Cilia-and flagella-associated protein 58

Overview
NameCilia-and flagella-associated protein 58
Smed IDSMED30026782
Uniprot Best hitCilia- and flagella-associated protein 58 OS=Mus musculus OX=10090 GN=Cfap58 PE=2 SV=1 (E=0)
Length (bp)2808
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cilia-and flagella-associated protein 58 (SMED30026782) t-SNE clustered cells

Violin plots show distribution of expression levels for Cilia-and flagella-associated protein 58 (SMED30026782) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cilia-and flagella-associated protein 58 (SMED30026782) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cilia-and flagella-associated protein 58 (SMED30026782) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026782

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026782SMESG000061980.1 SmedASXL_009012SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30026782SMESG000061980.1 dd_Smed_v4_5727_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30026782SMESG000061980.1 dd_Smed_v4_5727_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026782SMESG000061980.1 dd_Smed_v4_5727_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026782SMESG000061980.1 dd_Smed_v4_5727_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30026782SMESG000061980.1 dd_Smed_v4_5727_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026782SMESG000061980.1 dd_Smed_v6_5727_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30026782SMESG000061980.1 dd_Smed_v6_5727_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026782SMESG000061980.1 dd_Smed_v4_5727_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30026782SMESG000061980.1 dd_Smed_v4_5727_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30026782SMESG000061980.1 dd_Smed_v4_5727_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Human
Match: CFAP58 (cilia and flagella associated protein 58 [Source:HGNC Symbol;Acc:HGNC:26676])

HSP 1 Score: 810.831 bits (2093), Expect = 0.000e+0
Identity = 501/850 (58.94%), Postives = 658/850 (77.41%), Query Frame = 2
Query:   98 AIDDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQR---QHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRES 2638
             +++SAFE +E+DFQ +LH+L G+  L+KFR EYE++   + KS+D+EKRLM KCREL AEIV NS+KVATA+KLSQ+DQ TI+SLKKEIEKAWKMVDSA +KE KA+ETI +LK EI NLTKLVEQG+GLS  Q  ++ DLL+ K+ +TKERD  ++E  KLR+    +  +  + E    E ++ I+    EIQ R  EA RE +KKEK+EK+LK  +A++++R  EIK L   + K K+EL+  +++L   K   E   +   Q  + +AKL   Q + +    V   L QENQ + LELK +E+EV  ++ D+ KL+K++E  +KKL   EDQKA+V++ +E LK++I  L  E++  +K+ E D++  +EL +ERD LN+ + KA + T KQ +LVK+HE +K+NLE EI NYK+EAQKQRKIIF LEKERDRYIN+ASDLTQKVL +MED+K+RE QIFDY+KKI E E KL+QQQNLYEAVR+DRN YSKNL+EAQDEIT+MKRKLKIM HQ+D+L+++IS KE+ LVK   E+Q++EKEK+ L +ELQ+LR QA E K +IE QEAEE+KL +II EAD ER+RQKKEL+QVISERDILG+QLVR+NDEL+LLYEKIKIQQS+LNKGE QYNQRL+D+R+L+LEIKKLRREK IL +S+ANV++L++E +H+QRELL+ERTRC+ALEEELENP+NVHRWRKL               E SDP+ +E+IQKI TLQKRLI+KTEEVVEKE+L+QEKEKLY+ELKH+LARQPGPE AEQL +Y+ TL  K +QLK L SE NMYE Q KE+K+E+EKL  E Q++K+KY  QK++E++ K++++
Sbjct:   10 VLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKEIEKAWKMVDSAYDKEQKAKETILALKEEIVNLTKLVEQGSGLSMDQHSNIRDLLRFKEEVTKERDQLLSEVVKLRESLAQTTEQQQETERSKEEAEHAISQFQQEIQQRQNEASREFRKKEKLEKELKQIQADMDSRQTEIKALQQYVQKSKEELQKLEQQLKEQKILNERAAKELEQFQMRNAKL---QQENEQHSLVCEQLSQENQQKALELKAKEEEVHQMRLDIGKLNKIREQIHKKLHHTEDQKAEVEQHKETLKNQIVGLEREVEASKKQAELDRKAMDELLRERDILNKNMLKAVNATQKQTDLVKLHEQAKRNLEGEIQNYKDEAQKQRKIIFHLEKERDRYINQASDLTQKVLMNMEDIKVRETQIFDYRKKIAESEIKLKQQQNLYEAVRSDRNLYSKNLVEAQDEITDMKRKLKIMIHQVDELKEDISAKESALVKLHLEQQRIEKEKETLKAELQKLRQQALETKHFIEKQEAEERKLLRIIAEADGERLRQKKELDQVISERDILGSQLVRRNDELALLYEKIKIQQSVLNKGESQYNQRLEDMRILRLEIKKLRREKGILARSMANVEELRQEFFHMQRELLKERTRCRALEEELENPLNVHRWRKL---------------EASDPNAYELIQKIHTLQKRLISKTEEVVEKELLLQEKEKLYMELKHVLARQPGPEAAEQLKLYRRTLHDKKQQLKVLSSELNMYEVQSKEYKYEVEKLTNELQNLKKKYLAQKRKEQLQKNKDT 841          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Human
Match: CFAP58 (cilia and flagella associated protein 58 [Source:HGNC Symbol;Acc:HGNC:26676])

HSP 1 Score: 103.99 bits (258), Expect = 5.426e-26
Identity = 53/78 (67.95%), Postives = 64/78 (82.05%), Query Frame = 2
Query: 1205 CEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKV 1438
             +EL +ERD LN+ + KA + T KQ +LVK+HE +K+NLE EI NYK+EAQKQRKIIF LEKERDRYIN+ASDLTQK 
Sbjct:    1 MDELLRERDILNKNMLKAVNATQKQTDLVKLHEQAKRNLEGEIQNYKDEAQKQRKIIFHLEKERDRYINQASDLTQKA 78          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Human
Match: CCDC146 (coiled-coil domain containing 146 [Source:HGNC Symbol;Acc:HGNC:29296])

HSP 1 Score: 74.3294 bits (181), Expect = 8.495e-13
Identity = 82/319 (25.71%), Postives = 169/319 (52.98%), Query Frame = 2
Query: 1430 QKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKL 2386
            QK    ++++K ++++I  +KKK  E+  +LR+   LY+ +R +RN++   L +A  ++ E+K + K+  ++++ LR+   ++E  L     +       ++ + ++++++ S+  E K   EAQ     +L   I   + E V+ +K  E+ +  R+  G QL+ + +E+ + YEKI IQ+ +   GE++ +   + I+ LK++I + +R+  + QK +     L  ++  LQ +  +   R K LE++   P   +R R              +LP G D +  EMIQK+  L+ +L  K E+++EK+ + ++  +L
Sbjct:  481 QKYTNIVKEMKAKDLEIRIHKKKKCEIYRRLREFAKLYDTIRNERNKFVNLLHKAHQKVNEIKERHKMSLNELEILRNSAVSQERKLQNSMLKHANNVTIRESMQNDVRKIVSKLQEMKEKKEAQLNNIDRLANTITMIEEEMVQLRKRYEKAVQHRNESGVQLIEREEEICIFYEKINIQEKMKLNGEIEIHLLEEKIQFLKMKIAEKQRQICVTQKLLPAKRSLDADLAVLQIQFSQCTDRIKDLEKQFVKPDGENRAR--------------FLP-GKDLTEKEMIQKLDKLELQLAKKEEKLLEKDFIYEQVSRL 784          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Human
Match: LAMA2 (laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:6482])

HSP 1 Score: 68.9366 bits (167), Expect = 4.778e-11
Identity = 100/467 (21.41%), Postives = 200/467 (42.83%), Query Frame = 2
Query:  188 RDE-YEKIMRALNKSHDSE-KRLMQKCRELKAEIVSNSSKVATAV----------------KLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQ-KQELKIKD-----EELSRFKSDFEHTQRQHAITDAKLRDQQTK---------LDSQVQVTNSLFQENQNRMLELKNR--------EDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKI 1465
            RDE +E+ +  L K  D   K L +K  E + EI  +    A A+                ++ ++ +  ++  K +++ AW ++  AT+   K RE  +   +   N+T L ++   + SG+   + + LK  + +  E +    E   + D  ED + ++  +  ++    +KI DL+ EI+ R   A++  + +    +   S+ A ++   +E KN++ +     K    IKD     E++++   D  H   + A     L  +  K         L+   ++ N + +EN++ +  LK R         D +  L + + KLS +   T  KL++V+D+    +   + + ++I+ L+  LD ++K          +L       N ++K  S  T      V   + + KNLEQE     +    + K I +LE    + I+E  +L  +  +    +K+
Sbjct: 1706 RDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYKNKVDDAWDLLREATD---KIREANRLFAVNQKNMTALEKKKEAVESGKR-QIENTLKEGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEEL---NDKIDDLSQEIKDRKL-AEKVSQAESHAAQLNDSS-AVLDGILDEAKNISFNATAAFKAYSNIKDYIDEAEKVAKEAKDLAHEATKLATGPRGLLKEDAKGCLQKSFRILNEAKKLANDV-KENEDHLNGLKTRIENADARNGDLLRTLNDTLGKLSAIPNDTAAKLQAVKDKARQANDTAKDVLAQITELHQNLDGLKKNY-------NKLADSVAKTNAVVKDPSKNT------VADADATVKNLEQE----ADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKV 2145          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Human
Match: LAMA2 (laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:6482])

HSP 1 Score: 68.1662 bits (165), Expect = 9.558e-11
Identity = 98/467 (20.99%), Postives = 201/467 (43.04%), Query Frame = 2
Query:  188 RDE-YEKIMRALNKSHDSE-KRLMQKCRELKAEIVSNSSKVATAV----------------KLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQ-KQELKIKD-----EELSRFKSDFEHTQRQHAITDAKLRDQQTK---------LDSQVQVTNSLFQENQNRMLELKNR--------EDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKI 1465
            RDE +E+ +  L K  D   K L +K  E + EI  +    A A+                ++ ++ +  ++  K +++ AW ++  AT+   K RE  +   +   N+T L ++   + SG+   + + LK  + +  E +    E   + D  ED + ++  +  ++    +KI DL+ EI+ R   A++  + +    +   S+ A ++   +E KN++ +     K    IKD     E++++   D  H   + A     L  +  K         L+   ++ N + +EN++ +  LK R         D +  L + + KLS +   T  KL++V+D+    +   + + ++I+ L+  LD ++K          +L       N ++K  S       +++   + + KNLEQE     +    + K I +LE    + I+E  +L  +  +    +K+
Sbjct: 1706 RDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAEDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYKNKVDDAWDLLREATD---KIREANRLFAVNQKNMTALEKKKEAVESGKR-QIENTLKEGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEEL---NDKIDDLSQEIKDRKL-AEKVSQAESHAAQLNDSS-AVLDGILDEAKNISFNATAAFKAYSNIKDYIDEAEKVAKEAKDLAHEATKLATGPRGLLKEDAKGCLQKSFRILNEAKKLANDV-KENEDHLNGLKTRIENADARNGDLLRTLNDTLGKLSAIPNDTAAKLQAVKDKARQANDTAKDVLAQITELHQNLDGLKKNY-------NKLADSVAKTNAVVKDPSKN-----KIIADADATVKNLEQE----ADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKV 2146          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Celegans
Match: epi-1 (Laminin-like protein epi-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21313])

HSP 1 Score: 61.6178 bits (148), Expect = 2.938e-9
Identity = 69/324 (21.30%), Postives = 152/324 (46.91%), Query Frame = 2
Query:  779 EEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKL-DSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKR----------------KCEELTKERDNLNRLLKKASDQTNKQVELVKMHET---SKKNLEQEILNYKEEAQKQRKIIFQLEKERDR-YINEASD----LTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKI-MNHQIDQLRDEIS 1672
            E+ + +   +++ +++++ + E+L + K  FE  +++     A L   Q  L +S+ +   S    N  +ML+L   E+ V  + +D++++   K    K   ++ +   ++  +RE++   ++ LN   +++ +  E  K+                K  EL  +   L +      D T++ VE          + KN + +I N  E    +      ++  RD+ + +E  +    L++ V Q +++ +  + Q+    +++ EL  KLR+++   EAV+A   +YSKN +++ DE  +   KLK  ++  I++ R +IS
Sbjct: 2289 EKAQTVPGKLEEIQKKIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQQLLKESKSKADKS---NNIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDKREEMTHAVTTLNETRNDVAEALEAAKKRVRRDEKSVDMQLVNAKAHELHLQATTLRQTFDNNKDNTDQAVEAANAFSNLTDTLKNAKAQIDNAYEALSAEPAFAESVQNARDKPFPDETKEKIDALSKTVSQDLKETEKLKKQL----EQLTELSEKLRKRK---EAVKAGIPKYSKNTLDSIDEKVQEVEKLKAEIDANIEETRAKIS 2602          

