ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30026802
Length (bp)1129
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30026802) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30026802) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30026802) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30026802) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026802

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30026802SMESG000046272.1 SMESG000046261.1 dd_Smed_v4_17861_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30026802SMESG000046272.1 SMESG000046261.1 dd_Smed_v4_17861_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|15772318 (tr|A0A1I8H3U2|A0A1I8H3U2_9PLAT ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014263g2 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.141e-26
Identity = 79/290 (27.24%), Postives = 135/290 (46.55%), Query Frame = 3
Query:  180 SKQLQISHRH-PQSNPSVMRIFNAICKGSWDEVNFSMRFVLFQD-SFYNNQTAAIASLFCQNANKRKMTIKILMKWKFNFSIQDLIFQRDPLHWCCILGIVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPREWSILGHNARNFTKRKL----------KVQFHKNLKTFQIPEIRVENET----------EPKPVDINKIIHSAYIVWANQHVDSFRKLAS 983
            +K L   H H P+ N +    F AI +G   ++ + +R V  +     + +T  +A+L      +R+     L      +   D  ++RD + W   LG   E   I+     +V+   +D  G TY+HLAVMS S   V+II++      +S D+ ++ G TPY+LSRKLG+  IS+ +Q    AS +  D +  +SPREWS++G   R   K++L            +    ++   +P +    ET           P      +++H  + +W+ QH  S+R+ A+
Sbjct:   86 TKMLLRRHAHVPKRNLNAHEFFKAIYQGQLSDILYFLRVVSIRSVDPADGKTPLMAALHIGAEKRRQEVFNYLAHHGAVYDGVDDQYRRDLVGWATALGRHEELRDILRDTTEEVNLQYRDALGLTYMHLAVMSGSLPTVEIIIDEFRRLDVSVDMPDAEGITPYLLSRKLGYTRISQCLQQRGRASAHKSDPVSLRSPREWSVIGRQERLMAKQQLLRYTNRAVLPLTEEESPIEALPVPPVTERGETYAEIRMHLLAPPTSKTSQQLVHDVFDLWSEQHRPSYRRGAA 375          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|15796363 (tr|A0A1I8I474|A0A1I8I474_9PLAT ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 7.825e-26
Identity = 79/290 (27.24%), Postives = 136/290 (46.90%), Query Frame = 3
Query:  180 SKQLQISHRH-PQSNPSVMRIFNAICKGSWDEVNFSMRFVLFQD-SFYNNQTAAIASLFCQNANKRKMTIKILMKWKFNFSIQDLIFQRDPLHWCCILGIVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPREWSILGHNARNFTKRKL----------KVQFHKNLKTFQIP----------EIRVENETEPKPVDINKIIHSAYIVWANQHVDSFRKLAS 983
            +K L   H H P+ N +    F AI +G    + + +R V  +     + +T  +A+L      +R+     L      +   D  ++RD + W   LG   E   I+     +V+   +D  G TY+HLAVMS S   V+II++      +S D+ ++ G TPY+LSRKLG+  IS+ +Q    AS +  D +  +SPREWS++G   R   K++L            +    ++   +P          EIR++    P      +++H  + +W+ QH  S+++ A+
Sbjct:   86 TKMLLRRHAHVPKRNLNAHEFFKAIYQGQLSNILYFLRVVSIRSVDPADGKTPLMAALHIGAEKRRQEVFNYLAHHGAVYDGVDDQYRRDLVGWATALGRHEELRDILRDTTEEVNLQYRDALGLTYMHLAVMSGSLPTVEIIIDEFRRLDVSVDMPDAEGITPYLLSRKLGYTRISQCLQQRGRASAHKSDPVSLRSPREWSVIGRQERLMAKQQLLRYTNRAVLPLTEEESPIEALPVPPVTERGETYAEIRMQLLAPPTSKTSQQLVHDVFDLWSEQHRPSYQRGAA 375          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18200507 (tr|A0A267H7D6|A0A267H7D6_9PLAT ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014263g1 PE=4 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 9.361e-26
