EF-hand domain-containing protein

Overview
NameEF-hand domain-containing protein
Smed IDSMED30026808
Length (bp)653
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF-hand domain-containing protein (SMED30026808) t-SNE clustered cells

Violin plots show distribution of expression levels for EF-hand domain-containing protein (SMED30026808) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF-hand domain-containing protein (SMED30026808) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF-hand domain-containing protein (SMED30026808) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026808

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30026808SMESG000081370.1 dd_Smed_v4_446_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30026808SMESG000081370.1 dd_Smed_v4_446_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026808SMESG000081370.1 dd_Smed_v4_446_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026808SMESG000081370.1 dd_Smed_v4_446_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026808SMESG000081370.1 dd_Smed_v4_446_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026808SMESG000081370.1 dd_Smed_v4_446_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026808SMESG000060188.1 Contig5832GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026808SMESG000081370.1 Contig55601newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026808SMESG000081370.1 Contig55601uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026808SMESG000081370.1 Contig5832GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30026808SMESG000081370.1 dd_Smed_v6_446_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30026808SMESG000081370.1 OX_Smed_1.0.23456ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30026808SMESG000081370.1 dd_Smed_v6_446_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026808SMESG000081370.1 dd_Smed_v6_446_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30026808SMESG000081370.1 dd_Smed_v6_446_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30026808SMESG000081370.1 dd_Smed_v4_446_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026808SMESG000081370.1 dd_Smed_v4_446_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|P14202|TEGU_SCHMA (Tegument antigen OS=Schistosoma mansoni OX=6183 GN=A12 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.518e-17
Identity = 56/179 (31.28%), Postives = 88/179 (49.16%), Query Frame = 1
Query:   52 LVELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEF-------ISRLEINDDFYDR------PVTHENDVEIISAGNTPFHRQYVMVNIVRRAF---KSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTPS 540
             +  F EIDA+ N  I ++EL  Y +K       ++ W+  FD D D KIS+EEF       +S +    D   +      P    N +EII+A  +   +QY +    +         G + +E+A  +K  LD+   ++W  VL+ G YW  +SHEP  S+ FK+ N V + ++TPS
Sbjct:   13 FIRAFLEIDADSNEMIDKQELIKYCQKYRLDMKLIDPWIARFDTDKDNKISIEEFCRGFGLKVSEIRREKDELKKERDGKFPKLPPN-IEIIAATMSK-TKQYEICCQFKEYVDNTSRTGNDMREVANKMKSLLDNTYGRVWQVVLLTGSYWMNFSHEPFLSIQFKYNNYVCLAWRTPS 189          
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|P32070|SM21_SCHMA (Antigen Sm21.7 OS=Schistosoma mansoni OX=6183 GN=SM21.7 PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 5.589e-10
Identity = 42/183 (22.95%), Postives = 79/183 (43.17%), Query Frame = 1
Query:   34 DDDVQMLVELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEF------------ISRLEINDDFYDRPVTHENDVEIISAGNTPFHRQYVMVNIVRRAFK--SHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTPS 540
            D  ++  ++ +  +  + +  +   +L +  +K       V +W+  FDVD D KI+ EEF            I R  I      R  +    V II A   P  +Q  +  + +  +       +  ++ K  K +L+ +  ++W    V   YW  +SHEP  S+ F++ N + + ++TPS
Sbjct:    2 DSPMEKFIQTYLTLLRDGDETVETSKLSESCRKEKLDMKQVNEWIALFDVDKDQKITFEEFCRGLGLKQNEMRIERNHIKTVQSGREQSLPEGVSII-ASTMPKPKQVEVTQLFKDIYNEVKKDPDMNKVVKTFKSELERRYGRVWQVNAVTHSYWASFSHEPFQSIQFQYDNKIILAWRTPS 183          
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2QY37|CDPKQ_ORYSJ (Calcium-dependent protein kinase 26 OS=Oryza sativa subsp. japonica OX=39947 GN=CPK26 PE=2 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 4.406e-6
Identity = 24/72 (33.33%), Postives = 49/72 (68.06%), Query Frame = 1
Query:   13 IMSGRYNDDDVQMLVELFYEIDANCNNEISRKELQDYMKKRG--YSDNDVEKWMQNFDVDHDGKISLEEFIS 222
            I++G  ++++++ L E+F  ID + +  I+ +EL++ + K+G  +SDN++E+ M+  D D +G I  EEF++
Sbjct:  376 IIAGCLSEEEIKGLKEMFKNIDKDNSGTITLEELKNGLAKQGTKFSDNEIEQLMEAADADGNGIIDYEEFVT 447          
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2RAV0|CDPKP_ORYSJ (Calcium-dependent protein kinase 25 OS=Oryza sativa subsp. japonica OX=39947 GN=CPK25 PE=2 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 4.406e-6