HSP 2 Score: 58.151 bits (139), Expect = 3.766e-8
Identity = 104/506 (20.55%), Postives = 213/506 (42.09%), Query Frame = 2
Query:  278 EIVSNSSKVATA-VKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLK---LEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKL--ENDIAEGQNKIAD-----LNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAE------------IEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQ--HAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEIS---------------RLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVK--MHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDR---YINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLR 1660
            +I++NS+++    V+     QN++SS K       + +    ++  +AR++++SL    L I + +K V     L    E ++  L  A      E+    T   KL ++ +  +    KL  + +  E Q K A+     LNS  Q    E++ +  K   + K L+ TK E            +EA   E + L V+I    + LK K EE++   +    T+     A+  AK R ++ +    +Q+ N+   E   +   L+   D     K++  +  +   A +    ++++ KA +D   E L +E +                   ++D + K   +D ++ E+L K+ + L  L    S++  K+ E VK  + + SK  L+      +E  + + +I   +E+ R +      +A ++T+K    ME +++         K    + +K  + + L  A  A  +  S       D+++++K  + +     ++++
Sbjct: 2194 DILTNSTQIQNKLVRTKTHSQNSVSSAKNITLNGTEFLQEVMKRAQRARQSVRSLAEIALAIGSSSKAVNVDPRLLKEAEETLMTLEAASADQYPEK--AQTVPGKLEEIQKKIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQQLLK-ESKSKADKSNNIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDKREEMTHAVTTLNETRNDVAEALEAAKKRVRRDEKSVDMQLVNAKAHELHLQATTLRQTFDNN---KDNTDQAVEAANAFSNLTDTLKNAKAQIDNAYEALSAEPAFAESVQNARDKPFPDETKEKIDALSKTVSQDLKETEKLKKQLEQLTEL----SEKLRKRKEAVKAGIPKYSKNTLDSIDEKVQEVEKLKAEIDANIEETRAKISEIAGKAEEITEKANSAMEGIRLARRNSVQLNKLAPVIVSKFEELKKLSSARSAKVDSVS-------DKVSQIKEMIAVARDAANRIK 2682          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Celegans
Match: epi-1 (Laminin-like protein epi-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21313])

HSP 1 Score: 61.6178 bits (148), Expect = 2.940e-9
Identity = 69/324 (21.30%), Postives = 152/324 (46.91%), Query Frame = 2
Query:  779 EEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKL-DSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKR----------------KCEELTKERDNLNRLLKKASDQTNKQVELVKMHET---SKKNLEQEILNYKEEAQKQRKIIFQLEKERDR-YINEASD----LTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKI-MNHQIDQLRDEIS 1672
            E+ + +   +++ +++++ + E+L + K  FE  +++     A L   Q  L +S+ +   S    N  +ML+L   E+ V  + +D++++   K    K   ++ +   ++  +RE++   ++ LN   +++ +  E  K+                K  EL  +   L +      D T++ VE          + KN + +I N  E    +      ++  RD+ + +E  +    L++ V Q +++ +  + Q+    +++ EL  KLR+++   EAV+A   +YSKN +++ DE  +   KLK  ++  I++ R +IS
Sbjct: 2289 EKAQTVPGKLEEIQKKIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQQLLKESKSKADKS---NNIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDKREEMTHAVTTLNETRNDVAEALEAAKKRVRRDEKSVDMQLVNAKAHELHLQATTLRQTFDNNKDNTDQAVEAANAFSNLTDTLKNAKAQIDNAYEALSAEPAFAESVQNARDKPFPDETKEKIDALSKTVSQDLKETEKLKKQL----EQLTELSEKLRKRK---EAVKAGIPKYSKNTLDSIDEKVQEVEKLKAEIDANIEETRAKIS 2602          

HSP 2 Score: 58.151 bits (139), Expect = 3.800e-8
Identity = 104/506 (20.55%), Postives = 213/506 (42.09%), Query Frame = 2
Query:  278 EIVSNSSKVATA-VKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLK---LEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKL--ENDIAEGQNKIAD-----LNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAE------------IEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQ--HAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEIS---------------RLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVK--MHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDR---YINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLR 1660
            +I++NS+++    V+     QN++SS K       + +    ++  +AR++++SL    L I + +K V     L    E ++  L  A      E+    T   KL ++ +  +    KL  + +  E Q K A+     LNS  Q    E++ +  K   + K L+ TK E            +EA   E + L V+I    + LK K EE++   +    T+     A+  AK R ++ +    +Q+ N+   E   +   L+   D     K++  +  +   A +    ++++ KA +D   E L +E +                   ++D + K   +D ++ E+L K+ + L  L    S++  K+ E VK  + + SK  L+      +E  + + +I   +E+ R +      +A ++T+K    ME +++         K    + +K  + + L  A  A  +  S       D+++++K  + +     ++++
Sbjct: 2194 DILTNSTQIQNKLVRTKTHSQNSVSSAKNITLNGTEFLQEVMKRAQRARQSVRSLAEIALAIGSSSKAVNVDPRLLKEAEETLMTLEAASADQYPEK--AQTVPGKLEEIQKKIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQQLLK-ESKSKADKSNNIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDKREEMTHAVTTLNETRNDVAEALEAAKKRVRRDEKSVDMQLVNAKAHELHLQATTLRQTFDNN---KDNTDQAVEAANAFSNLTDTLKNAKAQIDNAYEALSAEPAFAESVQNARDKPFPDETKEKIDALSKTVSQDLKETEKLKKQLEQLTEL----SEKLRKRKEAVKAGIPKYSKNTLDSIDEKVQEVEKLKAEIDANIEETRAKISEIAGKAEEITEKANSAMEGIRLARRNSVQLNKLAPVIVSKFEELKKLSSARSAKVDSVS-------DKVSQIKEMIAVARDAANRIK 2682          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Celegans
Match: epi-1 (Laminin-like protein epi-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21313])

HSP 1 Score: 61.6178 bits (148), Expect = 2.989e-9
Identity = 69/324 (21.30%), Postives = 152/324 (46.91%), Query Frame = 2
Query:  779 EEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKL-DSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKR----------------KCEELTKERDNLNRLLKKASDQTNKQVELVKMHET---SKKNLEQEILNYKEEAQKQRKIIFQLEKERDR-YINEASD----LTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKI-MNHQIDQLRDEIS 1672
            E+ + +   +++ +++++ + E+L + K  FE  +++     A L   Q  L +S+ +   S    N  +ML+L   E+ V  + +D++++   K    K   ++ +   ++  +RE++   ++ LN   +++ +  E  K+                K  EL  +   L +      D T++ VE          + KN + +I N  E    +      ++  RD+ + +E  +    L++ V Q +++ +  + Q+    +++ EL  KLR+++   EAV+A   +YSKN +++ DE  +   KLK  ++  I++ R +IS
Sbjct: 2298 EKAQTVPGKLEEIQKKIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQQLLKESKSKADKS---NNIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDKREEMTHAVTTLNETRNDVAEALEAAKKRVRRDEKSVDMQLVNAKAHELHLQATTLRQTFDNNKDNTDQAVEAANAFSNLTDTLKNAKAQIDNAYEALSAEPAFAESVQNARDKPFPDETKEKIDALSKTVSQDLKETEKLKKQL----EQLTELSEKLRKRK---EAVKAGIPKYSKNTLDSIDEKVQEVEKLKAEIDANIEETRAKIS 2611          

HSP 2 Score: 58.151 bits (139), Expect = 3.929e-8
Identity = 104/506 (20.55%), Postives = 213/506 (42.09%), Query Frame = 2
Query:  278 EIVSNSSKVATA-VKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLK---LEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKL--ENDIAEGQNKIAD-----LNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAE------------IEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQ--HAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEIS---------------RLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVK--MHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDR---YINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLR 1660
            +I++NS+++    V+     QN++SS K       + +    ++  +AR++++SL    L I + +K V     L    E ++  L  A      E+    T   KL ++ +  +    KL  + +  E Q K A+     LNS  Q    E++ +  K   + K L+ TK E            +EA   E + L V+I    + LK K EE++   +    T+     A+  AK R ++ +    +Q+ N+   E   +   L+   D     K++  +  +   A +    ++++ KA +D   E L +E +                   ++D + K   +D ++ E+L K+ + L  L    S++  K+ E VK  + + SK  L+      +E  + + +I   +E+ R +      +A ++T+K    ME +++         K    + +K  + + L  A  A  +  S       D+++++K  + +     ++++
Sbjct: 2203 DILTNSTQIQNKLVRTKTHSQNSVSSAKNITLNGTEFLQEVMKRAQRARQSVRSLAEIALAIGSSSKAVNVDPRLLKEAEETLMTLEAASADQYPEK--AQTVPGKLEEIQKKIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQQLLK-ESKSKADKSNNIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDKREEMTHAVTTLNETRNDVAEALEAAKKRVRRDEKSVDMQLVNAKAHELHLQATTLRQTFDNN---KDNTDQAVEAANAFSNLTDTLKNAKAQIDNAYEALSAEPAFAESVQNARDKPFPDETKEKIDALSKTVSQDLKETEKLKKQLEQLTEL----SEKLRKRKEAVKAGIPKYSKNTLDSIDEKVQEVEKLKAEIDANIEETRAKISEIAGKAEEITEKANSAMEGIRLARRNSVQLNKLAPVIVSKFEELKKLSSARSAKVDSVS-------DKVSQIKEMIAVARDAANRIK 2691          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Celegans
Match: epi-1 (Laminin-like protein epi-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21313])

HSP 1 Score: 61.6178 bits (148), Expect = 3.040e-9
Identity = 69/324 (21.30%), Postives = 152/324 (46.91%), Query Frame = 2
Query:  779 EEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKL-DSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKR----------------KCEELTKERDNLNRLLKKASDQTNKQVELVKMHET---SKKNLEQEILNYKEEAQKQRKIIFQLEKERDR-YINEASD----LTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKI-MNHQIDQLRDEIS 1672
            E+ + +   +++ +++++ + E+L + K  FE  +++     A L   Q  L +S+ +   S    N  +ML+L   E+ V  + +D++++   K    K   ++ +   ++  +RE++   ++ LN   +++ +  E  K+                K  EL  +   L +      D T++ VE          + KN + +I N  E    +      ++  RD+ + +E  +    L++ V Q +++ +  + Q+    +++ EL  KLR+++   EAV+A   +YSKN +++ DE  +   KLK  ++  I++ R +IS
Sbjct: 2309 EKAQTVPGKLEEIQKKIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQQLLKESKSKADKS---NNIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDKREEMTHAVTTLNETRNDVAEALEAAKKRVRRDEKSVDMQLVNAKAHELHLQATTLRQTFDNNKDNTDQAVEAANAFSNLTDTLKNAKAQIDNAYEALSAEPAFAESVQNARDKPFPDETKEKIDALSKTVSQDLKETEKLKKQL----EQLTELSEKLRKRK---EAVKAGIPKYSKNTLDSIDEKVQEVEKLKAEIDANIEETRAKIS 2622          

HSP 2 Score: 58.151 bits (139), Expect = 3.930e-8
Identity = 104/506 (20.55%), Postives = 213/506 (42.09%), Query Frame = 2
Query:  278 EIVSNSSKVATA-VKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLK---LEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKL--ENDIAEGQNKIAD-----LNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAE------------IEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQ--HAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEIS---------------RLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVK--MHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDR---YINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLR 1660
            +I++NS+++    V+     QN++SS K       + +    ++  +AR++++SL    L I + +K V     L    E ++  L  A      E+    T   KL ++ +  +    KL  + +  E Q K A+     LNS  Q    E++ +  K   + K L+ TK E            +EA   E + L V+I    + LK K EE++   +    T+     A+  AK R ++ +    +Q+ N+   E   +   L+   D     K++  +  +   A +    ++++ KA +D   E L +E +                   ++D + K   +D ++ E+L K+ + L  L    S++  K+ E VK  + + SK  L+      +E  + + +I   +E+ R +      +A ++T+K    ME +++         K    + +K  + + L  A  A  +  S       D+++++K  + +     ++++
Sbjct: 2214 DILTNSTQIQNKLVRTKTHSQNSVSSAKNITLNGTEFLQEVMKRAQRARQSVRSLAEIALAIGSSSKAVNVDPRLLKEAEETLMTLEAASADQYPEK--AQTVPGKLEEIQKKIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQQLLK-ESKSKADKSNNIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDKREEMTHAVTTLNETRNDVAEALEAAKKRVRRDEKSVDMQLVNAKAHELHLQATTLRQTFDNN---KDNTDQAVEAANAFSNLTDTLKNAKAQIDNAYEALSAEPAFAESVQNARDKPFPDETKEKIDALSKTVSQDLKETEKLKKQLEQLTEL----SEKLRKRKEAVKAGIPKYSKNTLDSIDEKVQEVEKLKAEIDANIEETRAKISEIAGKAEEITEKANSAMEGIRLARRNSVQLNKLAPVIVSKFEELKKLSSARSAKVDSVS-------DKVSQIKEMIAVARDAANRIK 2702          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Celegans
Match: epi-1 (Laminin-like protein epi-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21313])

HSP 1 Score: 61.6178 bits (148), Expect = 3.041e-9
Identity = 69/324 (21.30%), Postives = 152/324 (46.91%), Query Frame = 2
Query:  779 EEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKL-DSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKR----------------KCEELTKERDNLNRLLKKASDQTNKQVELVKMHET---SKKNLEQEILNYKEEAQKQRKIIFQLEKERDR-YINEASD----LTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKI-MNHQIDQLRDEIS 1672
            E+ + +   +++ +++++ + E+L + K  FE  +++     A L   Q  L +S+ +   S    N  +ML+L   E+ V  + +D++++   K    K   ++ +   ++  +RE++   ++ LN   +++ +  E  K+                K  EL  +   L +      D T++ VE          + KN + +I N  E    +      ++  RD+ + +E  +    L++ V Q +++ +  + Q+    +++ EL  KLR+++   EAV+A   +YSKN +++ DE  +   KLK  ++  I++ R +IS
Sbjct: 2298 EKAQTVPGKLEEIQKKIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQQLLKESKSKADKS---NNIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDKREEMTHAVTTLNETRNDVAEALEAAKKRVRRDEKSVDMQLVNAKAHELHLQATTLRQTFDNNKDNTDQAVEAANAFSNLTDTLKNAKAQIDNAYEALSAEPAFAESVQNARDKPFPDETKEKIDALSKTVSQDLKETEKLKKQL----EQLTELSEKLRKRK---EAVKAGIPKYSKNTLDSIDEKVQEVEKLKAEIDANIEETRAKIS 2611          

