WI G++ FG+GASM+ GG IE R+GA  T + G +IMS G +L+YF +  H+  + V+YGL+ G+GTGIAY VA+     WFP   GL+ GI+++GFG GS+ FD   + +I+ D   + +           P+   RVP  F+ +G IY ++Q +   L++RP   E    Q  +   G+ T                      +++  P Q++    FW++W T+ +NS  S+++I  Q K +G    ++D  L I       F+   R++WG+L DR  Y+ +++  +   A++ STF          T +G   +  YL+WV  MF L +GNF++FPA CAK++G  + T N+G+L+T  + + +I  ++
Sbjct:   10 AVIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSHSKWIGYP-DATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALLRRPTAAELEERQELVGEAGDDTAAQETALDEGSPSKPRAWKPRRRMDSTPGQMVRKPQFWLLWATFLVNSQ-SVVYINTQYKSFGLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTF----------TLSGAPWY--YLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALL 414          

HSP 2 Score: 93.5893 bits (231), Expect = 2.809e-16
Identity = 59/191 (30.89%), Postives = 104/191 (54.45%), Query Frame = 1
Query:  751 KRPETVEESVNQNNLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQ-KMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPII 1320
             +P  +E S + N     GE+   +  P Q++    FW++W T+ +NS  S+++I  Q K +G    ++D  L I       F+   R++WG+L DR  Y+ +++  +   A++ STF          T +G   +  YL+WV  MF L +GNF++FPA CAK++G  + T N+G+L+T  + + +I  ++
Sbjct:  475 SKPVAMETSEHGNR---GGES---DSTPGQMVRKPQFWLLWATFLVNSQ-SVVYINTQYKSFGLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTF----------TLSGAPWY--YLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALL 646          
BLAST of slc16a-10 vs. Ensembl Cavefish
Match: ENSAMXT00000010927.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002229.1:6659:13971:1 gene:ENSAMXG00000010636.2 transcript:ENSAMXT00000010927.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 6.026e-6
Identity = 80/325 (24.62%), Postives = 141/325 (43.38%), Query Frame = 1
Query:  211 IFTYG--SMFPYILQYM--NLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFIDDDITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEE--------SVNQNNLNIFGETTKIE-----LKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEIS-DLRLLIAT---CTGGIFSIFGRIIWGYLTDRFGYK--IVIWTSTLLFAIMFSTFYICSE 1116
            +FTYG   +F   LQ +  +  +TN RV       WI+ +  F    +  L   + +R G    ++ GG ++S G I T FT S++ + + V  GL+ G+G  + +   +TI +Q+F K   L++ +  +G            S         + LV    +  S IA G +  +  +I  P +  PE  +E        SV+    +I    T ++      +P  L F V     +I Y+L   F+ L     +++   L +S  L    AT    T  +  IFGR+  G++ +R   +   ++   T+L +++ + F   SE
Sbjct:   38 VFTYGIIKIFGIFLQDLMSHFEETNSRV------SWIVSICVFVMTFTAPLSTVLSNRFGCRPVVMFGGLLISLGTISTAFTHSINQMYITV--GLVSGLGYCLTFLPTVTILSQYFNKRRSLVTSVASTGECFSLFALTPALSILKAHVGWRNCLVVIGLMQASLIAFGAL--LRPIIIQPKLSSPEEEKEGRSLPSKSSVDSGVQSISSSKTNLKEEPVVAQPKLLDFSVLRDCSFICYSLFGLFATLGFFAPQLYIIDLSVSCGLERNQATYMLSTMAVAEIFGRLSIGWILNRRPVRKIYILLICTMLLSLVLALFTAVSE 352          
BLAST of slc16a-10 vs. Planmine SMEST
Match: SMESG000061393.1 (SMESG000061393.1)

