BTB domain-containing protein

Overview
NameBTB domain-containing protein
Smed IDSMED30026839
Length (bp)1301
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026839

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30026839SMESG000059408.1 Contig4592_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: bath-1 (BTB and MATH domain containing [Source:UniProtKB/TrEMBL;Acc:Q9N5Q0])

HSP 1 Score: 62.3882 bits (150), Expect = 1.227e-10
Identity = 49/154 (31.82%), Postives = 78/154 (50.65%), Query Frame = 2
Query:  584 DYFSDVQLVPEDPSNRRLFAHRQVLALNSPWFAERFRGSETLNNGDTGHVISVPFRYEDMHNFLRIIYPNRSIQVNEFNVEGLMDVAKEYQVPNVLRKAELFLYKNLEAGSAVLSYYLARKYELPHLQDAALLHLSELNS-SQLKARLSMDMKD 1042
            + FSDV L  ED   ++ F  R+ LA +S +F     G  T    D   +        D  NFL ++Y    I  ++ +VEG++ +A  Y VP  +RK E FL +  E  S      +A+KY+L +L+ +    LS++N+  ++KA L  D+ D
Sbjct:  143 EQFSDVVLAVED---KKFFVLRKFLASHSSYFKSLLLG--TFAEADKSEIKHEAINSIDFQNFLEVLYGEPVI--DDDDVEGILHLAHMYDVPVAIRKCEEFLIEKSEK-SMRDQLEIAKKYQLDNLKKSC---LSKVNTVEEIKAALMCDLAD 285          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: bath-21 (BTB and MATH domain containing [Source:UniProtKB/TrEMBL;Acc:Q9N5Q1])

HSP 1 Score: 54.299 bits (129), Expect = 5.076e-8
Identity = 45/147 (30.61%), Postives = 71/147 (48.30%), Query Frame = 2
Query:  539 TKMKKYTRQPDFTCPDY----FSDVQLVPEDPSNRRLFAHRQVLALNSPWFAERFRGSETLNNGDTGHVISVPFRYEDMHNFLRIIYPNRSIQVNEFNVEGLMDVAKEYQVPNVLRKAELFLYKNLEAGSAVLSYYLARKYELPHLQ 967
            TKM   +++P   C D     FSDV L   D   ++ F  R+ LA +S +F  RF G+   +  D   V        D  N L ++Y   +I  ++  V+G++ +A  Y +P  +RK E FL +  E  S      LA++Y+L  L+
Sbjct:  128 TKMTGISKKP-LKCFDQSKEKFSDVILAVGD---QKFFVLRKFLASHSTFFESRFLGN--FDEADKSEVTLRDIDSADFQNLLEVLYGEPAI--DDDTVDGILHLAHMYDIPLPIRKCEEFLIEVSEK-SMKDQLVLAKQYQLEKLK 265          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: btb-12 (BTB (Broad/complex/Tramtrack/Bric a brac) domain protein [Source:UniProtKB/TrEMBL;Acc:P91543])

HSP 1 Score: 48.521 bits (114), Expect = 3.616e-6
Identity = 40/126 (31.75%), Postives = 64/126 (50.79%), Query Frame = 2
Query:  593 SDVQLVPEDPSNRRLFAHRQVLALNSPWFAERFRGSETLNNGDTGHVISVPFRYEDMHNFLRIIYPNRSIQVNEFNVEGLMDVAKEYQVPN--VLRKAELFLYKNLEAGSAVLSYYLARKYELPHL 964
            +D  LV ED   +RL  +++ L+L+S +FAE F+ SE         +      YED    +  IYP + I  N+F  E ++++A  ++VP    L + +L  +  L  G  +L   LA KYE+  L
Sbjct:  110 TDAVLVVED---KRLHVNKEFLSLHSTYFAELFKKSE---------ITIEDLSYEDFGLLMSNIYP-KVIFPNDFTAEKILELAVRFKVPAAVALVENQLLHHSTLSHGKLLL---LADKYEMHRL 219          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: CG17068 (gene:FBgn0031098 transcript:FBtr0077341)