HSP 2 Score: 58.151 bits (139), Expect = 3.931e-8
Identity = 104/506 (20.55%), Postives = 213/506 (42.09%), Query Frame = 2
Query:  278 EIVSNSSKVATA-VKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLK---LEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKL--ENDIAEGQNKIAD-----LNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAE------------IEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQ--HAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEIS---------------RLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVK--MHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDR---YINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLR 1660
            +I++NS+++    V+     QN++SS K       + +    ++  +AR++++SL    L I + +K V     L    E ++  L  A      E+    T   KL ++ +  +    KL  + +  E Q K A+     LNS  Q    E++ +  K   + K L+ TK E            +EA   E + L V+I    + LK K EE++   +    T+     A+  AK R ++ +    +Q+ N+   E   +   L+   D     K++  +  +   A +    ++++ KA +D   E L +E +                   ++D + K   +D ++ E+L K+ + L  L    S++  K+ E VK  + + SK  L+      +E  + + +I   +E+ R +      +A ++T+K    ME +++         K    + +K  + + L  A  A  +  S       D+++++K  + +     ++++
Sbjct: 2203 DILTNSTQIQNKLVRTKTHSQNSVSSAKNITLNGTEFLQEVMKRAQRARQSVRSLAEIALAIGSSSKAVNVDPRLLKEAEETLMTLEAASADQYPEK--AQTVPGKLEEIQKKIQEETEKLDKQKETFEAQKKRAEELAAYLNSAQQLLK-ESKSKADKSNNIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDKREEMTHAVTTLNETRNDVAEALEAAKKRVRRDEKSVDMQLVNAKAHELHLQATTLRQTFDNN---KDNTDQAVEAANAFSNLTDTLKNAKAQIDNAYEALSAEPAFAESVQNARDKPFPDETKEKIDALSKTVSQDLKETEKLKKQLEQLTEL----SEKLRKRKEAVKAGIPKYSKNTLDSIDEKVQEVEKLKAEIDANIEETRAKISEIAGKAEEITEKANSAMEGIRLARRNSVQLNKLAPVIVSKFEELKKLSSARSAKVDSVS-------DKVSQIKEMIAVARDAANRIK 2691          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Fly
Match: ORY (gene:FBgn0046323 transcript:FBtr0346720)

HSP 1 Score: 112.464 bits (280), Expect = 6.292e-25
Identity = 152/541 (28.10%), Postives = 281/541 (51.94%), Query Frame = 2
Query:  920 QQTKLD---SQVQVTNSLFQENQNRMLEL----KNREDEVTILK-NDVQKLSKLKEATNKKLRSVEDQK------ADVDRQREKLKSEISRLNTELDNIRKE------QEEDKRKCEE-LTKERDNLNRLLKKASDQTN--KQVELVKMHETSKKNLEQEILNYK-EEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIM----NHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQ 2458
            Q+  LD   S+V   N    +N++ + +L    KN E+ +  L+  + +K + + + T++  +S+EDQ         ++R+   L SEI RL   ++++ K+      + +D R+ +E L +ERD+L   + K ++     K   ++K +  S  NL+   LN K +EA   +    + EKERD    E   L +++  + + + ++  Q+ D  +K++E + ++   +   E+V +++    +NL    +  T+ +   +I+     HQI QL  EIS  E  +     + + +     +L S+L+   +  A  +  +   +A+ + L K I   + + ++   ELE++  ER+++G Q+VR+NDE+ ++ EK++I Q+ L+ G  QYNQR++DIRLLK EI  L  E   L+ ++ +  D+++E+  LQR L +E  R +AL E+   P  VHRWR L               +G DP  FE+++K+Q LQKR + ++ E    +  + E +K    LK +L+  P  E+  +L + Q
Sbjct:  287 QRVHLDKYRSEVNALNKAMHKNEDDISDLTKNQKNNEEMIKQLRLIEKEKSNAVSQLTSRLKKSIEDQNNATTRMYKLNRKVMMLNSEILRLKNNINSLEKDVLNANGRTDDIRRIKETLQRERDSLRSDIIKLNNTMADLKHDMMLKANMISSLNLDMNKLNVKLDEAYILKS---KAEKERDEMAQEMETLHERIENYQDQISLKTSQVNDLTEKLHEKQREVHSYKKQLESVHSEKMMLQRNL----ENTTQERDNFRILQAKSGHQIQQLTTEISANEVKINSLNLKIEHLNNYIKELQSDLKNKENLVAALRKDMREMKAKNEMLAKTISNDELKFMKMGHELEEMRKERNLVGLQMVRRNDEIVVIKEKLQIAQNALDNGTTQYNQRVEDIRLLKKEISNLHTESECLKHAIKSTADMRKEIVRLQRALNQEHIRIRALTEDARTPTGVHRWRIL---------------KGEDPKKFELLEKLQLLQKRSLKQSIENSNLKNKLCEAQKTNETLKRMLSHMPTVEIKHKLVVQQ 805          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Fly
Match: CG6059 (gene:FBgn0039491 transcript:FBtr0085130)

HSP 1 Score: 100.523 bits (249), Expect = 2.811e-21
Identity = 74/194 (38.14%), Postives = 111/194 (57.22%), Query Frame = 2
Query: 1877 LEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQ 2458
            L++V  E+ ++G Q+VR+NDE+ LL EK+ + Q  +++G +QYNQR++DIRLLKLE+  LR     +Q+ V N   ++ +V  L+R+L +ER +  A  EEL  P  +HRWR L                G DP  FE+I+KIQ L KR I  + E   K   + E E ++ E K  +   P P V ++L + Q
Sbjct:  626 LDEVTKEKSLVGLQMVRRNDEVRLLREKLDMMQKAIDRGTMQYNQRVEDIRLLKLEVVNLRTSHECMQREVGNKAAMRHDVIRLERQLNQERLKVSAYSEELSRPCRIHRWRVL---------------LGKDPRRFELIRKIQQLLKRNIRLSVERENKAKELAELEHVHEEFKRQMTNLPDPSVRQKLCIQQ 804          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Fly
Match: CG5882 (gene:FBgn0039490 transcript:FBtr0085109)

HSP 1 Score: 99.7525 bits (247), Expect = 4.654e-21
Identity = 132/538 (24.54%), Postives = 279/538 (51.86%), Query Frame = 2
Query:  857 FKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKAS---DQTNKQVELVKMHET-----SKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQL 2446
             K++ EH   QH   + KL      L+  VQ  +   +    R+  LK REDE+  ++ D  KL+K +EA  +K   +++ K +V+    +L++++   + EL+++R+     ++  E LTKERD+L R L+      +Q+N Q +  + HE      +   ++ ++    E+A K +K   +   E   +I++   L         ++ ++E    + K+ I +LE K  + Q  ++ + A+R    +++  A +E  +++ +L  +   +++L+ +I  ++  + + + +  ++EKE+  L +E++  +      KA +  +  E  +  K + E + +  R +K+++ +++E++ +   L ++N+E   L    +  Q++ ++ + Q +Q  DD+RL+ +EIK LR E+++L+    +  DL++E+  + R L +ER + +AL++E+  PMNVHRWR               L  G DP   +++ +I  L+K+L+ +     E+E  + E ++LY  L+  + + P  +V  +L
Sbjct:  259 LKTNLEHLNTQHNAANNKLAKITVDLEYTVQERDKNKRALNQRINLLKVREDELIKVRQDNGKLAKSQEAIARKYAVLDEAKREVETLNIRLRTQLGTQDKELESMRRVVHHFEKNNENLTKERDSLRRELQAEHHQLEQSNAQHQEAQ-HEVRALKDTITTMDTKLKKLNEDANKLKKEKTKKLDEIQHWIDKLDALQN-------EMHLKENYEIELKRTISDLEAKCSKFQQQHDGLAAERQTLQRSVQLADEERQKLRDQLVNLQAHVEKLKAKIGYRDGEISRLQLQIDRMEKERRLLRNEIRHAQLGQQHTKAELLDKRKENDRHAKSLQEDEQKLARLRKDVDNLMNEKNAISAALTKRNEEFDRLKHSQENLQTVYDQTQRQCSQYQDDMRLMGVEIKNLRTERDVLRADRESAADLRQELLQMHRMLNQERIKARALQDEMVTPMNVHRWR---------------LLSGKDPEKMDLLGRISILRKQLLQQNVAASEQERALNEAQQLYAALREFMLKLPSHKVRAEL 773          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Zebrafish
Match: cfap58 (cilia and flagella associated protein 58 [Source:ZFIN;Acc:ZDB-GENE-060929-128])

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 484/884 (54.75%), Postives = 668/884 (75.57%), Query Frame = 2
Query:  104 DDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLT-----VSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNIEQNRFTGGGFNLNQ 2740
            DDS  E +E  FQ +L++L G+   DKFR EYEK+ +AL KSH++EKRLM KCREL AEIVSNS K++TA+KL  EDQ +I++LK+EI+KAWKMV+++ EKE +A+ETI+  K EIANL  LVE+GAG+S GQE SV DLLK K+ LT++RD  ++E   LR+    +     ++E +  +  + IA L  EIQ R  E  RE ++KEK+EK++K  + ++E++  EIK LT     +  D+QK E  +++ ++   KS  E  Q QH  T  +  ++Q  ++ +      L Q+NQ R  +LK +E+EVT LK ++ KL++L+E   ++LR +E+QKA+V+ QRE LK++I+ L  E++  + + + DK+  +EL +ERD LN+ + KA+++T+KQ  LVK+HE SKK LE EILNY++EAQKQRKII+QLEKERDRYINEAS+LT+KVL+++ED+K++EMQIF+YKK+I E ETKL+QQQNLYE VR +RN +SKNLIEA+D+  EM+RK+KI+NH  +QL+DEI+ KE  L KE+ E Q+VE+E++ L +ELQ+++ QA E K  +  Q+A+E++L KII EADAER+RQKKEL+QVISERD+LGTQLV++ND L+LLYEK+KIQQSILNKGEV YN+RL+DIR+LK+EIKK RREK+IL K+V NVDDL++EV+H+ REL++ERTRC+ALE+EL NP+NVHRWRKL               E SDPS+FE+IQKI +LQ+RLI+KT+EVVEKE+L+QEKEKLYVELKHILARQPGPE AE+L +YQ TL++K KQLK L +E NM+ESQ + +K+E+E+L  E Q+VK+KYF QK++++  ++++  L           IQPQR  +  RFTGGGF+L Q
Sbjct:   14 DDSTLETMEIGFQEVLNELSGDEKFDKFRVEYEKVTKALRKSHENEKRLMAKCRELNAEIVSNSVKLSTAMKLVDEDQASINTLKQEIDKAWKMVEASHEKELQAKETIKKHKEEIANLNNLVEKGAGVSGGQEYSVGDLLKIKEELTEQRDKLLSEVVTLRENLTKATGAQQEIEAEKNKAMDMIAQLQQEIQVRQNEVHRETRRKEKLEKEVKQFQTDLESKQSEIKLLTQQSQRLQDDQQKLEQLLQEHKIINEKSSKEMEQLQHRNTKLQQDNEQNSINLE-----QLSQQNQQRASDLKMKEEEVTQLKQEITKLTRLREGAQRRLRQMEEQKAEVENQRETLKNQITGLEREMEASKNQIDADKKAIDELVRERDILNKNMIKAANETDKQQTLVKLHEQSKKTLEHEILNYRDEAQKQRKIIYQLEKERDRYINEASELTKKVLENIEDIKLKEMQIFEYKKRIAEAETKLKQQQNLYEDVRTERNLFSKNLIEAKDQNAEMRRKVKIVNHMFEQLKDEITAKEVALDKERQEFQRVERERENLKAELQKMKLQAQETKQLLAKQQAQEQELLKIIAEADAERIRQKKELDQVISERDLLGTQLVKRNDSLALLYEKVKIQQSILNKGEVHYNERLEDIRVLKIEIKKQRREKSILSKTVINVDDLRQEVFHMHRELMKERTRCRALEDELNNPLNVHRWRKL---------------EASDPSSFELIQKIHSLQRRLISKTQEVVEKELLLQEKEKLYVELKHILARQPGPEAAEKLQVYQRTLREKTKQLKALTAELNMHESQAEGYKYEIERLVHELQEVKKKYFAQKRKDQENREKQRSL----GPAGQPVIQPQRP-DGPRFTGGGFSLKQ 872          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Zebrafish
Match: cfap58 (cilia and flagella associated protein 58 [Source:ZFIN;Acc:ZDB-GENE-060929-128])