HSP 1 Score: 813.142 bits (2099), Expect = 0.000e+0
Identity = 449/453 (99.12%), Postives = 453/453 (100.00%), Query Frame = 1
Query:  127 MDLKILNSKYACYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFIDDDITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFADQDTKXXXXXXXXXXXXXXXXXXXXXXXYNQSYHKKIFFGKTTKVSQAN 1485
            MDLKILNSKYACYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAV+YGLIVGIGTGIAYGVAMTIPTQWFPKHPGLLSGIILSGFGIGSVGFDLIHSYFIDDD+TNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQK+WGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFADQDTKTLFLTTFIIGSIISILSLLVSLFYNQSYHKKIFFGKTTKV+QAN
Sbjct:    1 MDLKILNSKYACYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVTYGLIVGIGTGIAYGVAMTIPTQWFPKHPGLLSGIILSGFGIGSVGFDLIHSYFIDDDVTNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKIWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFADQDTKTLFLTTFIIGSIISILSLLVSLFYNQSYHKKIFFGKTTKVAQAN 453          
BLAST of slc16a-10 vs. Planmine SMEST
Match: SMESG000061393.1 (SMESG000061393.1)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 338/371 (91.11%), Postives = 344/371 (92.72%), Query Frame = 1
Query:  379 ASFTIVTGGFI--MSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFIDDDITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFADQDTKXXXXXXXXXXXXXXXXXXXXXXXYNQSYHKKIFFGKTTKVSQAN 1485
            A +  V GGF+  +S G I TY                  GIGTGIAYGVAMTIPTQWFPKHPGLLSGIILSGFGIGSVGFDLIHSYFIDDD+TNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQK+WGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFADQDTKTLFLTTFIIGSIISILSLLVSLFYNQSYHKKIFFGKTTKV+QAN
Sbjct:   11 ACYVAVFGGFLVHISLGGIFTY------------------GIGTGIAYGVAMTIPTQWFPKHPGLLSGIILSGFGIGSVGFDLIHSYFIDDDVTNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQNNLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKIWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFADQDTKTLFLTTFIIGSIISILSLLVSLFYNQSYHKKIFFGKTTKVAQAN 363          

HSP 2 Score: 69.707 bits (169), Expect = 1.111e-12
Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 1
Query:  127 MDLKILNSKYACYVAVFGGFLVHISLGGIFTYG 225
            MDLKILNSKYACYVAVFGGFLVHISLGGIFTYG
Sbjct:    1 MDLKILNSKYACYVAVFGGFLVHISLGGIFTYG 33          
BLAST of slc16a-10 vs. Planmine SMEST
Match: SMESG000061391.1 (SMESG000061391.1)

HSP 1 Score: 344.354 bits (882), Expect = 2.239e-113
Identity = 186/414 (44.93%), Postives = 275/414 (66.43%), Query Frame = 1
Query:  127 MDLKILNSKYA----CYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFIDDDITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRPETVEESVNQN--NLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFADQDT 1350