Identity = 79/290 (27.24%), Postives = 136/290 (46.90%), Query Frame = 3
Query:  180 SKQLQISHRH-PQSNPSVMRIFNAICKGSWDEVNFSMRFVLFQD-SFYNNQTAAIASLFCQNANKRKMTIKILMKWKFNFSIQDLIFQRDPLHWCCILGIVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPREWSILGHNARNFTKRKL----------KVQFHKNLKTFQIP----------EIRVENETEPKPVDINKIIHSAYIVWANQHVDSFRKLAS 983
            +K L   H H P+ N +    F AI +G    + + +R V  +     + +T  +A+L      +R+     L      +   D  ++RD + W   LG   E   I+     +V+   +D  G TY+HLAVMS S   V+II++      +S D+ ++ G TPY+LSRKLG+  IS+ +Q    AS +  D +  +SPREWS++G   R   K++L            +    ++   +P          EIR++    P      +++H  + +W+ QH  S+++ A+
Sbjct:   86 TKMLLRRHAHVPKRNLNAHEFFKAIYQGQLSNILYFLRVVSIRSVDPADGKTPLMAALHIGAEKRRQEVFNYLAHHGAVYDGVDDQYRRDLVGWATALGRHEELRDILRDTTEEVNLQYRDALGLTYMHLAVMSGSLPTVEIIIDEFRRLDVSVDMPDAEGITPYLLSRKLGYTRISQCLQQRGRASAHKSDPVSLRSPREWSVIGRQERLMAKQQLLRYTNRAVLPLTEEESPIEALPVPPVTERGETYAEIRMQLLAPPTSKTSQQLVHDVFDLWSEQHRPSYQRGAA 375          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17227613 (tr|A0A433THM9|A0A433THM9_ELYCH ANK_REP_REGION domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_011160 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.777e-21
Identity = 57/210 (27.14%), Postives = 115/210 (54.76%), Query Frame = 3
Query:  240 FNAICKGSWDEV--NFSMRFVLFQDSFYNNQTAAIASLFCQNANKRKMTIKILMKWKFNFSIQDLIFQRDPLHWCCILGIVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPREWSILGHNARNFTKRKLKVQFHKNLKTFQI 863
            F A+ KG+ ++V    S    +   + Y   +  +A+L  ++  +R     +L++    +  +D    R  LHW C+LG V + + +++    D++ ++KD +G T LH AV   +  + + +++     G+S D+ + +G TPYI +R+LG+R+++ +++   +ASL   DN+F +SPREWS +G   R   K+ +++  H  +   ++
Sbjct:   63 FQAVIKGNVNKVKHQLSRGHNIHSKNDYG-MSPLVAALHIEDDARRARMFSLLLEKGCPYKSRDTSHDRPVLHWACVLGQVEQVKTLLEETAGDINLSEKDGEGYTALHHAVKIGNLPIAQSLVDYHVRFGVSVDLPDKMGLTPYIHARRLGYRDVAAILREQGLASLGHGDNLF-RSPREWSQIGKFER---KKAIELSIHDQVNAAKV 267          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|15729441 (tr|R7T7D1|R7T7D1_CAPTE ANK_REP_REGION domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_198548 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.898e-20
Identity = 56/172 (32.56%), Postives = 90/172 (52.33%), Query Frame = 3
Query:  342 SLFCQNANKRKMTIKILMKWKFNFSIQDLIFQRDPLHWCCILGIVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPREWSILGHNARNFTKRKLKVQFHKNLKTF 857
            +L  ++A  R   ++ L+    + S +D + +R+ L W C L  + E  +I+     ++D + KD DG T LH AV     +L + I  ++   G S D+ +  GFTPY+L+RKLGH + ++++ S  +AS   FD   YK  R W  +G   R+  +R  K Q   N KT 
Sbjct:  128 ALEIEDAQLRLQMVRFLILRDIHLSDRDRLHRRNALMWACFLRRLPEARLIMRKGRNEIDLSDKDSDGKTVLHYAVGHRDVDLTREISRSLLHRGYSVDVPDQDGFTPYLLARKLGHEDCADVLVSDGMASTCQFDQKAYKMARIWEEIGQQERSRKERASKEQKVANFKTL 299          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO32732 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU83])