HSP 1 Score: 764.992 bits (1974), Expect = 0.000e+0
Identity = 469/842 (55.70%), Postives = 646/842 (76.72%), Query Frame = 2
Query:  104 DDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLT-----VSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKRE 2614
            DDS  E +E  FQ +L++L G+   DKFR EYEK+ +AL KSH++EKRLM KCREL AEIVSNS K++TA+KL  EDQ +I++LK+EI+KAWKMV+++ EKE +A+ETI+  K EIANL  LVE+GAG+S GQE SV DLLK K+ LT++RD  ++E   LR+    +     ++E +  +  + IA L  EIQ R  E  RE ++KEK+EK++K  + ++E++  EIK LT     +  D+QK E  +++ ++   KS  E  Q QH  T  +  ++Q  ++ +      L Q+NQ R  +LK +E+EVT LK ++ KL++L+E   ++LR +E+QKA+V+ QRE LK++I+ L  E++  + + + DK+  +EL +ERD LN+ + KA+++T+KQ  LVK+HE SKK LE EILNY++EAQKQRKII+QLEKERDRYINEAS+LT+KVL+++ED+K++EMQIF+YKK+I E ETKL+QQQNLYE VR +RN +SKNLIEA+D+  EM+RK+KI+NH  +QL+DEI+ KE  L KE+ E Q+VE+E++ L +ELQ+++ QA E K  +  Q+A+E++L KII EADAER+RQKKEL+QVISERD+LGTQLV++ND L+LLYEK+KIQQSILNKGEV YN+RL+DIR+LK+EIKK RREK+IL K+V NVDDL++EV+H+ REL++ERTRC+ALE+EL NP+NVHRWRKL               E SDPS+FE+IQKI +LQ+RLI+KT+EVVEKE+L+QEKEKLYVELKHILARQPGPE AE+L +YQ TL++K KQLK L +E NM+ESQ + +K+E+E+L  E Q+VK+KYF QK+++
Sbjct:   14 DDSTLETMEIGFQEVLNELSGDEKFDKFRVEYEKVTKALRKSHENEKRLMAKCRELNAEIVSNSVKLSTAMKLVDEDQASINTLKQEIDKAWKMVEASHEKELQAKETIKKHKEEIANLNNLVEKGAGVSGGQEYSVGDLLKIKEELTEQRDKLLSEVVTLRENLTKATGAQQEIEAEKNKAMDMIAQLQQEIQVRQNEVHRETRRKEKLEKEVKQFQTDLESKQSEIKLLTQQSQRLQDDQQKLEQLLQEHKIINEKSSKEMEQLQHRNTKLQQDNEQNSINLE-----QLSQQNQQRASDLKMKEEEVTQLKQEITKLTRLREGAQRRLRQMEEQKAEVENQRETLKNQITGLEREMEASKNQIDADKKAIDELVRERDILNKNMIKAANETDKQQTLVKLHEQSKKTLEHEILNYRDEAQKQRKIIYQLEKERDRYINEASELTKKVLENIEDIKLKEMQIFEYKKRIAEAETKLKQQQNLYEDVRTERNLFSKNLIEAKDQNAEMRRKVKIVNHMFEQLKDEITAKEVALDKERQEFQRVERERENLKAELQKMKLQAQETKQLLAKQQAQEQELLKIIAEADAERIRQKKELDQVISERDLLGTQLVKRNDSLALLYEKVKIQQSILNKGEVHYNERLEDIRVLKIEIKKQRREKSILSKTVINVDDLRQEVFHMHRELMKERTRCRALEDELNNPLNVHRWRKL---------------EASDPSSFELIQKIHSLQRRLISKTQEVVEKELLLQEKEKLYVELKHILARQPGPEAAEKLQVYQRTLREKTKQLKALTAELNMHESQAEGYKYEIERLVHELQEVKKKYFAQKRKD 835          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Xenopus
Match: mrps17 (mitochondrial ribosomal protein S17 [Source:Xenbase;Acc:XB-GENE-5730000])

HSP 1 Score: 458.373 bits (1178), Expect = 5.530e-151
Identity = 296/542 (54.61%), Postives = 389/542 (71.77%), Query Frame = 2
Query:  104 DDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLR-DLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELS-------RFKSDFEHTQRQHAITDAKLR---DQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRL-NTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLV 1693
            D+ AFEALE+DFQ +L +L G+  L+KF+ EYEK+  AL KS+D+EKRLM KCREL AE        ATA+KLSQEDQ+TISSLKKEIEKAWKMVD+A EKE +A+ET+ SLK E+ +L+KLVEQGAG+S+GQE S  DLL AK+ L+KERD  + E  KLR +L + ++++    ++     Q  I     EIQ R  EA RE +KKEK+EKDL+  ++E EA+  EIK++  ++ + K+EL+  +++L        R   + E  Q    + + KL+   +QQ+ L+ Q      L QENQ + LELK +EDEV  ++ ++ K+SK +E   +K R +E+QK +V++QRE LK++I+     ++  I      D   C       ++ N L  +A++ T+KQ  LVK+HE SKKNLE+EI +YKEEAQKQRKII+QLEKERDRYINEASDLTQKVLQHMED+K+REMQIFDYKKKI E ETKL+QQQNLYEAVR+DRN YSKNLIEAQDEITEMKRKLKIMNHQ+DQL++EIS+KE+ LV
Sbjct:   11 DEKAFEALERDFQEVLQELVGDKSLEKFQIEYEKLHSALKKSYDNEKRLMAKCRELNAE--------ATAIKLSQEDQSTISSLKKEIEKAWKMVDAAYEKEQRAKETVNSLKDEVKSLSKLVEQGAGMSAGQEHS--DLLSAKEELSKERDELLAEVVKLRENLVKATELQQEAEKSKEEAEQG-IIQFQQEIQMRQNEASRESRKKEKLEKDLRGLQSEAEAKQLEIKSMQQNLTRNKEELQRLEQQLKENKILNERVSKELEQVQ----MRNNKLQQENEQQSVLNDQ------LTQENQQKQLELKAKEDEVNQMRQEISKISKARETIQRKYRQMEEQKIEVEQQRETLKNQITGFERGKVPVIDPFSATDHPVCHRPQYAPNHPNLL--RAANATDKQQSLVKLHEQSKKNLEEEIQSYKEEAQKQRKIIYQLEKERDRYINEASDLTQKVLQHMEDIKVREMQIFDYKKKIAEAETKLKQQQNLYEAVRSDRNLYSKNLIEAQDEITEMKRKLKIMNHQVDQLKEEISSKESVLV 529          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Xenopus
Match: CCDC146 (coiled-coil domain containing 146 [Source:NCBI gene;Acc:100496606])

HSP 1 Score: 83.9593 bits (206), Expect = 7.236e-16
Identity = 89/313 (28.43%), Postives = 171/313 (54.63%), Query Frame = 2
Query: 1430 QKVLQHMEDVKIREMQIFDYKKKIYELE-TKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEML 2365
            Q+  Q +++VK R++ I ++KKK  ++   +L++   +Y+ +R +RN+    +  A    +E++ KLKI  ++++ LR+    K+  L K K ++   +  +D L  +L R+R    E K   E Q+ +  +LT +I +A+ + ++ +K+ +  +  R+  G QL+ + +E+ +  EKI IQ+ IL  G+++     + IR LK+E  + +R+   LQK++ N   L+ ++  LQ +L +   R   LE + E+P   +R R               L EG DPS  E+++K + L+  L  K E+++EK++L
Sbjct:  423 QRYQQVLQEVKGRQLIIGEHKKKNQDVPFYRLKEFAKMYDIIRNERNKCVSLIQTAMQRASELREKLKIFANEMEILRNNAVNKDRQLQKIKLKENNSQMVRDSLQKDLSRVRVYLEEMKEKREQQKMQIGRLTNMINQAEVDMIQLRKKYQTAVQNRNERGVQLIEREEEICIFLEKINIQEMILRNGDLEMVSMDEKIRFLKIEAAEQKRQVEQLQKNLPNKRMLESDLVTLQIQLSQCNDRVAELETQTEDPGKEYRTR---------------LLEGKDPSLQELMKKTEELELHLAQKEEQLLEKDLL 720          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Xenopus
Match: CCDC146 (coiled-coil domain containing 146 [Source:NCBI gene;Acc:100496606])

HSP 1 Score: 83.9593 bits (206), Expect = 8.714e-16
Identity = 89/313 (28.43%), Postives = 171/313 (54.63%), Query Frame = 2
Query: 1430 QKVLQHMEDVKIREMQIFDYKKKIYELE-TKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEML 2365
            Q+  Q +++VK R++ I ++KKK  ++   +L++   +Y+ +R +RN+    +  A    +E++ KLKI  ++++ LR+    K+  L K K ++   +  +D L  +L R+R    E K   E Q+ +  +LT +I +A+ + ++ +K+ +  +  R+  G QL+ + +E+ +  EKI IQ+ IL  G+++     + IR LK+E  + +R+   LQK++ N   L+ ++  LQ +L +   R   LE + E+P   +R R               L EG DPS  E+++K + L+  L  K E+++EK++L
Sbjct:  452 QRYQQVLQEVKGRQLIIGEHKKKNQDVPFYRLKEFAKMYDIIRNERNKCVSLIQTAMQRASELREKLKIFANEMEILRNNAVNKDRQLQKIKLKENNSQMVRDSLQKDLSRVRVYLEEMKEKREQQKMQIGRLTNMINQAEVDMIQLRKKYQTAVQNRNERGVQLIEREEEICIFLEKINIQEMILRNGDLEMVSMDEKIRFLKIEAAEQKRQVEQLQKNLPNKRMLESDLVTLQIQLSQCNDRVAELETQTEDPGKEYRTR---------------LLEGKDPSLQELMKKTEELELHLAQKEEQLLEKDLL 749          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Xenopus
Match: CCDC146 (coiled-coil domain containing 146 [Source:NCBI gene;Acc:100496606])

HSP 1 Score: 79.337 bits (194), Expect = 1.983e-14
Identity = 88/313 (28.12%), Postives = 169/313 (53.99%), Query Frame = 2
Query: 1430 QKVLQHMEDVKIREMQIFDYKKKIYELE-TKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEML 2365
            Q+  Q +++VK R++ I ++KKK  ++   +L++   +Y+ +R +RN+    +  A    +E++ KLKI  ++++ LR+        L K K ++   +  +D L  +L R+R    E K   E Q+ +  +LT +I +A+ + ++ +K+ +  +  R+  G QL+ + +E+ +  EKI IQ+ IL  G+++     + IR LK+E  + +R+   LQK++ N   L+ ++  LQ +L +   R   LE + E+P   +R R               L EG DPS  E+++K + L+  L  K E+++EK++L
Sbjct:  480 QRYQQVLQEVKGRQLIIGEHKKKNQDVPFYRLKEFAKMYDIIRNERNKCVSLIQTAMQRASELREKLKIFANEMEILRN------NALQKIKLKENNSQMVRDSLQKDLSRVRVYLEEMKEKREQQKMQIGRLTNMINQAEVDMIQLRKKYQTAVQNRNERGVQLIEREEEICIFLEKINIQEMILRNGDLEMVSMDEKIRFLKIEAAEQKRQVEQLQKNLPNKRMLESDLVTLQIQLSQCNDRVAELETQTEDPGKEYRTR---------------LLEGKDPSLQELMKKTEELELHLAQKEEQLLEKDLL 771          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Mouse
Match: Cfap58 (cilia and flagella associated protein 58 [Source:MGI Symbol;Acc:MGI:2685815])

HSP 1 Score: 853.588 bits (2204), Expect = 0.000e+0
Identity = 524/883 (59.34%), Postives = 678/883 (76.78%), Query Frame = 2
Query:  104 DDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQR---QHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNIEQNRFTGGGFNLNQV 2743
            +++AFE +EKDFQ +L +L G+  L+KFR EYEK+   + KS+++EKRLM KCREL AEIV NS+KVATA+KLSQ+DQ TI+SLKKEIEKAWKMVDSA +KE KA+ETI +LK EI NLTKLVEQG+GLS  Q+ ++ DLLK K+ +TKERD  ++E  KLR+    +  +    E+   E +  I+    EIQ R  EA RE +KKEK+EK+L+  + +++ R  EIK +   + K K+EL+  +++L   K   E   +   Q  + +AKL   Q + D        L QENQ + LELK +EDE+  ++ D+ KL+K++E  +KKL  ++DQKA+V++Q++ LK++I  L  E+++ +K+ E DK+  EEL +ERD LN+ + KA   T KQV+LVK+HE +KKNLE+EI NYK+EAQKQRKIIFQLEKERDRYINEASDLTQ+VL +MED+K+RE+QIFDY+KKI E ETKL+QQQNLYEAVR+DRN YSKNL+EAQDEITEMKRKLKIM HQ+DQL++EIS KE  LVK   E+Q++EKEK+ L +ELQ+LR QA E K +IE QE EE+KL +II EAD ERVRQKKEL+QVISERDILG+QLVR+NDEL+LLYEKIKIQQS+LNKGE QYNQR++D+R+LKLEIKKLRREK IL +SVANV++L++E+YH+QRE L+ERTRC+ALEEELENPMNVHRWRKL               E SDPSTFE+IQKI TLQKRLI+KTEEVVEKE+L+QEKEKLYVELKHILARQPGPE AEQL +Y+ TL++K KQLK L SE NMYESQ +E+K+E+E+L  E   +K+KY  QK++E +LK+++ +       +NN   + ++++   RFTGGGF L+Q 
Sbjct:   12 EETAFEEIEKDFQEVLSELSGDKSLEKFRTEYEKLHSIMKKSYENEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKEIEKAWKMVDSAYDKEQKAKETILALKEEIVNLTKLVEQGSGLSMDQDSNIRDLLKFKEEVTKERDQLLSEVVKLRENLAQTIEKQQAAEHAKEEAEMAISQFQQEIQHRQNEASRESRKKEKLEKELRQIQTDMDGRQAEIKAMQQYMHKSKEELQRLEQQLKEQKILNERAAKEVEQFQMRNAKL---QQENDQHTLTCEQLSQENQQKALELKAKEDEIHQMRLDLGKLNKIREQIHKKLHQLDDQKAEVEQQKDTLKNQILGLEREVESSKKQAELDKKAMEELLRERDILNKNMLKAVSATQKQVDLVKLHEQAKKNLEEEIQNYKDEAQKQRKIIFQLEKERDRYINEASDLTQRVLANMEDIKVREIQIFDYRKKIAESETKLKQQQNLYEAVRSDRNLYSKNLVEAQDEITEMKRKLKIMTHQVDQLKEEISAKEAALVKLHLEQQRIEKEKETLKAELQKLRQQALETKHFIEKQEVEERKLLRIIAEADGERVRQKKELDQVISERDILGSQLVRRNDELALLYEKIKIQQSVLNKGETQYNQRVEDMRILKLEIKKLRREKGILARSVANVEELRQELYHMQREFLKERTRCRALEEELENPMNVHRWRKL---------------EASDPSTFELIQKIHTLQKRLISKTEEVVEKELLLQEKEKLYVELKHILARQPGPEAAEQLQIYRHTLREKTKQLKVLSSELNMYESQSQEYKYEIERLGNELMSLKKKYLAQKRKELVLKNKDRM------SMNNIFSETKKSV--PRFTGGGFPLHQA 868          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Mouse
Match: Cfap58 (cilia and flagella associated protein 58 [Source:MGI Symbol;Acc:MGI:2685815])