HSP 1 Score: 50.447 bits (119), Expect = 2.656e-6
Identity = 38/127 (29.92%), Postives = 63/127 (49.61%), Query Frame = 2
Query:  605 LVPEDPSNRRLFAHRQVLALNSPWFAERFRGSETLNNGDTGHVISVP-FRYEDMHNFLRIIYPNRSIQVNEFNVE-GLMDVAKEYQVPNVLRKAELFLYKNLEAGSAVLSYYLARKYELPHLQDAAL 979
            LV   P+ R +  H+ +LA+ SP F   F G    N  D    I +P  + E     L  IY +R I +  F+    L  VAK+Y +P+V+ +   FL+ +L   +A  +Y  A+ ++ P L  +++
Sbjct:   31 LVGSSPTQRLIAGHKLLLAMASPVFERMFYG----NLPDKTDPIVIPDVQPEAFEAMLEYIYTDR-ITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPKNACRAYEFAKLFDEPRLMQSSM 152          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A4S2M6F1 (BTB domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003638 PE=4 SV=1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 247/345 (71.59%), Postives = 296/345 (85.80%), Query Frame = 2
Query:   68 MSKNLVGNSILDHFLTDETGKNCGPFTFSEADLKLFCSRDVNLNDQPAQVTISHPKIPGLSWIIFFYQTGSNQYQPKIAYDFPSYLRSDSEVCIQFAGMHWVVKHKFEGSAWLSSCLPPKVMNERWVTMGTIKKVEVRVTISKVWFKFPIFTCCCFPTKMKKYTRQPDFTCPDYFSDVQLVPEDPSNRRLFAHRQVLALNSPWFAERFRGSETLNNGDTGHVISVPFRYEDMHNFLRIIYPNRSIQVNEFNVEGLMDVAKEYQVPNVLRKAELFLYKNLEAGSAVLSYYLARKYELPHLQDAALLHLSELNSSQLKARLSMDMKDKPADAQEVLLNDLCIRLANA 1102
            M+    G ++L HFLTDETG NCG FTF+E DL L CSRD+NLNDQPAQV +SHPKIPGLSWIIFFYQT  NQYQP++AYDFPSYLR+D EVCIQFAGMHWVVKHKFEGS+WL+S LPPK MNERWVT+GT+KKVE+RV I+K+WFKFP+FT CC+P K K++ RQPDFT PD+FSDVQL+P+DP+NRRLFAHRQVLA+NSPWFAERFR +  LN GD G +IS+PF Y+ + NFLR IYPN ++++   NVEGL+D+AKEYQ+PNV+RK E ++YK +E GSAVL YYLARK+ELP +QDAALLHL+ELNSSQL+ARL++DMK K  D  EVLL+DLCIRLA +
Sbjct:    1 MNSKYAGGTVLSHFLTDETGPNCGDFTFNEQDLLLLCSRDINLNDQPAQVMVSHPKIPGLSWIIFFYQTAPNQYQPRVAYDFPSYLRADCEVCIQFAGMHWVVKHKFEGSSWLTSTLPPKAMNERWVTLGTVKKVEIRVNITKIWFKFPVFTACCYPLKTKRFVRQPDFTMPDHFSDVQLLPQDPNNRRLFAHRQVLAMNSPWFAERFRSASALNTGDIGPIISIPFDYDTVLNFLRFIYPNGNLEITAENVEGLLDMAKEYQMPNVIRKCEKWMYKFMEGGSAVLCYYLARKHELPQVQDAALLHLAELNSSQLRARLNLDMKGKSPDTHEVLLSDLCIRLAGS 345          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A074ZU98 (BTB domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_03004 PE=4 SV=1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 247/345 (71.59%), Postives = 296/345 (85.80%), Query Frame = 2
Query:   68 MSKNLVGNSILDHFLTDETGKNCGPFTFSEADLKLFCSRDVNLNDQPAQVTISHPKIPGLSWIIFFYQTGSNQYQPKIAYDFPSYLRSDSEVCIQFAGMHWVVKHKFEGSAWLSSCLPPKVMNERWVTMGTIKKVEVRVTISKVWFKFPIFTCCCFPTKMKKYTRQPDFTCPDYFSDVQLVPEDPSNRRLFAHRQVLALNSPWFAERFRGSETLNNGDTGHVISVPFRYEDMHNFLRIIYPNRSIQVNEFNVEGLMDVAKEYQVPNVLRKAELFLYKNLEAGSAVLSYYLARKYELPHLQDAALLHLSELNSSQLKARLSMDMKDKPADAQEVLLNDLCIRLANA 1102
            M+    G ++L HFLTDETG NCG FTF+E DL L CSRD+NLNDQPAQV +SHPKIPGLSWIIFFYQT  NQYQP++AYDFPSYLR+D EVCIQFAGMHWVVKHKFEGS+WL+S LPPK MNERWVT+GT+KKVE+RV I+K+WFKFP+FT CC+P K K++ RQPDFT PD+FSDVQL+P+DP+NRRLFAHRQVLA+NSPWFAERFR +  LN GD G +IS+PF Y+ + NFLR IYPN ++++   NVEGL+D+AKEYQ+PNV+RK E ++YK +E GSAVL YYLARK+ELP +QDAALLHL+ELNSSQL+ARL++DMK K  D  EVLL+DLCIRLA +
Sbjct:    1 MNSKYAGGTVLSHFLTDETGPNCGDFTFNEQDLLLLCSRDINLNDQPAQVMVSHPKIPGLSWIIFFYQTAPNQYQPRVAYDFPSYLRADCEVCIQFAGMHWVVKHKFEGSSWLTSTLPPKAMNERWVTLGTVKKVEIRVNITKIWFKFPVFTACCYPLKTKRFVRQPDFTMPDHFSDVQLLPQDPNNRRLFAHRQVLAMNSPWFAERFRSASALNTGDIGPIISIPFDYDTVLNFLRFIYPNGNLEITAENVEGLLDMAKEYQMPNVIRKCEKWMYKFMEGGSAVLCYYLARKHELPQVQDAALLHLAELNSSQLRARLNLDMKGKSPDTHEVLLSDLCIRLAGS 345          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: G7Y432 (Protein C4 OS=Clonorchis sinensis OX=79923 GN=CLF_100718 PE=4 SV=1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 247/345 (71.59%), Postives = 296/345 (85.80%), Query Frame = 2
Query:   68 MSKNLVGNSILDHFLTDETGKNCGPFTFSEADLKLFCSRDVNLNDQPAQVTISHPKIPGLSWIIFFYQTGSNQYQPKIAYDFPSYLRSDSEVCIQFAGMHWVVKHKFEGSAWLSSCLPPKVMNERWVTMGTIKKVEVRVTISKVWFKFPIFTCCCFPTKMKKYTRQPDFTCPDYFSDVQLVPEDPSNRRLFAHRQVLALNSPWFAERFRGSETLNNGDTGHVISVPFRYEDMHNFLRIIYPNRSIQVNEFNVEGLMDVAKEYQVPNVLRKAELFLYKNLEAGSAVLSYYLARKYELPHLQDAALLHLSELNSSQLKARLSMDMKDKPADAQEVLLNDLCIRLANA 1102
            M+    G ++L HFLTDETG NCG FTF+E DL L CSRD+NLNDQPAQV +SHPKIPGLSWIIFFYQT  NQYQP++AYDFPSYLR+D EVCIQFAGMHWVVKHKFEGS+WL+S LPPK MNERWVT+GT+KKVE+RV I+K+WFKFP+FT CC+P K K++ RQPDFT PD+FSDVQL+P+DP+NRRLFAHRQVLA+NSPWFAERFR +  LN GD G +IS+PF Y+ + NFLR IYPN ++++   NVEGL+D+AKEYQ+PNV+RK E ++YK +E GSAVL YYLARK+ELP +QDAALLHL+ELNSSQL+ARL++DMK K  D  EVLL+DLCIRLA +
Sbjct:    1 MNSKYAGGTVLSHFLTDETGPNCGDFTFNEQDLLLLCSRDINLNDQPAQVMVSHPKIPGLSWIIFFYQTAPNQYQPRVAYDFPSYLRADCEVCIQFAGMHWVVKHKFEGSSWLTSTLPPKAMNERWVTLGTVKKVEIRVNITKIWFKFPVFTACCYPLKTKRFVRQPDFTMPDHFSDVQLLPQDPNNRRLFAHRQVLAMNSPWFAERFRSASALNTGDIGPIISIPFDYDTVLNFLRFIYPNGNLEITAENVEGLLDMAKEYQMPNVIRKCEKWMYKFMEGGSAVLCYYLARKHELPQVQDAALLHLAELNSSQLRARLNLDMKGKSPDTHEVLLSDLCIRLAGS 345          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A504YNU3 (BTB domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_01334 PE=4 SV=1)