HSP 1 Score: 58.5362 bits (140), Expect = 8.803e-10
Identity = 37/132 (28.03%), Postives = 66/132 (50.00%), Query Frame = 3
Query:  318 NNQTAAIASLFCQNANKRKMTIKILMKWKFNFSIQDLIFQRDPLHWCCILGIVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELI 713
            + +TA I ++F +NA  R++++K+L+ +     I D    R  L W C  G      +       D+D    D  GNT L LA MS + ++V +I  A   N    +  N+ G +   L R+LG++++ +++
Sbjct:   67 SGETALIRAVFLENAKLRRISLKMLVNYGAKVKITDKT-GRSALSWACYHGREDVLRIFQGNPQLDLDLGSIDNQGNTNLILACMSGNAKIVTLIARAFRRNRFDVNRRNNAGESAMSLVRQLGYKDLVDVL 197          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO41179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S546])

HSP 1 Score: 51.9878 bits (123), Expect = 1.982e-7
Identity = 38/143 (26.57%), Postives = 72/143 (50.35%), Query Frame = 3
Query:  348 FCQNANKRKMTIKILMKWKFNFSIQDLIFQRDPLHWCCILGIVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPRE 776
            F  N +K     K+L++   N  I+D    +  L + CIL      + +  +++ D++ T  D+DGNT L+ A+++    +V  ++  +   G++ D  N  G TP I + K    +I++++     ASL V+D+   K+  E
Sbjct:   42 FVDNEDKACSMAKLLLENGGNVGIKDK-QGKTALSYACILKKKKLLKWLTRFVDYDLNST--DLDGNTALNYAILAGDETVVMELVRKLKAYGLTVDTINRKGETPLINALKSERTDIADILLEIGKASLQVWDSETGKTASE 181          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO32718 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU82])

HSP 1 Score: 47.3654 bits (111), Expect = 1.745e-6
Identity = 29/91 (31.87%), Postives = 47/91 (51.65%), Query Frame = 3
Query:  321 NQTAAIASLFCQNANKRKMTIKILMKWKFNFSIQDLIFQRDPLHWCCILGIVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELV 593
             +TA +   F +N   R+  +K+L+      + +D +  R  L W C+ G+V     +V+   ++VD    D DGNT L LAV S + E+V
Sbjct:   32 GRTALVYCCFLKNPQTRQTILKLLLASGAKVNKRDHL-GRSALLWACLQGLVDVVTSLVNDSQSEVDLNLTDNDGNTSLLLAVKSGNLEMV 121          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO34178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ28])

HSP 1 Score: 48.521 bits (114), Expect = 3.421e-6
Identity = 40/136 (29.41%), Postives = 67/136 (49.26%), Query Frame = 3
Query:  492 IVDYLNADV-DYTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPREWSILGHNARNFTKRKLKVQFHKNLKTFQIPEIRVENETEP 896
            IVD+L  +  D    +++GNT LH A  +   E+ K++L +     I   I NS G TP  L+++ GH E  EL++      L   D++      +W +  + A +FT   +++    ++KT  +P  R   ET P
Sbjct:  592 IVDFLAQNGNDANVVNMEGNTPLHFAGQAGKTEVAKVLLRSGAAESIH--IENSNGKTPVQLAKESGHSETLELLRKCAKGKLTFCDHVKI----DWGL--NQADDFTDDVIEL---TDIKTTPVPP-RTTGETVP 715          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000046272.1 (SMESG000046272.1)

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 345/347 (99.42%), Postives = 345/347 (99.42%), Query Frame = 3
Query:   18 MILSKKIDEKVIYLKLSLLNEDSLYQDGFIKSNSSIYLPRVDCGSPNDSQDKSLSKQLQISHRHPQSNPSVMRIFNAICKGSWDEVNFSMRFVLFQDSFYNNQTAAIASLFCQNANKRKMTIKILMKWKFNFSIQDLIFQRDPLHWCCILGIVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPREWSILGHNARNFTKRKLKVQFHKNLKTFQIPEIRVENETEPKPVDINKIIHSAYIVWANQHVDSFRKLASYKEPAIIXXXXXXXXXXXXXXSRVK 1058
            MILSKKIDEKVIYLKLSLLNEDSLYQDGFIKSNSSIYLPRVDCGSPNDSQDKS SKQLQISHRHPQSNPSVMRIFNAICKGSWDEVNFSMRFVLFQDSFYNNQTAAIASLFCQNANKRKMTIKILMKWKFNFSIQDLIFQRDPLHWCCIL IVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPREWSILGHNARNFTKRKLKVQFHKNLKTFQIPEIRVENETEPKPVDINKIIHSAYIVWANQHVDSFRKLASYKEPAIIKPKLVVPLPPVHKKSRVK
Sbjct:    1 MILSKKIDEKVIYLKLSLLNEDSLYQDGFIKSNSSIYLPRVDCGSPNDSQDKSESKQLQISHRHPQSNPSVMRIFNAICKGSWDEVNFSMRFVLFQDSFYNNQTAAIASLFCQNANKRKMTIKILMKWKFNFSIQDLIFQRDPLHWCCILSIVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPREWSILGHNARNFTKRKLKVQFHKNLKTFQIPEIRVENETEPKPVDINKIIHSAYIVWANQHVDSFRKLASYKEPAIIKPKLVVPLPPVHKKSRVK 347          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000046261.1 (SMESG000046261.1)