HSP 1 Score: 182.956 bits (463), Expect = 4.642e-53
Identity = 90/134 (67.16%), Postives = 112/134 (83.58%), Query Frame = 2
Query:  104 DDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQE 505
            +++AFE +EKDFQ +L +L G+  L+KFR EYEK+   + KS+++EKRLM KCREL AEIV NS+KVATA+KLSQ+DQ TI+SLKKEIEKAWKMVDSA +KE KA+ETI +LK EI NLTKLVEQG+GLS  Q+
Sbjct:   12 EETAFEEIEKDFQEVLSELSGDKSLEKFRTEYEKLHSIMKKSYENEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKEIEKAWKMVDSAYDKEQKAKETILALKEEIVNLTKLVEQGSGLSMDQD 145          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Mouse
Match: Ccdc146 (coiled-coil domain containing 146 [Source:MGI Symbol;Acc:MGI:1922422])

HSP 1 Score: 68.1662 bits (165), Expect = 4.033e-11
Identity = 79/318 (24.84%), Postives = 171/318 (53.77%), Query Frame = 2
Query: 1448 MEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELK 2401
            ++++K ++++I  YKK+ +E+  +LR+  +LY+ +R +RN++   L +A  ++ E+K +LK+  ++++ LR+   ++E  L     +       K+ + +++ ++ ++  E K   EAQ     +L  +I   + E V+ +K+ E+ +  R+  G QL+ + +E+ + YEK+ +Q+ I    +V+ +   + IR LKL I + +R+ ++ +K V     L  ++  +Q +  +   R K LE+   NP +  R R +               +G D +  EMI+K+  L+ ++  K E+++EK+ + ++  +L   LK
Sbjct:  509 VKEIKSKDLEIRLYKKRKHEIHRRLREFASLYDTIRNERNKFVNLLHKAHQKVNEIKERLKMSLNELEILRNSAVSQERKLQNAMLKHSNNVTIKESIQNDVCKITAKLQEMKEKKEAQLTSMDRLASMITVIEEEMVQLRKKYEKAVQRRNESGVQLIEREEEVCIFYEKVNVQEKIKLHQDVEIHILEEKIRFLKLRIAEKQRQISVTRKLVPIKKSLDADLAVIQIQFSQCTDRIKDLEKLFVNPDSKGRVRFI---------------KGKDLTEEEMIKKLDMLELQIAKKEEKLLEKDFIYEQVSQLTNRLK 811          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Mouse
Match: Lama2 (laminin, alpha 2 [Source:MGI Symbol;Acc:MGI:99912])

HSP 1 Score: 52.7582 bits (125), Expect = 2.879e-6
Identity = 88/468 (18.80%), Postives = 196/468 (41.88%), Query Frame = 2
Query:  152 HDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAE-IVSNSSKVATAVKLSQED-----QNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKL--VEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQ-KQELKIKD-----EELSRFKSDFEHTQRQHAITDAKL--RDQQTKLDSQVQVTNSL------FQENQNRMLELKNREDEVTI--------LKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKI 1465
             D      L++ + E +++++ L       ++ + +   + AE ++   +K+    +   ED     Q  ++  K +++ AW ++  AT+K   A       +L  AN   +  +E       G +  + + LK  + +  E +  + E   + D  +D K ++  +  ++++   KI DL  EI+ R   A++  + +    +   S+ A ++   +E KN++ +     +    IKD     E+++R   +      + A +   L   D +  L    ++ N         + N N + +LK R +   +        L + + KLS +   T  KL++V+++  + +   + + +++  L+  LD +       K+   +L       N ++K  S       +++    TS +NLEQE     +    + K I +LE    + I+E  +L  +  +    +K+
Sbjct: 1702 QDKTAERNLEELQKEIDRMLKELRSKDLQTQKEVAEDELVAAEGLLKRVNKLFGEPRAQNEDMEKDLQQKLAEYKNKLDDAWDLLREATDKTRDAN------RLSAANQKNMTILETKKEAIEGSKRQIENTLKEGNDILDEANRLLGEINSVIDYVDDIKTKLPPMSEELSD---KIDDLAQEIKDRRL-AEKVFQAESHAAQLNDSS-AVLDGILDEAKNISFNATAAFRAYSNIKDYIDEAEKVAREAKELAQGATKLATSPQGLLKEDAKGSLQKSFRILNEAKKLANDVKGNHNDLNDLKTRLETADLRNSGLLGALNDTMDKLSAITNDTAAKLQAVKEKAREANDTAKAVLAQVKDLHQNLDGL-------KQNYNKLADSVAKTNAVVKDPSKN-----KIIADAGTSVRNLEQE----ADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKV 2142          
BLAST of Cilia-and flagella-associated protein 58 vs. UniProt
Match: sp|B2RW38|CFA58_MOUSE (Cilia- and flagella-associated protein 58 OS=Mus musculus OX=10090 GN=Cfap58 PE=2 SV=1)

HSP 1 Score: 853.588 bits (2204), Expect = 0.000e+0
Identity = 524/883 (59.34%), Postives = 678/883 (76.78%), Query Frame = 2
Query:  104 DDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQR---QHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNIEQNRFTGGGFNLNQV 2743
            +++AFE +EKDFQ +L +L G+  L+KFR EYEK+   + KS+++EKRLM KCREL AEIV NS+KVATA+KLSQ+DQ TI+SLKKEIEKAWKMVDSA +KE KA+ETI +LK EI NLTKLVEQG+GLS  Q+ ++ DLLK K+ +TKERD  ++E  KLR+    +  +    E+   E +  I+    EIQ R  EA RE +KKEK+EK+L+  + +++ R  EIK +   + K K+EL+  +++L   K   E   +   Q  + +AKL   Q + D        L QENQ + LELK +EDE+  ++ D+ KL+K++E  +KKL  ++DQKA+V++Q++ LK++I  L  E+++ +K+ E DK+  EEL +ERD LN+ + KA   T KQV+LVK+HE +KKNLE+EI NYK+EAQKQRKIIFQLEKERDRYINEASDLTQ+VL +MED+K+RE+QIFDY+KKI E ETKL+QQQNLYEAVR+DRN YSKNL+EAQDEITEMKRKLKIM HQ+DQL++EIS KE  LVK   E+Q++EKEK+ L +ELQ+LR QA E K +IE QE EE+KL +II EAD ERVRQKKEL+QVISERDILG+QLVR+NDEL+LLYEKIKIQQS+LNKGE QYNQR++D+R+LKLEIKKLRREK IL +SVANV++L++E+YH+QRE L+ERTRC+ALEEELENPMNVHRWRKL               E SDPSTFE+IQKI TLQKRLI+KTEEVVEKE+L+QEKEKLYVELKHILARQPGPE AEQL +Y+ TL++K KQLK L SE NMYESQ +E+K+E+E+L  E   +K+KY  QK++E +LK+++ +       +NN   + ++++   RFTGGGF L+Q 
Sbjct:   12 EETAFEEIEKDFQEVLSELSGDKSLEKFRTEYEKLHSIMKKSYENEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKEIEKAWKMVDSAYDKEQKAKETILALKEEIVNLTKLVEQGSGLSMDQDSNIRDLLKFKEEVTKERDQLLSEVVKLRENLAQTIEKQQAAEHAKEEAEMAISQFQQEIQHRQNEASRESRKKEKLEKELRQIQTDMDGRQAEIKAMQQYMHKSKEELQRLEQQLKEQKILNERAAKEVEQFQMRNAKL---QQENDQHTLTCEQLSQENQQKALELKAKEDEIHQMRLDLGKLNKIREQIHKKLHQLDDQKAEVEQQKDTLKNQILGLEREVESSKKQAELDKKAMEELLRERDILNKNMLKAVSATQKQVDLVKLHEQAKKNLEEEIQNYKDEAQKQRKIIFQLEKERDRYINEASDLTQRVLANMEDIKVREIQIFDYRKKIAESETKLKQQQNLYEAVRSDRNLYSKNLVEAQDEITEMKRKLKIMTHQVDQLKEEISAKEAALVKLHLEQQRIEKEKETLKAELQKLRQQALETKHFIEKQEVEERKLLRIIAEADGERVRQKKELDQVISERDILGSQLVRRNDELALLYEKIKIQQSVLNKGETQYNQRVEDMRILKLEIKKLRREKGILARSVANVEELRQELYHMQREFLKERTRCRALEEELENPMNVHRWRKL---------------EASDPSTFELIQKIHTLQKRLISKTEEVVEKELLLQEKEKLYVELKHILARQPGPEAAEQLQIYRHTLREKTKQLKVLSSELNMYESQSQEYKYEIERLGNELMSLKKKYLAQKRKELVLKNKDRM------SMNNIFSETKKSV--PRFTGGGFPLHQA 868          
BLAST of Cilia-and flagella-associated protein 58 vs. UniProt
Match: sp|Q5T655|CFA58_HUMAN (Cilia- and flagella-associated protein 58 OS=Homo sapiens OX=9606 GN=CFAP58 PE=1 SV=1)

HSP 1 Score: 810.831 bits (2093), Expect = 0.000e+0
Identity = 501/850 (58.94%), Postives = 658/850 (77.41%), Query Frame = 2
Query:   98 AIDDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQR---QHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRES 2638
             +++SAFE +E+DFQ +LH+L G+  L+KFR EYE++   + KS+D+EKRLM KCREL AEIV NS+KVATA+KLSQ+DQ TI+SLKKEIEKAWKMVDSA +KE KA+ETI +LK EI NLTKLVEQG+GLS  Q  ++ DLL+ K+ +TKERD  ++E  KLR+    +  +  + E    E ++ I+    EIQ R  EA RE +KKEK+EK+LK  +A++++R  EIK L   + K K+EL+  +++L   K   E   +   Q  + +AKL   Q + +    V   L QENQ + LELK +E+EV  ++ D+ KL+K++E  +KKL   EDQKA+V++ +E LK++I  L  E++  +K+ E D++  +EL +ERD LN+ + KA + T KQ +LVK+HE +K+NLE EI NYK+EAQKQRKIIF LEKERDRYIN+ASDLTQKVL +MED+K+RE QIFDY+KKI E E KL+QQQNLYEAVR+DRN YSKNL+EAQDEIT+MKRKLKIM HQ+D+L+++IS KE+ LVK   E+Q++EKEK+ L +ELQ+LR QA E K +IE QEAEE+KL +II EAD ER+RQKKEL+QVISERDILG+QLVR+NDEL+LLYEKIKIQQS+LNKGE QYNQRL+D+R+L+LEIKKLRREK IL +S+ANV++L++E +H+QRELL+ERTRC+ALEEELENP+NVHRWRKL               E SDP+ +E+IQKI TLQKRLI+KTEEVVEKE+L+QEKEKLY+ELKH+LARQPGPE AEQL +Y+ TL  K +QLK L SE NMYE Q KE+K+E+EKL  E Q++K+KY  QK++E++ K++++
Sbjct:   10 VLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKEIEKAWKMVDSAYDKEQKAKETILALKEEIVNLTKLVEQGSGLSMDQHSNIRDLLRFKEEVTKERDQLLSEVVKLRESLAQTTEQQQETERSKEEAEHAISQFQQEIQQRQNEASREFRKKEKLEKELKQIQADMDSRQTEIKALQQYVQKSKEELQKLEQQLKEQKILNERAAKELEQFQMRNAKL---QQENEQHSLVCEQLSQENQQKALELKAKEEEVHQMRLDIGKLNKIREQIHKKLHHTEDQKAEVEQHKETLKNQIVGLEREVEASKKQAELDRKAMDELLRERDILNKNMLKAVNATQKQTDLVKLHEQAKRNLEGEIQNYKDEAQKQRKIIFHLEKERDRYINQASDLTQKVLMNMEDIKVRETQIFDYRKKIAESEIKLKQQQNLYEAVRSDRNLYSKNLVEAQDEITDMKRKLKIMIHQVDELKEDISAKESALVKLHLEQQRIEKEKETLKAELQKLRQQALETKHFIEKQEAEERKLLRIIAEADGERLRQKKELDQVISERDILGSQLVRRNDELALLYEKIKIQQSVLNKGESQYNQRLEDMRILRLEIKKLRREKGILARSMANVEELRQEFFHMQRELLKERTRCRALEEELENPLNVHRWRKL---------------EASDPNAYELIQKIHTLQKRLISKTEEVVEKELLLQEKEKLYMELKHVLARQPGPEAAEQLKLYRRTLHDKKQQLKVLSSELNMYEVQSKEYKYEVEKLTNELQNLKKKYLAQKRKEQLQKNKDT 841          
BLAST of Cilia-and flagella-associated protein 58 vs. UniProt
Match: sp|A8HUA1|CFA58_CHLRE (Cilia- and flagella-associated protein 58 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP58 PE=1 SV=1)