            M  K+ N K+      Y++VFGGFLV ++LGG++TYG+M PY+LQYM  N    + ++  +  WI G+  FG GA+MS GGFIE++LG SFTI+ G  IMSFG ++TY+TI +H+  VA+SYGLIVG+G G+AYG+ + +P  WFP   GL++GI+++GFGIG + FD I +Y+I+ D+ N+ L   + +  SFI M  IY  IQ+I + +IK+P   E+  N+   N N   E  KI LK H+L+F  +FWI+WITY LNS  ++L + L K +G  L+I+DL L   T +G   +  GR+IWG L DR  YK+++ + +L  ++M  TFY+C   G  + P     F MY +WVI++ FL+SGNF++FP ICAK FG +HF GN+G+L+T YSF  ++T  +  ++  ++ +
Sbjct:    1 MICKLFNKKFKHPKLAYLSVFGGFLVQLTLGGVYTYGNMAPYMLQYMRNNTAPYKDINVGNSVWIFGLCVFGLGATMSFGGFIEYKLGTSFTILLGSLIMSFGVLITYWTIQVHLALVAISYGLIVGLGVGLAYGLILGVPNLWFPDSKGLVTGIVVAGFGIGPIIFDFIQAYYINHDLHNTKLSEVNNLRYSFILMAGIYAAIQIIGSLMIKKPPA-EKPTNEFSINDNFSKENYKISLKTHELLFERDFWILWITYMLNSVVAILVLSLHKTFGFTLKITDLYLTYFTASGAFANGVGRVIWGILNDRIPYKVLMSSLSLCMSLMLGTFYLCVLAGSSNKPESGREF-MYCVWVIVLHFLLSGNFTLFPTICAKTFGSEHFAGNYGLLFTAYSFGGIVTSAVTTKLLENEHS 412          
BLAST of slc16a-10 vs. Planmine SMEST
Match: SMESG000061391.1 (SMESG000061391.1)

HSP 1 Score: 343.199 bits (879), Expect = 2.091e-112
Identity = 187/417 (44.84%), Postives = 277/417 (66.43%), Query Frame = 1
Query:  127 MDLKILNSKYA----CYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFIDDDITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRP----ETVEESVNQN-NLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFADQDT 1350
            M  K+ N K+      Y++VFGGFLV ++LGG++TYG+M PY+LQYM  N    + ++  +  WI G+  FG GA+MS GGFIE++LG SFTI+ G  IMSFG ++TY+TI +H+  VA+SYGLIVG+G G+AYG+ + +P  WFP   GL++GI+++GFGIG + FD I +Y+I+ D+ N+ L   + +  SFI M  IY  IQ+I + +IK+P     T E S+N N +  +  E  KI LK H+L+F  +FWI+WITY LNS  ++L + L K +G  L+I+DL L   T +G   +  GR+IWG L DR  YK+++ + +L  ++M  TFY+C   G  + P     F MY +WVI++ FL+SGNF++FP ICAK FG +HF GN+G+L+T YSF  ++T  +  ++  ++ +
Sbjct:    1 MICKLFNKKFKHPKLAYLSVFGGFLVQLTLGGVYTYGNMAPYMLQYMRNNTAPYKDINVGNSVWIFGLCVFGLGATMSFGGFIEYKLGTSFTILLGSLIMSFGVLITYWTIQVHLALVAISYGLIVGLGVGLAYGLILGVPNLWFPDSKGLVTGIVVAGFGIGPIIFDFIQAYYINHDLHNTKLSEVNNLRYSFILMAGIYAAIQIIGSLMIKKPPAEKPTNEFSINDNFSKYVAVENYKISLKTHELLFERDFWILWITYMLNSVVAILVLSLHKTFGFTLKITDLYLTYFTASGAFANGVGRVIWGILNDRIPYKVLMSSLSLCMSLMLGTFYLCVLAGSSNKPESGREF-MYCVWVIVLHFLLSGNFTLFPTICAKTFGSEHFAGNYGLLFTAYSFGGIVTSAVTTKLLENEHS 416          
BLAST of slc16a-10 vs. Planmine SMEST
Match: SMESG000061390.1 (SMESG000061390.1)

HSP 1 Score: 310.071 bits (793), Expect = 4.165e-100
Identity = 167/397 (42.07%), Postives = 257/397 (64.74%), Query Frame = 1
Query:  139 ILNSKYACYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPXXXXXXXXXXXXXXXXXXDLIHSYFIDDDITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIKRP------ETVEESVNQNNLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVIIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVIT 1311
            + N     Y+ + GGFLV ++LG ++TYG+M PY+L YM  N      +   +  WI G++ FG GA+MSLGGF+   +GA+ TI+ G ++MS G I TY+TI   I  VA++YGL++G+G GIAYG  + IP+QWFP+  G  +GI+++GFG   +  D I SY+I+ +I+   + N   VP SF+ MG IY +IQLI + LI+ P      E+ E ++    + I  ++ +I++KP +L+F  +FW++W++Y  NS  ++L + L K++G+ L I D+ L IA+  G  F+  GRI WG+L D+F YK ++   TL  ++M  TFY+CS +     PN + +F M+LIWVII+ FL+SGNFSI+P IC++ FG ++   N+GVL+T Y+   +IT