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 248/345 (71.88%), Postives = 294/345 (85.22%), Query Frame = 2
Query:   68 MSKNLVGNSILDHFLTDETGKNCGPFTFSEADLKLFCSRDVNLNDQPAQVTISHPKIPGLSWIIFFYQTGSNQYQPKIAYDFPSYLRSDSEVCIQFAGMHWVVKHKFEGSAWLSSCLPPKVMNERWVTMGTIKKVEVRVTISKVWFKFPIFTCCCFPTKMKKYTRQPDFTCPDYFSDVQLVPEDPSNRRLFAHRQVLALNSPWFAERFRGSETLNNGDTGHVISVPFRYEDMHNFLRIIYPNRSIQVNEFNVEGLMDVAKEYQVPNVLRKAELFLYKNLEAGSAVLSYYLARKYELPHLQDAALLHLSELNSSQLKARLSMDMKDKPADAQEVLLNDLCIRLANA 1102
            M+    G ++L HFLTDETG NCG FTF+E DL L CSR++NLNDQPAQV +SHPKIPGLSWIIFFYQT  NQYQP+IA+DFPSYLR+D EVCIQFAGMHW+VKHKFEGS+WL+S LPPK MNERWVT+GT+KKVE+RV I+K+WFKFP+FT CC+P K K++ RQPDFT PD+FSDVQL+P+DPSNRRLFAHRQVLA+NSPWF+ERFR + TLN GD G +IS+PF YE + NFL  IYPN    +   NVEGLMD+AKEYQ+PNV+RK E ++Y+ +E GSAVL YYLARK+ELP +QDAALLHLSELNSSQL+ARL++DMK K  D QEVLL+DLCIRLA +
Sbjct:    1 MNSKFAGGTVLSHFLTDETGPNCGDFTFNEQDLLLLCSREINLNDQPAQVMVSHPKIPGLSWIIFFYQTSPNQYQPRIAFDFPSYLRADCEVCIQFAGMHWIVKHKFEGSSWLTSTLPPKAMNERWVTLGTVKKVEIRVNITKIWFKFPVFTACCYPLKTKRFVRQPDFTMPDHFSDVQLLPQDPSNRRLFAHRQVLAMNSPWFSERFRSASTLNTGDIGPIISIPFDYETVLNFLHFIYPNGDFAITADNVEGLMDMAKEYQMPNVIRKCEKWMYQFMEGGSAVLCYYLARKHELPQVQDAALLHLSELNSSQLRARLNLDMKGKSPDTQEVLLSDLCIRLAGS 345          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A2H1CKK9 (BTB/POZ domain protein OS=Fasciola hepatica OX=6192 GN=D915_003588 PE=4 SV=1)