Identity = 24/72 (33.33%), Postives = 49/72 (68.06%), Query Frame = 1
Query:   13 IMSGRYNDDDVQMLVELFYEIDANCNNEISRKELQDYMKKRG--YSDNDVEKWMQNFDVDHDGKISLEEFIS 222
            I++G  ++++++ L E+F  ID + +  I+ +EL++ + K+G  +SDN++E+ M+  D D +G I  EEF++
Sbjct:  376 IIAGCLSEEEIKGLKEMFKNIDKDNSGTITLEELKNGLAKQGTKFSDNEIEQLMEAADADGNGIIDYEEFVT 447          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8J0C9 (EF-hand domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012489g1 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.054e-25
Identity = 57/167 (34.13%), Postives = 91/167 (54.49%), Query Frame = 1
Query:   58 ELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEFISRLEIN-----DDFYDRPVTHE--NDVEIISAGNTPFHRQYVMVNIVRRAFKSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTP 537
            E +  ID      I+ ++L  YMKK+ Y D  V KWM+ FD D+ G I +EE+   L +N      +   R  T      VE IS G+     Q  + N+     +++ +N K++ K++K + D Q  +LWH V+V GQ+W ++ HEP  S +F++   +FI+F+TP
Sbjct:    6 EAWLAIDVQGRGSITSRDLSAYMKKQNYDDAFVNKWMRLFDQDNSGTIEVEEYCDVLGLNPKQIMSEVRSRIATGSMPEGVEYIS-GDMDLSWQIKIANLTLEGLRTN-QNMKDVPKWIKTQADRQFNQLWHVVIVNGQFWCYFGHEPAYSFIFRYGKQIFIIFRTP 170          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8H6V5 (Dynein light chain OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034129g1 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.385e-25
Identity = 52/169 (30.77%), Postives = 99/169 (58.58%), Query Frame = 1
Query:   55 VELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEFISRL-----EINDDFYD--RPVTHENDVEIISAGNTPFHRQYVMVNIVRRAFKSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTPS 540
            ++ ++ ID     EI+  +L  YM++  Y +  V KW++ FD D+ G I+L+E+   L     ++  D+    R  +  +D+ +IS+  T    Q  ++ IVR   +     +K++AK++K++ D+++E+LWH V++ GQ+W +YSHEP  S +F+    +F +++TP 
Sbjct:    6 IDAYFAIDTEGKGEITSAQLTRYMRQNNYDEAFVRKWLKLFDSDNSGTITLDEYCQTLGLEAKKVKADYIAKMRSGSLPSDITVISSDMT-LELQLRIIEIVRDG-QRLNSMEKDMAKYIKQQCDAKMERLWHVVIINGQFWCWYSHEPGYSFIFRLGKYIFCIWRTPG 172          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A267F2V4 (Dynein light chain (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034129g2 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.428e-25
Identity = 52/169 (30.77%), Postives = 99/169 (58.58%), Query Frame = 1
Query:   55 VELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEFISRL-----EINDDFYD--RPVTHENDVEIISAGNTPFHRQYVMVNIVRRAFKSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTPS 540
            ++ ++ ID     EI+  +L  YM++  Y +  V KW++ FD D+ G I+L+E+   L     ++  D+    R  +  +D+ +IS+  T    Q  ++ IVR   +     +K++AK++K++ D+++E+LWH V++ GQ+W +YSHEP  S +F+    +F +++TP 
Sbjct:   10 IDAYFAIDTEGKGEITSAQLTRYMRQNNYDEAFVRKWLKLFDSDNSGTITLDEYCQTLGLEAKKVKADYIAKMRSGSLPSDITVISSDMT-LELQLRIIEIVRDG-QRLNSMEKDMAKYIKQQCDAKMERLWHVVIINGQFWCWYSHEPGYSFIFRLGKYIFCIWRTPG 176          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A267GBS0 (EF-hand domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014838g1 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 2.005e-25
Identity = 58/172 (33.72%), Postives = 94/172 (54.65%), Query Frame = 1
Query:   43 VQMLVELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEFISRLEINDD-------FYDRPVTHENDVEIISAGNTPFHRQYVMVNIVRRAFKSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTP 537
            +++  E +Y ID      I+ ++L  YM+K  Y +  V+KWM  FD D+ G I LEE+   L +N+           +       VE I AG+    RQ  +  +   A + H  + KE+ K+VK + D Q +++WH + ++GQ+W ++  EPE S VF++K  VFI++KTP
Sbjct:    1 MEVFKEAWYSIDLEAKGSINAEDLAVYMRKNNYEEAFVKKWMAIFDQDNSGTIELEEYCEVLGLNEKEMMEETRLRAKATGMPEGVEYI-AGDMSEERQIDIARLCIEALEKHS-SLKEVPKWVKLEADKQFDRVWHVLAIRGQFWCYFGFEPETSYVFRYKRNVFIIWKTP 170          
BLAST of EF-hand domain-containing protein vs. TrEMBL
Match: A0A1I8GDT5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.235e-25
Identity = 61/167 (36.53%), Postives = 101/167 (60.48%), Query Frame = 1
Query:   52 LVELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEFISRLEI---NDDFYDRPVTH--ENDVEIISAGNTPFHRQYVMVNIVRRAFKSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTP 537
             ++ F  ID + +  I+ +EL++YMKK  + ++ ++KW++ FD++ DG ISL+EF   L +   N   Y R V      +V +IS+    +  Q ++V  VRRA      ++++I+  +K+ LD++  KLW  V+V GQY+  YSHEPE S  FK  N V++++KTP
Sbjct:   33 FLDAFIAIDEDGSETITVEELRNYMKKNNFQESFIKKWLKMFDLNSDGVISLDEFCEVLGLQMKNARMYRRKVQGGLPAEVTVISSSMAEWM-QVIIVETVRRA-SGRFRDERDISNDIKQHLDAEFGKLWQVVIVMGQYFASYSHEPEMSFFFKLGNRVYLIWKTP 197          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000081370.1 (SMESG000081370.1)