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 345/347 (99.42%), Postives = 345/347 (99.42%), Query Frame = 3
Query:   18 MILSKKIDEKVIYLKLSLLNEDSLYQDGFIKSNSSIYLPRVDCGSPNDSQDKSLSKQLQISHRHPQSNPSVMRIFNAICKGSWDEVNFSMRFVLFQDSFYNNQTAAIASLFCQNANKRKMTIKILMKWKFNFSIQDLIFQRDPLHWCCILGIVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPREWSILGHNARNFTKRKLKVQFHKNLKTFQIPEIRVENETEPKPVDINKIIHSAYIVWANQHVDSFRKLASYKEPAIIXXXXXXXXXXXXXXSRVK 1058
            MILSKKIDEKVIYLKLSLLNEDSLYQDGFIKSNSSIYLPRVDCGSPNDSQDKS SKQLQISHRHPQSNPSVMRIFNAICKGSWDEVNFSMRFVLFQDSFYNNQTAAIASLFCQNANKRKMTIKILMKWKFNFSIQDLIFQRDPLHWCCIL IVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPREWSILGHNARNFTKRKLKVQFHKNLKTFQIPEIRVENETEPKPVDINKIIHSAYIVWANQHVDSFRKLASYKEPAIIKPKLVVPLPPVHKKSRVK
Sbjct:    1 MILSKKIDEKVIYLKLSLLNEDSLYQDGFIKSNSSIYLPRVDCGSPNDSQDKSESKQLQISHRHPQSNPSVMRIFNAICKGSWDEVNFSMRFVLFQDSFYNNQTAAIASLFCQNANKRKMTIKILMKWKFNFSIQDLIFQRDPLHWCCILSIVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPREWSILGHNARNFTKRKLKVQFHKNLKTFQIPEIRVENETEPKPVDINKIIHSAYIVWANQHVDSFRKLASYKEPAIIKPKLVVPLPPVHKKSRVK 347          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000016882.1 (SMESG000016882.1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.987e-11
Identity = 31/100 (31.00%), Postives = 56/100 (56.00%), Query Frame = 3
Query:  417 IQDLIFQRDPLHWCCILGIVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQ 716
            I D  F+RD + W     +  +   ++   N  ++Y   D DGNTYLHLAV + +  +V++I   M    ++ + SN +GF+P +L+  LG  +I+++ +
Sbjct:   77 ISDQNFKRDTIAWVTFWKLERQLRFLLKTFNGFINYYTDDRDGNTYLHLAVETGNIRIVRMIAERMFQLNLNMNKSNKIGFSPNLLAYYLGFLDITKMFE 176          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000011793.1 (SMESG000011793.1)