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 248/345 (71.88%), Postives = 294/345 (85.22%), Query Frame = 2
Query:   68 MSKNLVGNSILDHFLTDETGKNCGPFTFSEADLKLFCSRDVNLNDQPAQVTISHPKIPGLSWIIFFYQTGSNQYQPKIAYDFPSYLRSDSEVCIQFAGMHWVVKHKFEGSAWLSSCLPPKVMNERWVTMGTIKKVEVRVTISKVWFKFPIFTCCCFPTKMKKYTRQPDFTCPDYFSDVQLVPEDPSNRRLFAHRQVLALNSPWFAERFRGSETLNNGDTGHVISVPFRYEDMHNFLRIIYPNRSIQVNEFNVEGLMDVAKEYQVPNVLRKAELFLYKNLEAGSAVLSYYLARKYELPHLQDAALLHLSELNSSQLKARLSMDMKDKPADAQEVLLNDLCIRLANA 1102
            M+    G ++L HFLTDETG NCG FTF+E DL L CSR++NLNDQPAQV +SHPKIPGLSWIIFFYQT  NQYQP+IA+DFPSYLR+D EVCIQFAGMHW+VKHKFEGS+WL+S LPPK MNERWVT+GT+KKVE+RV I+K+WFKFP+FT CC+P K K++ RQPDFT PD+FSDVQL+P+DPSNRRLFAHRQVLA+NSPWF+ERFR + TLN GD G +IS+PF YE + NFL  IYPN    +   NVEGLMD+AKEYQ+PNV+RK E ++Y+ +E GSAVL YYLARK+ELP +QDAALLHLSELNSSQL+ARL++DMK K  D QEVLL+DLCIRLA +
Sbjct:    1 MNSKFAGGTVLSHFLTDETGPNCGDFTFNEQDLLLLCSREINLNDQPAQVMVSHPKIPGLSWIIFFYQTSPNQYQPRIAFDFPSYLRADCEVCIQFAGMHWIVKHKFEGSSWLTSTLPPKAMNERWVTLGTVKKVEIRVNITKIWFKFPVFTACCYPLKTKRFVRQPDFTMPDHFSDVQLLPQDPSNRRLFAHRQVLAMNSPWFSERFRSASTLNTGDIGPIISIPFDYETVLNFLHFIYPNGDFAITADNVEGLMDMAKEYQMPNVIRKCEKWMYQFMEGGSAVLCYYLARKHELPQVQDAALLHLSELNSSQLRARLNLDMKGKSPDTQEVLLSDLCIRLAGS 345          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO36075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJN5])