Sbjct:    1 MFNKPIFAYLTLVGGFLVQLTLGAVYTYGNMAPYMLSYMENNTKPYNKIDSGNAMWIFGLSVFGLGATMSLGGFLVPIIGATSTILIGSWLMSLGVITTYWTIKTCIGFVALTYGLVLGLGVGIAYGTVINIPSQWFPESKGFTTGIVVAGFGFAPITLDFIQSYYINPNISEIHIKNTDNVPFSFVLMGSIYAIIQLIGSVLIRTPNSTPRLESAETNIRFRKIGIL-DSAEIQMKPIKLMFQKDFWVLWLSYTFNSCVAILVLSLHKVFGETLSIIDINLTIASAIGAGFNGIGRIAWGFLIDKFSYKTIMTILTLSMSLMIGTFYLCSLI-----PNVHQKFIMFLIWVIILHFLLSGNFSIYPVICSRTFGQENSVVNYGVLFTAYALAGLIT 391          
The following BLAST results are available for this feature:
BLAST of slc16a-10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Y59A8B.213.880e-2424.62pep chromosome:WBcel235:V:17986260:17994546:1 gene... [more]
F10G7.56.438e-2024.70pep chromosome:WBcel235:II:4693414:4696408:1 gene:... [more]
F10G7.57.297e-2024.70pep chromosome:WBcel235:II:4693414:4696408:1 gene:... [more]
F10G7.57.297e-2024.70pep chromosome:WBcel235:II:4693542:4696408:1 gene:... [more]
back to top
BLAST of slc16a-10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P37662|YHJX_ECOLI1.193e-720.50Uncharacterized MFS-type transporter YhjX OS=Esche... [more]
back to top
BLAST of slc16a-10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF100.000e+0100.00Slc16a-10 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A1I8HL501.057e-6233.65MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A267H5U21.356e-6233.65MFS domain-containing protein (Fragment) OS=Macros... [more]
A0A1I8HYG03.571e-6233.65MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8H2055.280e-6234.13MFS domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of slc16a-10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000010927.26.026e-624.62pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of slc16a-10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061393.10.000e+099.12SMESG000061393.1[more]
SMESG000061393.11.111e-1291.11SMESG000061393.1[more]
SMESG000061391.12.239e-11344.93SMESG000061391.1[more]
SMESG000061391.12.091e-11244.84SMESG000061391.1[more]
SMESG000061390.14.165e-10042.07SMESG000061390.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30026842
GenBankAKN21505.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026842 ID=SMED30026842|Name=slc16a-10|organism=Schmidtea mediterranea sexual|type=transcript|length=1609bp
GTGAATTGTAAATTATATTAATTATCGAAATTTTCATTACTTTCATTTAA
ATATTCTATAGAAAAATATTTTAGGTCTTACTCAATTATATTGTTTAGTA
ATATTTGATTCATTTCATTGAGGTATATGGATTTGAAGATTTTAAATTCT
AAATATGCATGTTATGTAGCAGTTTTCGGTGGTTTTCTTGTACACATCAG
CTTAGGTGGTATTTTTACATACGGAAGTATGTTTCCATATATTCTGCAAT
ATATGAATTTAAATCAGACCAATGTAAGAGTCGTTCATCCAACAGATGTT
GGTTGGATAATCGGTATGGCTACATTTGGTAGAGGTGCTTCAATGTCACT
TGGGGGGTTTATTGAACACCGCCTAGGTGCTTCTTTCACTATTGTAACCG
GTGGTTTTATTATGAGTTTTGGTTATATTTTGACGTATTTCACTATCAGC
TTACATATAATTCCAGTTGCCGTATCCTATGGTTTAATTGTAGGCATAGG
CACTGGAATAGCATATGGTGTAGCGATGACCATTCCAACTCAATGGTTTC