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 418/844 (49.53%), Postives = 601/844 (71.21%), Query Frame = 2
Query:   98 AIDDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLR-DLAEDS-KVRIA---KLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKRE 2614
             +     E LE+ +  +L +L  +  +D FR EYEK+ RAL K+++S+ RL +KC+EL ++I  N+SKV +A+KL++ED+ T  +LK+EI KAWKMVD +T KE KA+ET Q LK+EIANL++LVE+GAGL+ G+E ++ +LLK K+ L +ERD+Q+ +  K R DL E   K+R A   KL+ D       I  L   I  +  EA+RE++KKE+MEK++K  + ++E R+ EIK+  + +   ++++   ++ L   K   E  Q+++ + + +++     L+ Q+     L  EN  + +EL+ +E+E++ +K +  +++KL+E T KK + +E+Q+ +V+++R+ L++E++ L  EL+  +KE + +K+K EELT+ERD        A + T KQ++LVK++E +K+NLEQEI  YK EAQKQ K+I+QLEKER++Y  EA++   K  Q   +VK+R   I D +++I E E+KL+QQQNLYEAVRADRN YSKNLIEAQDEI EMKRK KIM HQI+QL++EI+ K+  L+KE  E QKV  EK+QL +EL R +S   E  + I AQ+ E  KL  II EAD ER RQKKE + V++ERDILGTQLVR+NDEL+ LYE+IKIQQ+ L  G+ QY  RL +IR LK+ +  L+R+ ++L+ SV+N+D LKREV+ L RELL+ERT+ KAL EELENP+NVHRWRKL               EGSDP T+EMIQKIQTLQKRLI+KTEEVVEK++LIQEKEKLY+ELK+ILARQPGPEVAEQL++YQ  L++K KQ+K + SE NMY++Q+ E+K+E+E+L +E  ++KQ +F ++K+E
Sbjct:    8 GLHGGHHETLEQ-YNKVLEELAADAVMDPFRVEYEKLHRALRKTYESQARLAKKCQELNSDISLNASKVQSALKLNEEDRETAVALKREINKAWKMVDDSTVKETKAKETAQQLKVEIANLSRLVEEGAGLAIGEETALNELLKQKEELARERDAQVEQLMKYRSDLMETQEKLRAADAEKLQLDA-----DIQHLRGTINDKKAEAEREIRKKERMEKEMKELRQQLEIRSSEIKSKQLQVTSTEEQVARLEQMLRDAKFATEKVQKEYNMLNERMQKLHHDLEEQIHTNTQLLTENSAKQVELRVKEEEISGIKQEASRVNKLREQTVKKTKQLEEQRVEVEKERDVLRAELAALERELEAKQKEVDVEKKKLEELTRERD--------AENATQKQIDLVKINENAKRNLEQEIQGYKMEAQKQSKLIYQLEKEREKYDLEAAEAANKYQQAQSEVKLRVDAIMDLQRRIAEGESKLKQQQNLYEAVRADRNLYSKNLIEAQDEIQEMKRKFKIMQHQIEQLKEEITGKDLYLLKEHFEHQKVINEKEQLRNELDRSKSNIKEADSAINAQKVEIDKLNHIINEADQERRRQKKEYDIVVNERDILGTQLVRRNDELAALYERIKIQQATLQMGQSQYRDRLAEIRQLKVRLADLKRQLHLLKSSVSNIDVLKREVHQLGRELLQERTKVKALSEELENPLNVHRWRKL---------------EGSDPGTYEMIQKIQTLQKRLISKTEEVVEKDLLIQEKEKLYMELKNILARQPGPEVAEQLSIYQANLREKTKQMKAMASELNMYQAQVNEYKYEIERLVRELNEMKQVFFDRRKKE 822          
BLAST of Cilia-and flagella-associated protein 58 vs. UniProt
Match: sp|Q8IYE0|CC146_HUMAN (Coiled-coil domain-containing protein 146 OS=Homo sapiens OX=9606 GN=CCDC146 PE=1 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 4.080e-12
Identity = 82/319 (25.71%), Postives = 169/319 (52.98%), Query Frame = 2
Query: 1430 QKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKL 2386
            QK    ++++K ++++I  +KKK  E+  +LR+   LY+ +R +RN++   L +A  ++ E+K + K+  ++++ LR+   ++E  L     +       ++ + ++++++ S+  E K   EAQ     +L   I   + E V+ +K  E+ +  R+  G QL+ + +E+ + YEKI IQ+ +   GE++ +   + I+ LK++I + +R+  + QK +     L  ++  LQ +  +   R K LE++   P   +R R              +LP G D +  EMIQK+  L+ +L  K E+++EK+ + ++  +L
Sbjct:  481 QKYTNIVKEMKAKDLEIRIHKKKKCEIYRRLREFAKLYDTIRNERNKFVNLLHKAHQKVNEIKERHKMSLNELEILRNSAVSQERKLQNSMLKHANNVTIRESMQNDVRKIVSKLQEMKEKKEAQLNNIDRLANTITMIEEEMVQLRKRYEKAVQHRNESGVQLIEREEEICIFYEKINIQEKMKLNGEIEIHLLEEKIQFLKMKIAEKQRQICVTQKLLPAKRSLDADLAVLQIQFSQCTDRIKDLEKQFVKPDGENRAR--------------FLP-GKDLTEKEMIQKLDKLELQLAKKEEKLLEKDFIYEQVSRL 784          
BLAST of Cilia-and flagella-associated protein 58 vs. UniProt
Match: sp|Q66H60|CC146_RAT (Coiled-coil domain-containing protein 146 OS=Rattus norvegicus OX=10116 GN=Ccdc146 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.921e-10
Identity = 79/318 (24.84%), Postives = 168/318 (52.83%), Query Frame = 2
Query: 1448 MEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELK 2401
            ++++K ++++I  Y+K+  E+  +L++   LY+A+R +RN++   L +A  ++ E+K +LK+  ++++ LR    ++E  L     +       ++ + +++ ++ ++  E K   EAQ     +L  +I   + E V+ +K+ E+ +  R+  G QL+ + +E+ + YEK+ IQ  +    +++ +   + IR LKL++ + +R+  + QK V     L   +  +Q +  +   R KALE+   NP    R R              ++P G D +  EMI+K+  L+ +L  K E+++EK+ + ++  +L   LK
Sbjct:  506 IKEIKSKKLEIRLYRKRKREIHRRLKEFAGLYDAIRNERNKFVNLLHKAYQKVNEIKERLKMSLNELEILRSSAVSQERKLQNAMLKHSNNVTIRESMQNDVCKITAKLQEMKEKKEAQLTSMDRLASMITVIEEEMVQLRKKYEKAVQRRNESGVQLIEREEEVCIFYEKMNIQDKVKLHQDIEIHILEEKIRFLKLKVAEKQRQICVTQKLVPIKKSLDANLAVVQIQFSQCADRIKALEKCFVNPDCQGRVR--------------FIP-GKDLTEEEMIKKLDMLELQLAKKEEKLLEKDFIYEQVSQLTNRLK 808          
BLAST of Cilia-and flagella-associated protein 58 vs. TrEMBL
Match: gnl|BL_ORD_ID|17714432 (tr|A0A2G8L5A5|A0A2G8L5A5_STIJA Putative coiled-coil domain-containing protein OS=Stichopus japonicus OX=307972 GN=BSL78_07619 PE=4 SV=1)

HSP 1 Score: 981.089 bits (2535), Expect = 0.000e+0
Identity = 581/883 (65.80%), Postives = 708/883 (80.18%), Query Frame = 2
Query:   95 PAIDDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNIEQNRFTGGGFNLNQV 2743
             + +DSAFE+LEKDFQ +L++L G+  L+KFR EYEK+ RAL KSHDSEKRLMQKCREL AEIV+NS+KVATA+KLS EDQ TI+ LKKEIEKAWKMVD++ EKE +ARETIQSLKLEI NL+KLVEQGAGLS GQE SV +LLKAK+ LTKERD ++ E  KLR+   ++  +    E D  E   KIA+++ +IQ R+ EAQRE ++KEK++++LK +K E+E +  E+K++     + K ++   + +L   K  FE TQR   I + +L   Q   D Q+   +SL QENQ +  +LK++EDE+  LK D  +L+K++E   +KLR+VEDQK D ++Q+E LKS+I  L  E+++ +K+ E D++  ++L +ERD LN+ L KA+  T KQ+ LVK+HE SKKNLEQEI NYKEEAQKQRKII+QLEKERDRYINEASDLTQKVLQHMEDVK+REMQIFDYKKKI E ETKL+QQQNLYEAVR+DRN YSKNLIE+QDEITEMKRKLKIMNHQIDQL++EI+ KE  LVKE  + Q+VEKEKD L +ELQR++ QA E+KAYIEAQEAEE+KL KII EADAER+RQKKEL+QVI+ERDILGT LVR+NDEL+LLYEKIKIQQS L+KGE+QY QRL+DIRLLKLEIKKLRREKNIL K+VANVDDLKREVYHLQRELLRERTRCKALEEELENPMN+HRWRKL               EGSDPST+EMIQKIQTLQ+RLI KTEEVVEKE+LIQEKEKLYVELKHILARQPGPEVAEQL +YQ TLK K KQLK++ SE NMYESQ+ E+K+E+E+LAKE QDVK+KY+ QK++E+  +DR+   LAQ       +IQPQ + ++ RFTGGGFNL Q 
Sbjct:   14 TSFEDSAFESLEKDFQEVLNELMGDKSLEKFRTEYEKLHRALKKSHDSEKRLMQKCRELNAEIVANSAKVATALKLSTEDQTTIAQLKKEIEKAWKMVDASQEKEQRARETIQSLKLEIFNLSKLVEQGAGLSMGQEHSVNELLKAKEDLTKERDEKLEEIAKLRENLSEAGQKQQMAEKDRDEAATKIAEMSQDIQVRSNEAQREQRRKEKLDRELKQSKNELEQKTNEVKSMGSQCQRYKDDIDKLENQLKEQKILFERTQRDTDILNTRLTKLQQDYDQQLVNCDSLAQENQQKFNDLKSKEDEINQLKQDTLRLTKMRETIQRKLRTVEDQKGDTEQQKETLKSQIIALEREIESSKKQAEMDRKAIDDLVRERDILNKNLLKAASATQKQLNLVKLHEQSKKNLEQEIANYKEEAQKQRKIIYQLEKERDRYINEASDLTQKVLQHMEDVKVREMQIFDYKKKIAEAETKLKQQQNLYEAVRSDRNLYSKNLIESQDEITEMKRKLKIMNHQIDQLKEEITAKEAALVKEHLDHQRVEKEKDALKAELQRMKQQAVESKAYIEAQEAEERKLLKIISEADAERLRQKKELDQVINERDILGTHLVRRNDELALLYEKIKIQQSTLSKGELQYRQRLEDIRLLKLEIKKLRREKNILNKNVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNIHRWRKL---------------EGSDPSTYEMIQKIQTLQRRLIQKTEEVVEKELLIQEKEKLYVELKHILARQPGPEVAEQLQIYQQTLKDKTKQLKSMASELNMYESQVSEYKYEIERLAKELQDVKKKYYTQKRKEQHARDRDR-ALAQAGA---PTIQPQ-HTDKPRFTGGGFNLTQT 876          
BLAST of Cilia-and flagella-associated protein 58 vs. TrEMBL
Match: gnl|BL_ORD_ID|15769750 (tr|A0A1I8GJV9|A0A1I8GJV9_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023212g2 PE=4 SV=1)