HSP 1 Score: 59.3066 bits (142), Expect = 5.667e-10
Identity = 49/154 (31.82%), Postives = 81/154 (52.60%), Query Frame = 2
Query:  566 PDFTCPDYFSDVQLVPEDPSNRRLFAHRQVLALNSPWFAERFRGSETLNNGDTGHVISVPFRYED-MHNFLRIIYPNRSIQVNEF-NVEGLMDVAKEYQVPNVLRKAELFLYKNLEAGSAVLSYYLARKYELPHLQDAALLHLSELNSSQLKAR 1021
            P F+ P  +SD+ LV E+    R   HR +LA+ SP F   F+         +   I +P +  D +++FL ++YP   IQ+ E  +V  L+++A+EYQ+P +  + E  L   L+  S+V    LA+++ L  L D  L+ LS +    LK +
Sbjct:    2 PSFSEPWGYSDLVLVVEE---ERFHVHRAILAMCSPVFRAMFQSK---FKEASLEEIPLPGKKADRIYDFLCMLYP-FPIQIAEHHDVSSLLELAREYQIPKLTARCEERL---LQKQSSVDLILLAQEFNLTKLLDKCLVSLSRMQLHDLKEK 145          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO44770 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUX6])

HSP 1 Score: 58.9214 bits (141), Expect = 1.615e-9
Identity = 48/151 (31.79%), Postives = 76/151 (50.33%), Query Frame = 2
Query:  569 DFTCPDYFSDVQLVPEDPSNRRLFAHRQVLALNSPWFAERFRGSETLNNGDTGHVISVPFRYEDMHNFLRIIYPNRSIQVNEFNVEGLMDVAKEYQVPNVLRKAELFLYKNLEAGS-AVLSYYLARKYELPHLQDAALLHLSELNSSQLKA 1018
            DF+ P   SDV L+ E+   +R+  H+ +LA+ S  F E F       N    H+  V  +  +M   L  IYP  S  +NE N   L+++AK +++  V    E +L +  + GS A+    LA KY L  L+D  L  + +LN S +++
Sbjct:   10 DFSQPWRMSDVVLLVEE---QRMHVHQSILAMWSTVFEEMFNELRK-KNSRALHLEGV--KAHEMRELLLFIYPTISRPINEDNCYCLLELAKRFKMGKVTEDCEEYLMRTTKKGSDAINMLVLASKYGLKRLRDDCLHTVKKLNWSTIRS 154          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO47648 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLR1])

HSP 1 Score: 54.299 bits (129), Expect = 6.142e-8
Identity = 43/140 (30.71%), Postives = 67/140 (47.86%), Query Frame = 2
Query:  566 PDFTCPDYFSDVQLVPEDPSNRRLFAHRQVLALNSPWFAERFRGSETLNNGDTGHVISVPF-RYEDMHNFLRIIYPNRSIQ-VNEFNVEGLMDVAKEYQVPNVLRKAELFLYKNLEAGSAVLSYYLARKYELPHLQDAAL 979
            PDF+ P +FSDV LV E     +   HR  L++ SP F   F    T     T   I +P  R  ++   LR++Y     Q + E N   L+++A+EYQ+  V      FL  NL+  + +  Y +A  ++L  +   +L
Sbjct:  421 PDFSSPWHFSDVVLVIEGT---KFHVHRSTLSIWSPVFERMFTSGFT---EKTAEEIPLPGKRAAEIEVLLRVMYTFGKAQPITEGNYTFLLELAEEYQMDRVKELCAEFLNYNLQESNCLKFYRVAEHFKLKEVMARSL 554          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000059408.1 (SMESG000059408.1)