HSP 1 Score: 363.999 bits (933), Expect = 3.451e-130
Identity = 174/176 (98.86%), Postives = 176/176 (100.00%), Query Frame = 1
Query:   16 MSGRYNDDDVQMLVELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEFISRLEINDDFYDRPVTHENDVEIISAGNTPFHRQYVMVNIVRRAFKSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTPSM 543
            MSGRYNDDDVQMLVELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEF+SRLEI+DDFYDRPVTHENDVEIISAGNTPFHRQYVMVNIVRRAFKSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTPSM
Sbjct:    1 MSGRYNDDDVQMLVELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEFVSRLEISDDFYDRPVTHENDVEIISAGNTPFHRQYVMVNIVRRAFKSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTPSM 176          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000006807.1 (SMESG000006807.1)

HSP 1 Score: 152.14 bits (383), Expect = 8.881e-47
Identity = 76/165 (46.06%), Postives = 117/165 (70.91%), Query Frame = 1
Query:   52 LVELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEFISRLEINDDF--YDRPVTHENDVEIISAGNTPFHRQYVMVNIVRRAFKSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTPS 540
            ++E+F+EID N    +S+K+L  ++ KR +++ ++E +M+ F+ D + +IS EE+   L+I +D   YD P  H+ D+EII++    FHR++V  NI+RR  +S  ++KKEIA+ VK+ LD Q+ +LWHCV+VKGQYW +YSHEP  S+V K +N +FILFKTP 
Sbjct:    1 MIEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFE-DSNEEISFEEYC--LQIGEDVQDYDYPRAHKQDIEIINSKCLSFHREWVTANIIRRT-QSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPG 161          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000006807.1 (SMESG000006807.1)