HSP 1 Score: 48.1358 bits (113), Expect = 6.164e-6
Identity = 24/86 (27.91%), Postives = 46/86 (53.49%), Query Frame = 3
Query:  522 YTKKDIDGNTYLHLAVMSNSWELVKIILNAMTINGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKSPREW 779
            Y++ D+DG + LH A +  +  +++ ++N      I+ +IS+++ FTP +L+ K        LI        NV DN ++++  EW
Sbjct:  127 YSQTDVDGYSILHYAAVRENLAMLEYLINLFISFNITTEISSNMNFTPLLLACKFSKYRSVALIIKMGGKYFNVRDNEYFRNSVEW 212          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157723181.141e-2627.24tr|A0A1I8H3U2|A0A1I8H3U2_9PLAT ANK_REP_REGION doma... [more]
gnl|BL_ORD_ID|157963637.825e-2627.24tr|A0A1I8I474|A0A1I8I474_9PLAT ANK_REP_REGION doma... [more]
gnl|BL_ORD_ID|182005079.361e-2627.24tr|A0A267H7D6|A0A267H7D6_9PLAT ANK_REP_REGION doma... [more]
gnl|BL_ORD_ID|172276131.777e-2127.14tr|A0A433THM9|A0A433THM9_ELYCH ANK_REP_REGION doma... [more]
gnl|BL_ORD_ID|157294413.898e-2032.56tr|R7T7D1|R7T7D1_CAPTE ANK_REP_REGION domain-conta... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO327328.803e-1028.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411791.982e-726.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327181.745e-631.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341783.421e-629.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000046272.10.000e+099.42SMESG000046272.1[more]
SMESG000046261.10.000e+099.42SMESG000046261.1[more]
SMESG000016882.12.987e-1131.00SMESG000016882.1[more]
SMESG000011793.16.164e-627.91SMESG000011793.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026802 ID=SMED30026802|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1129bp
CCAGTTTTATTTTTTAGATGATTCTTTCAAAGAAAATTGATGAAAAAGTT
ATTTATTTAAAACTCTCCCTTCTCAACGAAGATTCTTTGTACCAAGATGG
ATTTATTAAAAGTAATTCTAGCATATATTTGCCCCGAGTTGATTGTGGAT
CACCAAATGATTCCCAAGATAAATCATTAAGTAAGCAACTGCAAATCTCC
CATCGTCATCCTCAAAGCAATCCGTCAGTCATGAGAATATTCAACGCCAT
ATGTAAGGGTAGTTGGGATGAAGTCAACTTCTCTATGAGATTCGTTTTGT
TTCAAGATTCGTTCTATAACAACCAAACTGCAGCGATTGCTAGTTTGTTT
TGTCAGAATGCGAATAAACGAAAAATGACAATCAAAATTTTGATGAAATG
GAAGTTTAATTTTTCAATTCAGGATTTAATTTTCCAACGAGATCCCTTAC
ATTGGTGTTGTATTCTAGGCATTGTGATGGAGTTCGAGATGATTGTGGAC
TATCTTAATGCCGATGTTGACTACACGAAAAAAGACATAGATGGAAACAC
ATATTTACATTTAGCAGTCATGTCCAATAGTTGGGAGCTTGTAAAAATAA
TATTAAATGCAATGACAATAAATGGAATTAGCGGTGACATAAGCAATTCC
TTGGGATTTACACCTTATATTTTGTCAAGAAAGCTCGGACATAGAGAAAT
ATCGGAATTAATTCAATCTACTAACATTGCGTCTCTAAACGTCTTCGATA
ATATGTTCTACAAATCACCGAGAGAATGGTCAATTCTCGGACACAACGCA
AGGAACTTTACAAAGAGAAAGTTAAAGGTCCAATTTCACAAAAATCTTAA
AACATTTCAAATTCCAGAAATACGAGTGGAAAATGAGACAGAACCGAAAC
CTGTGGATATTAATAAAATAATTCACTCAGCATATATCGTATGGGCAAAT
CAACATGTGGATTCCTTTAGGAAGTTAGCAAGCTATAAAGAACCAGCAAT
CATTAAACCTAAACTAGTTGTCCCTTTACCTCCAGTACACAAAAAATCTC
GGGTAAAATGATTAAAGTTTCGAAGTGATTATATTTTATATATTAATAAT
TATTTATTGAACTGGCAATAATTTTTCAA
back to top

protein sequence of SMED30026802-orf-1

>SMED30026802-orf-1 ID=SMED30026802-orf-1|Name=SMED30026802-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=348bp
MILSKKIDEKVIYLKLSLLNEDSLYQDGFIKSNSSIYLPRVDCGSPNDSQ
DKSLSKQLQISHRHPQSNPSVMRIFNAICKGSWDEVNFSMRFVLFQDSFY
NNQTAAIASLFCQNANKRKMTIKILMKWKFNFSIQDLIFQRDPLHWCCIL
GIVMEFEMIVDYLNADVDYTKKDIDGNTYLHLAVMSNSWELVKIILNAMT
INGISGDISNSLGFTPYILSRKLGHREISELIQSTNIASLNVFDNMFYKS
PREWSILGHNARNFTKRKLKVQFHKNLKTFQIPEIRVENETEPKPVDINK
IIHSAYIVWANQHVDSFRKLASYKEPAIIKPKLVVPLPPVHKKSRVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR020683Ankyrin_rpt-contain_dom
IPR002110Ankyrin_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 51..278
e-value: 2.4E-13
score: 51.8
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 102..235
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 122..232
score: 10.843
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 175..197
score: 8.549