HSP 1 Score: 730.324 bits (1884), Expect = 0.000e+0
Identity = 347/347 (100.00%), Postives = 347/347 (100.00%), Query Frame = 2
Query:   68 MSKNLVGNSILDHFLTDETGKNCGPFTFSEADLKLFCSRDVNLNDQPAQVTISHPKIPGLSWIIFFYQTGSNQYQPKIAYDFPSYLRSDSEVCIQFAGMHWVVKHKFEGSAWLSSCLPPKVMNERWVTMGTIKKVEVRVTISKVWFKFPIFTCCCFPTKMKKYTRQPDFTCPDYFSDVQLVPEDPSNRRLFAHRQVLALNSPWFAERFRGSETLNNGDTGHVISVPFRYEDMHNFLRIIYPNRSIQVNEFNVEGLMDVAKEYQVPNVLRKAELFLYKNLEAGSAVLSYYLARKYELPHLQDAALLHLSELNSSQLKARLSMDMKDKPADAQEVLLNDLCIRLANAHM 1108
            MSKNLVGNSILDHFLTDETGKNCGPFTFSEADLKLFCSRDVNLNDQPAQVTISHPKIPGLSWIIFFYQTGSNQYQPKIAYDFPSYLRSDSEVCIQFAGMHWVVKHKFEGSAWLSSCLPPKVMNERWVTMGTIKKVEVRVTISKVWFKFPIFTCCCFPTKMKKYTRQPDFTCPDYFSDVQLVPEDPSNRRLFAHRQVLALNSPWFAERFRGSETLNNGDTGHVISVPFRYEDMHNFLRIIYPNRSIQVNEFNVEGLMDVAKEYQVPNVLRKAELFLYKNLEAGSAVLSYYLARKYELPHLQDAALLHLSELNSSQLKARLSMDMKDKPADAQEVLLNDLCIRLANAHM
Sbjct:    1 MSKNLVGNSILDHFLTDETGKNCGPFTFSEADLKLFCSRDVNLNDQPAQVTISHPKIPGLSWIIFFYQTGSNQYQPKIAYDFPSYLRSDSEVCIQFAGMHWVVKHKFEGSAWLSSCLPPKVMNERWVTMGTIKKVEVRVTISKVWFKFPIFTCCCFPTKMKKYTRQPDFTCPDYFSDVQLVPEDPSNRRLFAHRQVLALNSPWFAERFRGSETLNNGDTGHVISVPFRYEDMHNFLRIIYPNRSIQVNEFNVEGLMDVAKEYQVPNVLRKAELFLYKNLEAGSAVLSYYLARKYELPHLQDAALLHLSELNSSQLKARLSMDMKDKPADAQEVLLNDLCIRLANAHM 347          
The following BLAST results are available for this feature:
BLAST of BTB domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
bath-11.227e-1031.82BTB and MATH domain containing [Source:UniProtKB/... [more]
bath-215.076e-830.61BTB and MATH domain containing [Source:UniProtKB/... [more]
btb-123.616e-631.75BTB (Broad/complex/Tramtrack/Bric a brac) domain p... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG170682.656e-629.92gene:FBgn0031098 transcript:FBtr0077341[more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BTB domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M6F10.000e+071.59BTB domain-containing protein OS=Opisthorchis feli... [more]
A0A074ZU980.000e+071.59BTB domain-containing protein OS=Opisthorchis vive... [more]
G7Y4320.000e+071.59Protein C4 OS=Clonorchis sinensis OX=79923 GN=CLF_... [more]
A0A504YNU30.000e+071.88BTB domain-containing protein OS=Fasciola gigantic... [more]
A0A2H1CKK90.000e+071.88BTB/POZ domain protein OS=Fasciola hepatica OX=619... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BTB domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO360755.667e-1031.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447701.615e-931.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476486.142e-830.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BTB domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000059408.10.000e+0100.00SMESG000059408.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026839 ID=SMED30026839|Name=BTB domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1301bp
TAAATTTTGATGAATCAAATCAATAAATCTATTTAATATTTAAATAATAC
AATATATAATCAATAAAATGTCTAAAAATCTTGTTGGTAATAGCATACTT
GATCATTTTTTAACCGATGAGACTGGCAAAAATTGTGGCCCATTTACATT
TTCTGAGGCTGATTTGAAGTTATTTTGCAGTCGCGATGTCAATCTCAATG
ATCAACCGGCCCAAGTAACGATCAGTCATCCAAAAATCCCCGGCTTGTCA
TGGATAATTTTCTTCTATCAAACTGGCAGTAATCAGTATCAACCGAAAAT
CGCCTATGATTTTCCTAGCTATCTCCGATCTGACAGCGAGGTTTGTATCC
AATTTGCCGGTATGCATTGGGTAGTAAAACATAAATTCGAAGGCAGTGCT
TGGTTAAGTAGTTGTCTTCCTCCAAAGGTCATGAATGAGAGATGGGTTAC
GATGGGTACTATCAAAAAGGTTGAGGTAAGAGTGACCATTTCTAAGGTTT
GGTTTAAATTTCCAATCTTCACATGTTGTTGCTTTCCAACTAAAATGAAG
AAATATACTCGACAACCTGATTTTACGTGCCCAGATTACTTCTCCGACGT
ACAATTAGTTCCAGAAGATCCAAGCAACCGACGACTTTTTGCTCATCGAC
AGGTTTTGGCTTTAAATTCGCCTTGGTTTGCAGAGAGATTTCGCGGATCT
GAAACACTAAATAATGGCGATACAGGACACGTTATTTCCGTTCCTTTTCG
ATACGAGGATATGCATAATTTTCTTAGAATTATCTATCCAAATAGATCAA
TTCAAGTTAATGAATTCAACGTTGAAGGTCTTATGGACGTAGCTAAAGAA
TATCAAGTACCAAATGTATTAAGAAAAGCCGAATTATTTCTGTATAAAAA
TCTTGAAGCTGGTTCAGCTGTTCTAAGCTACTATTTAGCTAGGAAATACG
AATTACCTCATTTACAAGACGCCGCACTTTTACATCTTAGCGAATTGAAT
TCATCTCAGTTGAAAGCTAGATTAAGTATGGATATGAAAGACAAACCTGC
AGATGCCCAAGAAGTCTTACTAAATGATTTATGCATTCGACTGGCAAATG
CTCACATGTAAAAAGGCTGGCATTGAGCCTAAACTCCATTTCAATCGAGT
TTAATTAAAAATTAATTATTAATCAATTAGTAAATTTGGATTGAAATTCC
AATTGGTAACATGATTATTTGATCTTGACTTTGGTAATTGTAATTTTTTA
AATATGAAAACTGACAAATGATTAAAATAAAATTTTCTAATAGGTTAAAA
A
back to top