CAAAGCATCCGGGGCTTTTATCAGGAATAATACTTTCTGGATTTGGAATT
GGATCCGTCGGATTTGATTTGATTCATTCGTATTTTATCGATGATGATAT
AACAAACAGTACTCTCGTCAACCCCTCCAGAGTTCCGGTATCATTTATCG
CCATGGGCTGTATCTATTTCATGATTCAACTTATTGCTGCTCCATTAATA
AAAAGACCAGAAACCGTTGAAGAATCAGTCAATCAGAACAATTTGAATAT
ATTCGGTGAAACTACGAAAATCGAACTTAAACCTCACCAGTTAATTTTTT
ATGTCAATTTTTGGATTATTTGGATCACATATGCTCTTAATTCTGCGTTC
TCTTTGTTGTTTATTCTCCTTCAGAAAATGTGGGGTAAATATTTAGAAAT
TTCTGATTTGCGATTACTTATTGCTACTTGTACTGGGGGAATTTTCAGTA
TTTTTGGACGAATTATATGGGGATATTTGACAGATAGATTCGGATATAAG
ATTGTCATTTGGACGTCGACTTTATTGTTCGCTATAATGTTCAGTACGTT
CTACATTTGTTCTGAAGTTGGTAAATTGAGTACTCCAAATGGCAATAATC
GTTTTGCAATGTATTTGATATGGGTAATTATTATGTTTTTCCTCATATCG
GGAAACTTTTCTATTTTTCCCGCAATATGTGCAAAAGTTTTCGGCATCCA
GCATTTCACGGGAAATTTCGGTGTCCTATATACCGGATATTCTTTCACTG
CCGTAATAACACCTATTATCGTTCTGAGAGTATTTGCTGACCAAGACACC
AAAACTCTTTTTTTAACTACATTTATAATTGGATCCATTATCTCTATATT
GTCCTTGCTAGTATCATTATTTTATAACCAGTCTTATCATAAAAAAATCT
TTTTTGGAAAAACTACAAAAGTATCGCAAGCTAATTAAATCTCCGTGAAT
AGAAATTGTAATAAATACAATAAATAATGACTTGGTCAATTAACATTGAA
TCAAATTCCATTGTTGTTACGTTGTTAGAAGAAATAAATCAAATAAAAGA
ACTTGATAA
back to top

protein sequence of SMED30026842-orf-1

>SMED30026842-orf-1 ID=SMED30026842-orf-1|Name=SMED30026842-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=454bp
MDLKILNSKYACYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNV
RVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGY
ILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPGLLSG
IILSGFGIGSVGFDLIHSYFIDDDITNSTLVNPSRVPVSFIAMGCIYFMI
QLIAAPLIKRPETVEESVNQNNLNIFGETTKIELKPHQLIFYVNFWIIWI
TYALNSAFSLLFILLQKMWGKYLEISDLRLLIATCTGGIFSIFGRIIWGY
LTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWV
IIMFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVL
RVFADQDTKTLFLTTFIIGSIISILSLLVSLFYNQSYHKKIFFGKTTKVS
QAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 7..440
e-value: 2.5E-31
score: 110.6
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 13..426
NoneNo IPR availablePANTHERPTHR11360:SF3OXALATE/FORMATE ANTIPORTERcoord: 13..426
NoneNo IPR availableCDDcd17353MFS_OFA_likecoord: 13..413
e-value: 1.35707E-51
score: 177.032
NoneNo IPR availableTMHMMTMhelixcoord: 411..433
NoneNo IPR availableTMHMMTMhelixcoord: 186..208
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 243..265
NoneNo IPR availableTMHMMTMhelixcoord: 382..404
NoneNo IPR availableTMHMMTMhelixcoord: 310..332
NoneNo IPR availableTMHMMTMhelixcoord: 278..300
NoneNo IPR availableTMHMMTMhelixcoord: 83..105
NoneNo IPR availableTMHMMTMhelixcoord: 345..367
NoneNo IPR availableTMHMMTMhelixcoord: 144..166
NoneNo IPR availableTMHMMTMhelixcoord: 112..134
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 24..328
e-value: 6.6E-20
score: 71.3
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 11..438
score: 20.778
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 7..434