HSP 1 Score: 152.525 bits (384), Expect = 9.905e-47
Identity = 76/165 (46.06%), Postives = 117/165 (70.91%), Query Frame = 1
Query:   52 LVELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEFISRLEINDDF--YDRPVTHENDVEIISAGNTPFHRQYVMVNIVRRAFKSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTPS 540
            ++E+F+EID N    +S+K+L  ++ KR +++ ++E +M+ F+ D + +IS EE+   L+I +D   YD P  H+ D+EII++    FHR++V  NI+RR  +S  ++KKEIA+ VK+ LD Q+ +LWHCV+VKGQYW +YSHEP  S+V K +N +FILFKTP 
Sbjct:    6 MIEIFFEIDENEYGSVSKKDLISHLNKRDFNEKEIESFMEVFE-DSNEEISFEEYC--LQIGEDVQDYDYPRAHKQDIEIINSKCLSFHREWVTANIIRRT-QSAYQDKKEIAERVKKALDKQMNELWHCVIVKGQYWAYYSHEPGCSIVLKHQNNIFILFKTPG 166          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000011992.1 (SMESG000011992.1)

HSP 1 Score: 151.369 bits (381), Expect = 1.968e-46
Identity = 74/163 (45.40%), Postives = 113/163 (69.33%), Query Frame = 1
Query:   52 LVELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEFISRLEINDDFYDRPVTHENDVEIISAGNTPFHRQYVMVNIVRRAFKSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTPS 540
             +ELF EIDA+ N  I++ E+++Y+  R +S+ D+E+++  F+  H  +I+  EF + L  ++     P  H++DVEII++  T FH+Q+ + NI+RRAF S  E KKE+A  +K+ +D Q++ +WHCV+V GQYW FYSHE E S+  K+KN +FILFKTPS
Sbjct:    6 FIELFLEIDASRNGVITKNEMKNYLIGREFSNEDIEEFLSLFE--HFEEINYSEFCAILGRDECELQYPTEHDSDVEIINSRITDFHQQWKVTNIIRRAFASAKE-KKEMAAIIKKSMDKQMDPMWHCVIVSGQYWAFYSHEEEGSIAIKYKNLIFILFKTPS 165          
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000020829.1 (SMESG000020829.1)