HSP 1 Score: 980.319 bits (2533), Expect = 0.000e+0
Identity = 584/884 (66.06%), Postives = 721/884 (81.56%), Query Frame = 2
Query:  101 IDDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLL--LAQDNGVNNSSIQPQRNIEQNRFTGGGFNLNQVK 2746
            +DDSAF+ LEKDFQ +L +LQGN GLDKF+ EYEK+MRAL KSH+SEKRLMQKCRELKAEIV+NS+K+ +A+KLS+EDQ TI+SLKKEIEKAWKMVD+A +KE +AR+TIQSLKLEIANL+KLVEQGAGL+SGQ+ +V++LL+AK+ LTK+RD  M +N  LRD  E++K +  +LE D+ + Q K+A+L  EIQT+N+EA RE +KKEKME+DLK  KAE EA+  EI+ L   +    QE K ++EE+   K++ E  QR     + K++D    L+ Q Q    L  +NQ++ LELK REDEV  LK+++QKL +++E T +KLR  ED K++++ QRE+LK+EI  +  E+D I+K  E+DK+  +ELT+ERD LN+ L KA++ T KQ  +VK+HE SKK LEQEI NYK+EAQKQRKII+QLEKERDRYINEASDLTQKVLQHMEDVK+REMQIFDYKKKI E ET+LRQQQNLYEAVR+DRN YSKNLIEAQDEITE+KRK KIM+HQIDQL++E + K+  LVKE  E+QKVEKEKDQL+ ELQ ++    EN  YIEAQE E+KKLTK+I EADAER+RQKKEL++++SERDILGTQLVR+NDEL+LLYEKIKIQQS+LNKGEVQYNQRL+DIR+LKLEIKKLRREK +LQ++V NVD+L+REVYHLQ+ELLRERTRCKALEEELENPMNVHRWRKL               EGSDPST+EMIQKIQTLQKRLI KTEEVVEKE+LIQEKEKLY+ELKHILARQPGPEVAEQL++YQ TL+ K KQ+K + +ETNMYESQIKE+K+E+EKLA+E Q+VK+KYF QKK+E+ +++RE  +  L       N  IQPQR  +Q RFTGGGF+L + K
Sbjct:   14 MDDSAFDTLEKDFQEVLQELQGNKGLDKFKLEYEKLMRALQKSHESEKRLMQKCRELKAEIVANSAKMTSALKLSEEDQATIASLKKEIEKAWKMVDAAHDKEARARDTIQSLKLEIANLSKLVEQGAGLTSGQDQNVSELLEAKEELTKQRDELMQQNSHLRDELEENKSQKLRLETDLTDCQTKVAELEQEIQTKNSEATREQRKKEKMERDLKQAKAEAEAKEGEIQTLRSRLAGVTQENKTREEEIRATKAELEKAQRHQHFLETKIKDDTMVLNDQRQRVQQLIGDNQSKTLELKQREDEVNSLKSEIQKLVRVRETTLRKLRLTEDNKSNLEGQREQLKNEIHGMEKEMDLIKKANEQDKKVVDELTRERDILNKNLIKAANATEKQRGMVKLHEASKKTLEQEIENYKDEAQKQRKIIYQLEKERDRYINEASDLTQKVLQHMEDVKVREMQIFDYKKKIAEAETRLRQQQNLYEAVRSDRNLYSKNLIEAQDEITELKRKHKIMSHQIDQLKEETAMKDGQLVKENMERQKVEKEKDQLSKELQAMKKLHKENSDYIEAQEVEKKKLTKMINEADAERLRQKKELDKLVSERDILGTQLVRRNDELALLYEKIKIQQSLLNKGEVQYNQRLEDIRVLKLEIKKLRREKALLQRTVHNVDELRREVYHLQKELLRERTRCKALEEELENPMNVHRWRKL---------------EGSDPSTYEMIQKIQTLQKRLILKTEEVVEKELLIQEKEKLYIELKHILARQPGPEVAEQLSIYQQTLRDKTKQMKAMAAETNMYESQIKEYKYEIEKLARELQEVKKKYFQQKKKEQAVRERERAIEALQMGGAPGNPPIQPQRT-DQARFTGGGFSLTKTK 881          
BLAST of Cilia-and flagella-associated protein 58 vs. TrEMBL
Match: gnl|BL_ORD_ID|20329765 (tr|A0A1S3I8U9|A0A1S3I8U9_LINUN cilia- and flagella-associated protein 58 OS=Lingula unguis OX=7574 GN=LOC106162069 PE=4 SV=1)

HSP 1 Score: 964.911 bits (2493), Expect = 0.000e+0
Identity = 568/882 (64.40%), Postives = 703/882 (79.71%), Query Frame = 2
Query:   98 AIDDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNIEQNRFTGGGFNLNQV 2743
            +IDDSAFEALEKDFQ +L +L G+  LDKF+ EYEK+ +AL KSH+SEKRLMQKCREL AEIV+N++KV+TA+KLSQEDQ TI+SL+KEIEKAWKMVDSA EKE +ARETIQSLKLEI NL+KLVEQGAGL+ GQE SV +LLK K+ LTKERD  ++E  K+R+    +     KLE D  +   KI +L  +IQ RN EAQRE +KK+K+E++LK  +A+++A+  EIK     +++ KQ++   + +L   +   E   +   I +A+ +  Q   ++Q+   + L  ENQ ++ +LK +EDEV  LK +  +L+K++E   +KLR+VED K +V+ Q+E LKS+I  L  EL+ ++K+ E D++  ++L +ERD LN+ + KA+  T KQ  LVK+HE SKKNLEQEI NYKEEAQKQRKII+QLEKERDRYINEASDLTQKVLQHMEDVK+REMQIFDYKKKI E ETKL+QQQNLYEAVR+DRN YSKNLIE+QDEITEMKRKLKIMNHQIDQL++EIS KE  L+KE  + Q+VEKEK+ L +ELQ+++ QAAENKA IE+Q+ E++KL KII E+D ERVRQKKEL+QVISERDILGTQLVR+NDEL+LLYEKIKIQQS LNKGE+QYNQRL+DIR+LKLEIKKLRREK+ILQKSVANVDDL+REVYH+QRELLRERTRCKALEEELENPMN+HRWRKL               EGSDPST+EMIQKIQTLQKRLI KTEEVVEKE+LIQEKEKLYVELKHILARQPGPEVAEQL +YQ TLK+K KQ+K + SE NMYESQ+ E+K+E+E+LA+E Q+VK+KY++QK++E+  K+RE  +      V    IQPQR  +  RFTGGGF+L Q 
Sbjct:   18 SIDDSAFEALEKDFQEVLQELMGDKSLDKFKTEYEKLHKALKKSHESEKRLMQKCRELNAEIVANAAKVSTALKLSQEDQATIASLRKEIEKAWKMVDSAHEKEQRARETIQSLKLEIENLSKLVEQGAGLTVGQEHSVNELLKIKEELTKERDDLLSEIVKVREQLAQASNEQQKLEADKEDCNMKITELQQDIQVRNNEAQRETRKKDKIERELKQARADLDAKASEIKTSQAQLERYKQDVTKLEAQLKEQRIMNERITKDSDILNARFQKLQQDYEAQLISADQLASENQTKVSDLKQKEDEVNALKAEASRLNKMRETIQRKLRNVEDSKGEVEGQKETLKSQIVGLERELEALKKQSEADRKAIDDLVRERDILNKNMLKAAAATQKQHNLVKLHEQSKKNLEQEIQNYKEEAQKQRKIIYQLEKERDRYINEASDLTQKVLQHMEDVKVREMQIFDYKKKIAEAETKLKQQQNLYEAVRSDRNLYSKNLIESQDEITEMKRKLKIMNHQIDQLKEEISAKEAALIKEHMDHQRVEKEKEALKAELQKMKQQAAENKAVIESQDQEQRKLLKIIAESDGERVRQKKELDQVISERDILGTQLVRRNDELALLYEKIKIQQSTLNKGEIQYNQRLEDIRVLKLEIKKLRREKSILQKSVANVDDLRREVYHIQRELLRERTRCKALEEELENPMNIHRWRKL---------------EGSDPSTYEMIQKIQTLQKRLIAKTEEVVEKELLIQEKEKLYVELKHILARQPGPEVAEQLQIYQQTLKEKTKQMKGMSSELNMYESQVNEYKYEIERLARELQEVKKKYYMQKRKEQQAKERERAIAQAGQPV----IQPQRT-DAPRFTGGGFSLKQT 879          
BLAST of Cilia-and flagella-associated protein 58 vs. TrEMBL
Match: gnl|BL_ORD_ID|23505281 (tr|A0A210PV48|A0A210PV48_MIZYE Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17111 PE=4 SV=1)

HSP 1 Score: 963.37 bits (2489), Expect = 0.000e+0
Identity = 579/885 (65.42%), Postives = 710/885 (80.23%), Query Frame = 2
Query:   95 PAIDDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNIEQNRFTGGGFNLNQVKT 2749
              IDDSAFE+LEKDFQ +L  L G+  L+KFR EYEK+ +AL KSH+SEKRLMQKCREL AEIV+NS+KVATA+KLSQEDQNTI+SLKKEIEKAWKMVD+A EKE +ARETIQSLK+EIANL+KLVEQGAGL+ GQE SV +LLK K+ LTKERD Q+ E  KLR+    +  +  KLE D +E + KI +L+ +IQ RN EAQRE +KK+K E++LK  KA++++++ EIK +   I + K+++   +++L   +   E   +   I + + +  Q + + Q+  T+ L  ENQNR+ ELK +EDEV  LK + Q+L+K++E   +KLR+VEDQK DV++Q+E LKS+I  L  EL+  +K+ E DK++ ++L +E+D LN+ + KA   T KQ+ LVK+HE SKKNLEQ+I NYKEEAQKQRKII+QLEKERDRYINEASDLTQKVL HMEDVK+REMQIFDYKKKI E ETKL+QQQNLYEAVR+DRN YSKNLIE+QDEITEMKRKLKIMNHQIDQL++EI  KE  LVKE  E Q+VEKEKD L  +L +++ QAAE+KAYI+AQEAEE+KL KII EADAERVRQKKEL+QVISERDILGTQLVR+NDEL+LLYEKIKIQQS LNKGE+QYNQRL+DIR+LKLEIKKLRREK+IL KSVANV+DL+REV+H+Q ELLRERTRCKALEEELENPMN+HRWRKL               EGSDPST+EMIQKI TLQKRLI+KTEEVVEKE+LIQEKEKLY+ELKHILARQPGPEVAEQL +YQ TLK+K KQ+K++ SE NMYESQ+ E+K+E+E++A+E  +VK+KYF+QKK+E+  K+RE  +    N      IQPQR  E  RFTGGGFNL   KT
Sbjct:   56 TGIDDSAFESLEKDFQEVLQQLTGDRSLEKFRSEYEKLHKALKKSHESEKRLMQKCRELNAEIVANSAKVATALKLSQEDQNTITSLKKEIEKAWKMVDAAHEKETRARETIQSLKMEIANLSKLVEQGAGLTMGQEHSVNELLKIKEDLTKERDEQLGEIVKLRENLAQASAQQQKLEQDRSECEEKIQELSQDIQVRNNEAQRESRKKDKTERELKQAKADLDSKSGEIKTMQTQIGRYKEDVGKLEQQLKEQRILNERALKDCDILNTRFQKLQGEYEGQLITTDQLTAENQNRVSELKQKEDEVNQLKQETQRLNKIRETIQRKLRNVEDQKGDVEQQKETLKSQIIGLERELEASKKQAELDKKQIDDLVREKDILNKNMLKAISSTQKQLHLVKLHEQSKKNLEQDIQNYKEEAQKQRKIIYQLEKERDRYINEASDLTQKVLGHMEDVKVREMQIFDYKKKIAEAETKLKQQQNLYEAVRSDRNLYSKNLIESQDEITEMKRKLKIMNHQIDQLKEEIQAKEAALVKEHLEHQRVEKEKDTLKGDLNKMKQQAAESKAYIDAQEAEERKLLKIIAEADAERVRQKKELDQVISERDILGTQLVRRNDELALLYEKIKIQQSTLNKGEIQYNQRLEDIRVLKLEIKKLRREKSILNKSVANVEDLRREVHHIQTELLRERTRCKALEEELENPMNIHRWRKL---------------EGSDPSTYEMIQKIHTLQKRLISKTEEVVEKELLIQEKEKLYLELKHILARQPGPEVAEQLQIYQQTLKEKTKQMKSMSSELNMYESQVNEYKYEIERIARELVEVKKKYFMQKKKEQQTKERERAI----NQAGGPIIQPQRT-EGPRFTGGGFNLKSTKT 920          
BLAST of Cilia-and flagella-associated protein 58 vs. TrEMBL
Match: gnl|BL_ORD_ID|19135462 (tr|A0A4E0RKB9|A0A4E0RKB9_FASHE Cilia-and flagella-associated protein 58 OS=Fasciola hepatica OX=6192 GN=D915_008043 PE=4 SV=1)