protein sequence of SMED30026839-orf-1

>SMED30026839-orf-1 ID=SMED30026839-orf-1|Name=SMED30026839-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=348bp
MSKNLVGNSILDHFLTDETGKNCGPFTFSEADLKLFCSRDVNLNDQPAQV
TISHPKIPGLSWIIFFYQTGSNQYQPKIAYDFPSYLRSDSEVCIQFAGMH
WVVKHKFEGSAWLSSCLPPKVMNERWVTMGTIKKVEVRVTISKVWFKFPI
FTCCCFPTKMKKYTRQPDFTCPDYFSDVQLVPEDPSNRRLFAHRQVLALN
SPWFAERFRGSETLNNGDTGHVISVPFRYEDMHNFLRIIYPNRSIQVNEF
NVEGLMDVAKEYQVPNVLRKAELFLYKNLEAGSAVLSYYLARKYELPHLQ
DAALLHLSELNSSQLKARLSMDMKDKPADAQEVLLNDLCIRLANAHM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR000210BTB/POZ_dom
IPR011333SKP1/BTB/POZ_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 176..279
e-value: 9.0E-17
score: 71.7
IPR000210BTB/POZ domainPFAMPF00651BTBcoord: 174..278
e-value: 2.1E-13
score: 50.5
IPR000210BTB/POZ domainPROSITEPS50097BTBcoord: 176..243
score: 12.764
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 158..308
e-value: 1.2E-17
score: 66.1
NoneNo IPR availablePANTHERPTHR47022FAMILY NOT NAMEDcoord: 125..314
NoneNo IPR availableCDDcd18186BTB_POZ_ZBTB_KLHL-likecoord: 175..262
e-value: 3.74893E-9
score: 51.0154
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 169..277