HSP 1 Score: 150.599 bits (379), Expect = 4.030e-46
Identity = 73/163 (44.79%), Postives = 114/163 (69.94%), Query Frame = 1
Query:   52 LVELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKWMQNFDVDHDGKISLEEFISRLEINDDFYDRPVTHENDVEIISAGNTPFHRQYVMVNIVRRAFKSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGFYSHEPENSVVFKFKNTVFILFKTPS 540
             +ELF EIDA+ N  I++ E+++Y+  R +S+ D+E+++  F+  H  +I+  EF + L  ++     P  H++DVEII++  T FH+Q+ + NI+RRAF S  E KKE+A  +K+ +D Q++ +WHCV+V GQYW FYSHE E S++ K+K+ +FILFKTPS
Sbjct:    6 FIELFLEIDASRNGVITKNEMKNYLIGREFSNEDIEEFLSLFE--HFEEINYSEFCAILGRDECELQYPTEHDSDVEIINSRITDFHQQWKVTNIIRRAFASAKE-KKEMAAIIKKSMDKQMDPMWHCVIVSGQYWAFYSHEEEASIIIKYKDLIFILFKTPS 165          
The following BLAST results are available for this feature:
BLAST of EF-hand domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|P14202|TEGU_SCHMA1.518e-1731.28Tegument antigen OS=Schistosoma mansoni OX=6183 GN... [more]
sp|P32070|SM21_SCHMA5.589e-1022.95Antigen Sm21.7 OS=Schistosoma mansoni OX=6183 GN=S... [more]
sp|Q2QY37|CDPKQ_ORYSJ4.406e-633.33Calcium-dependent protein kinase 26 OS=Oryza sativ... [more]
sp|Q2RAV0|CDPKP_ORYSJ4.406e-633.33Calcium-dependent protein kinase 25 OS=Oryza sativ... [more]
back to top
BLAST of EF-hand domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J0C91.054e-2534.13EF-hand domain-containing protein OS=Macrostomum l... [more]
A0A1I8H6V51.385e-2530.77Dynein light chain OS=Macrostomum lignano OX=28230... [more]
A0A267F2V41.428e-2530.77Dynein light chain (Fragment) OS=Macrostomum ligna... [more]
A0A267GBS02.005e-2533.72EF-hand domain-containing protein OS=Macrostomum l... [more]
A0A1I8GDT52.235e-2536.53Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081370.13.451e-13098.86SMESG000081370.1[more]
SMESG000006807.18.881e-4746.06SMESG000006807.1[more]
SMESG000006807.19.905e-4746.06SMESG000006807.1[more]
SMESG000011992.11.968e-4645.40SMESG000011992.1[more]
SMESG000020829.14.030e-4644.79SMESG000020829.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026808 ID=SMED30026808|Name=EF-hand domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=653bp
TTGTAATAAATTATAATGTCTGGCAGATACAATGATGACGATGTTCAAAT
GTTGGTAGAACTTTTCTATGAAATCGATGCAAATTGCAATAATGAGATTT
CACGAAAAGAATTGCAAGATTACATGAAGAAAAGAGGATATTCAGATAAT
GATGTTGAAAAATGGATGCAAAATTTTGATGTGGATCATGATGGGAAAAT
ATCTTTGGAGGAATTTATCAGTAGATTGGAAATTAACGATGATTTTTATG
ATCGCCCAGTTACTCATGAAAATGATGTAGAAATAATTAGTGCTGGTAAT
ACACCTTTCCATCGTCAATATGTTATGGTGAATATTGTTCGCCGAGCATT
TAAGAGCCATGGTGAAAACAAAAAGGAAATAGCGAAATTTGTTAAAGAAA
AACTTGATTCCCAATTGGAAAAATTGTGGCACTGTGTACTTGTCAAGGGT
CAATATTGGGGGTTCTATTCGCACGAACCAGAAAATAGCGTTGTATTCAA
ATTCAAAAACACCGTCTTTATTTTGTTCAAAACGCCATCAATGTAGCCAA
AAGATGTGTTTAGCCTCAAATAATGATAAATATAATAAATACTAGAAACA
AAACTAATAAATTAACCTTTGAATTTTGTTAAAATATAATATTTTTCAAT
TTT
back to top

protein sequence of SMED30026808-orf-1

>SMED30026808-orf-1 ID=SMED30026808-orf-1|Name=SMED30026808-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=177bp
MSGRYNDDDVQMLVELFYEIDANCNNEISRKELQDYMKKRGYSDNDVEKW
MQNFDVDHDGKISLEEFISRLEINDDFYDRPVTHENDVEIISAGNTPFHR
QYVMVNIVRRAFKSHGENKKEIAKFVKEKLDSQLEKLWHCVLVKGQYWGF
YSHEPENSVVFKFKNTVFILFKTPSM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037177DLC_sf
IPR002048EF_hand_dom
IPR001372Dynein_light_chain_typ-1/2
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 46..74
e-value: 0.0053
score: 26.0
coord: 12..40
e-value: 1.8
score: 15.7
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 15..69
e-value: 1.6E-10
score: 41.3
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 8..41
score: 7.065
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 42..77
score: 12.784
IPR002048EF-hand domainCDDcd00051EFhcoord: 12..68
e-value: 2.3037E-11
score: 54.4761
IPR001372Dynein light chain, type 1/2SMARTSM01375Dynein_light_2coord: 83..173
e-value: 2.0E-8
score: 44.0
IPR001372Dynein light chain, type 1/2PFAMPF01221Dynein_lightcoord: 98..173
e-value: 1.0E-15
score: 57.8
IPR037177Dynein light chain superfamilyGENE3DG3DSA:3.30.740.10coord: 79..174
e-value: 4.8E-14
score: 54.1
IPR037177Dynein light chain superfamilySUPERFAMILYSSF54648DLCcoord: 91..174
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 5..71
e-value: 3.9E-16
score: 60.7
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 55..67
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 5..119