HSP 1 Score: 960.288 bits (2481), Expect = 0.000e+0
Identity = 538/884 (60.86%), Postives = 717/884 (81.11%), Query Frame = 2
Query:   95 PAIDDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVN-NSSIQPQRNI-EQNRFTGGGFNLNQ 2740
            PA+DD+A+EALEK+F  +L++L+GN GL+KF++EYEK+MRA NKSH++EKRLM+KCRELKAEIVSNS+KVA AVKLS +DQ  +++LKKEIEKAWKMVD A EKE KARETI  LK EIA+L+KLVEQG   +SG + ++ ++ K K+ L +ERD    EN+KLR   E+++ R    +N++ E QNKI +L  EIQ +NTEAQREL+KKE+ME++LK  +AE+EA+ EE++  + +++K KQELK K+EE    K   E   RQ  +T+ KLR+ Q+KL++Q+QVT+S+  ENQ R+ E+K+RE+EV  +K + QKL K KEA+ +KLR  +++KA ++  R++L+SEI     E++ +RK  + D+R C+EL+KER+ LN+ L KA  QTNKQ  L+KMHE SK+NLEQEI+NY++EAQKQRKII++LE+ERDRYI EAS+LTQKVLQHM+++K REMQIF+ KK+I E ETKL+QQQNLYEAVR+DRN YSKNLIEAQDEI EMKRKLK+++HQIDQL+D+I+TKE  LVKE  E+QKV+KEK+QL  +LQR++ QAAEN+AYIEAQEAEE KL KI+ EA+ ER+R++KE EQVI+ERD+LG+QLVR+NDEL+LLYEKI+IQQS+++KGE QYN++L D+ LLK E++KLRREK +LQ +   ++DLK EV+ +QR+L+RERTR +ALEEEL+NP+NVHRWRKLE+ YF+ WR+F +LPEGSDPST+EMI KIQ LQKRLI+KTEEVVEKE+LIQEKEKLYVELKHILARQPGPEVAEQL +YQ  ++ K KQ+K + +E N+YE+QI ++K EL+ L KE +++K++YF QKK +++  + E   +   N +N N+SI+PQ    E+ +FTGGGF L Q
Sbjct:   19 PAVDDNAYEALEKEFDEVLNELEGNKGLEKFKEEYEKLMRAFNKSHENEKRLMKKCRELKAEIVSNSAKVAQAVKLSSDDQGNMTALKKEIEKAWKMVDDAAEKETKARETIDRLKGEIAHLSKLVEQGGTAASGVD-NLAEMTKMKEKLIRERDEHQDENRKLRQQIEETRTRTVNYQNELLESQNKITELTQEIQAKNTEAQRELRKKERMERELKQVRAEVEAKMEEMRLTSTAVEKLKQELKQKEEENRGTKVSLEQASRQLQVTETKLRECQSKLETQMQVTDSVMVENQTRLAEVKHREEEVASMKAECQKLLKQKEASQRKLRQTDEEKAQLEATRDRLRSEIQAYENEMEMMRKSLDSDRRACDELSKEREQLNKSLTKAIAQTNKQSNLLKMHEMSKQNLEQEIINYRDEAQKQRKIIYRLERERDRYITEASELTQKVLQHMDELKYREMQIFENKKRIAEAETKLKQQQNLYEAVRSDRNLYSKNLIEAQDEIIEMKRKLKVLSHQIDQLKDDIATKEAILVKENLERQKVDKEKEQLARDLQRMKVQAAENRAYIEAQEAEEGKLLKIVAEAEQERLRERKEHEQVITERDVLGSQLVRRNDELALLYEKIRIQQSVISKGEKQYNEKLRDLNLLKQEVRKLRREKAMLQSTTCKINDLKSEVHRVQRDLIRERTRARALEEELQNPVNVHRWRKLEIYYFDGWRDFNFLPEGSDPSTYEMILKIQVLQKRLISKTEEVVEKELLIQEKEKLYVELKHILARQPGPEVAEQLNIYQNMIRDKTKQMKAMAAEMNLYENQIVQYKGELDILNKEMRELKKRYFAQKKNKRLAPEAE---IETANNMNQNNSIKPQNTKDERGKFTGGGFRLTQ 898          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Cavefish
Match: ENSAMXT00000040425.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:13246345:13252579:1 gene:ENSAMXG00000032928.1 transcript:ENSAMXT00000040425.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 1.976e-22
Identity = 47/77 (61.04%), Postives = 66/77 (85.71%), Query Frame = 2
Query: 1208 EELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKV 1438
            +EL +E+D L++ + KA++ T KQ +LV++ + +KK L+QEIL YK+EAQKQRKIIFQLE+ERD++IN+ASDLTQKV
Sbjct:    2 DELVREKDTLHKNMIKAANATEKQQDLVRLQKQTKKTLDQEILAYKDEAQKQRKIIFQLEQERDKHINDASDLTQKV 78          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005099.1 (pep scaffold:Pmarinus_7.0:GL476392:969020:986502:-1 gene:ENSPMAG00000004604.1 transcript:ENSPMAT00000005099.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 920.998 bits (2379), Expect = 0.000e+0
Identity = 546/883 (61.83%), Postives = 703/883 (79.61%), Query Frame = 2
Query:   95 PAI-DDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLR-DLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNIEQNRFTGGGFNLN 2737
            P + D+  FE+LE+DFQ +L +L G+  L+KFRDEYEK+ RAL KSHD+EKRLM KCREL AEIV+NS+KV+TA+KLSQEDQ +I+SLKKEIEKAWKMVD+A EKE +A+ETIQ+LK EI NL K+VEQGAG+S GQE ++ DLLKAK+ LTKERD  +++  +LR DLA+ +  +  K+E D+ E +  I++L  +IQ R  +  RE ++KEK+E+++K  + +I+ ++ E KNL   + + K EL+ ++++L       E T ++     A+    Q + D +V + + L QENQ    ELK REDEV  +K+++ +L+K++E T KKLR VEDQK +V++QRE LK++ISR+  E +  +K+ E DK+  +EL +E++ LN+ + KA+ +T KQV +V++HE SK+NLEQEI NYK+EAQKQRKIIFQLEKERDRYINEASDLTQKVL HMEDVK+REMQIFDYKKKI E ETKL+QQQNLYEAVR+DRN YSKNLIEAQDEITE KRKLKIMNHQIDQL++EI+ KE  LVKE  E Q+VEKE++ L  ELQR++ QAAE KA+I++QE EE+KL +II EAD +R+RQKKEL+QV++ERD+LGTQLVR+NDEL+LLYEKIKIQQS LNKGEVQY QRL+DIRLLKLEI+KLRREKNIL +S ANV+DL+REVYH+QR+LLRERTRCKALEEELENPMN+HRWRKL               EGSDPST+E+IQKI  LQKRLITKTEEVVE+E+LIQEKEKLYVELKHILARQPGPEVAEQL +YQ TL++K KQ+K+L SE NMYESQ +E+K+E+E+L++E Q+VK+KY +QK++E+  K R+  +   ++G   S IQPQR  +  RFTGGGF+++
Sbjct:    8 PVVGDEGTFESLERDFQEVLSELTGDKSLEKFRDEYEKLHRALKKSHDNEKRLMTKCRELNAEIVANSAKVSTALKLSQEDQASIASLKKEIEKAWKMVDAAHEKEQRAKETIQTLKQEITNLAKMVEQGAGISQGQEYNLNDLLKAKEDLTKERDGLLSDVVRLREDLAQ-ATTQQQKMEQDMTEVEQTISELQQDIQMRQNDIMRETRRKEKLEREVKQMQMDIDNKHAENKNLQGHLQRSKDELQRQEQQLKDQNIQNERTIKESESLKARSMKLQQEYDQKVMLVDQLAQENQQSSAELKAREDEVFQMKHEITRLTKMREMTQKKLRQVEDQKTEVEQQREILKNQISRMEKEAEASKKQIEADKKVIDELQREKELLNKNIGKAAGETQKQVHMVRLHEQSKRNLEQEIHNYKDEAQKQRKIIFQLEKERDRYINEASDLTQKVLLHMEDVKVREMQIFDYKKKIAEAETKLKQQQNLYEAVRSDRNLYSKNLIEAQDEITETKRKLKIMNHQIDQLKEEITAKEATLVKEHMENQRVEKEREALKVELQRMKQQAAETKAFIDSQEVEERKLLRIISEADQDRLRQKKELDQVLTERDVLGTQLVRRNDELALLYEKIKIQQSTLNKGEVQYRQRLEDIRLLKLEIRKLRREKNILTRSTANVEDLRREVYHMQRDLLRERTRCKALEEELENPMNIHRWRKL---------------EGSDPSTYELIQKIHMLQKRLITKTEEVVERELLIQEKEKLYVELKHILARQPGPEVAEQLQIYQQTLREKTKQMKSLASELNMYESQCQENKYEMERLSRELQNVKKKYLIQKRKEQQTKQRDREIALAESGA--SLIQPQRT-DMPRFTGGGFSMS 871          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005509.1 (pep scaffold:Pmarinus_7.0:GL476755:198637:219471:-1 gene:ENSPMAG00000005005.1 transcript:ENSPMAT00000005509.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 1.128e-8
Identity = 70/318 (22.01%), Postives = 157/318 (49.37%), Query Frame = 2
Query: 1448 MEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQ-----KKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKL 2386
            +++VK +++ I D+KK+  E+  +L++   LY  ++ +RN+ +  ++ A  +  E + KLKI+ ++++ L    S+K   + K++ + Q V   +D   ++  R      E +   E  +  ++ L ++   A  ER +      +   E+ + +R    +QL+    E+  LYE++ +  +   +G V      ++ R L +   +  R+  + ++   +   L  ++  L  +LL+ +   + LE +LE+P               E R   +L EG D S  E+ +K + L+++L  K E+++EK++++++  +L
Sbjct:  408 LQEVKAKDLSIVDHKKRHQEIVLRLKEFSQLYNVIKLERNRCANMILAAAQQSAETREKLKILENELEILVSSSSSKALMIQKQRKKHQTVALSRDTARADTTRC---GREGRELEERHQRSQEALARL--RAHVERAQSGSRELRSRYEEAVRQRRARASQLLELEGEVCALYERLHVGDTAAREGHVALQALEEEARFLAMARLEETRQLGLARRDGPSRRMLDEQLIGLHLQLLQYQDHIRELEGQLEDP---------------EGRRVRFL-EGKDLSPSELARKTEELEEQLAHKEEQLLEKQLVLEQVSRL 704          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Nematostella
Match: EDO42722 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S4])

HSP 1 Score: 231.876 bits (590), Expect = 4.145e-71
Identity = 137/163 (84.05%), Postives = 152/163 (93.25%), Query Frame = 2
Query: 1733 DQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLE 2221
            D L +ELQR++ QAAE+KAYIE QEAEE+KL KII EADAER+RQKKEL+QVI ERDILGTQLVR+NDEL+LLYEKIKIQQS LNKGE+QY QRL+DIRLLKLEIKKLRREKNIL K+VANV+DL+REVYH QRELLRERTRCKALEEELENPMN+HRWRKLE
Sbjct:    6 DALKAELQRMKQQAAESKAYIEQQEAEERKLLKIISEADAERMRQKKELDQVIGERDILGTQLVRRNDELALLYEKIKIQQSTLNKGEIQYRQRLEDIRLLKLEIKKLRREKNILTKNVANVEDLRREVYHHQRELLRERTRCKALEEELENPMNIHRWRKLE 168          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Nematostella
Match: EDO42721 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S3])

HSP 1 Score: 126.716 bits (317), Expect = 9.542e-35
Identity = 62/74 (83.78%), Postives = 68/74 (91.89%), Query Frame = 2
Query: 1472 MQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLV 1693
            MQIFDYKKKI E ETKL+QQQNLYEAVR+DRN YSKNLIE+QDEITEMKRKLKIMNHQIDQL++EI+ KE  LV
Sbjct:    1 MQIFDYKKKIAEAETKLKQQQNLYEAVRSDRNLYSKNLIESQDEITEMKRKLKIMNHQIDQLKEEITAKEATLV 74          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Nematostella
Match: EDO49671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFV9])

HSP 1 Score: 100.908 bits (250), Expect = 9.252e-22
Identity = 111/387 (28.68%), Postives = 213/387 (55.04%), Query Frame = 2
Query: 1448 MEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDE-ITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHI--LARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAK-EHQDVKQKYF 2596
            +ED+K + + I D  KK  E++ +L     LY+ ++ +RN+   NLI+   +   EM+ K+KI+ ++I+ LR +++ K+  L K + ++      +D L +E  +   Q  E++   E    +  KL ++I +A+   V+ +K  E  + ER+ +G QL+ +N+E+ + YEK+ IQ +++  G+V+   R ++IR LK+E+ ++RR   +  K++ N   L  E+  LQ +L   R R   LE+ELE+P N  R R L                G+DP    + +KI+ L+ RL  K E+++EK+++ +E  +L    K+     ++   E+A+++  YQ  +K   +++  +VSE +M ++    +  +L+++ K + Q+V+Q Y 
Sbjct:  480 LEDLKTKNLNIQDSAKKYAEMQHRLSDFAKLYDVIKNERNKCV-NLIQTSTQKAAEMREKIKILQNEIEILRSKVNAKDRLLQKARLKRSNAVVIRDSLRNEASKQGKQDEESREKREQLRLDIAKLNELINKAEENMVQLRKRYETSVQERNDMGIQLIERNEEVCVFYEKLNIQDTMIRNGDVELKAREEEIRFLKMELNEIRRGIGLANKNMPNKRALDNELVTLQIQLAAARDRLADLEKELEDPSNEERVRLL---------------SGADPEPDILAKKIEELELRLAEKEEKLLEKDLIFEEVTRLADRTKNKAETGKEDTLELAKKVNEYQAKIKDTTRKMMAMVSELSMNQA----NALKLQQVVKGKEQEVEQAYI 846          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Nematostella
Match: EDO42723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S5])

HSP 1 Score: 80.1073 bits (196), Expect = 2.187e-18
Identity = 40/81 (49.38%), Postives = 56/81 (69.14%), Query Frame = 2
Query: 2498 VSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNIEQNRFTGGGFNLNQ 2740
             SE NMYE+Q+KE+K+E+E+LAKE QD K+KY++QK++E+  K+RE  +          +  PQR  +  RFTGGGFNL Q
Sbjct:    2 ASELNMYEAQVKEYKYEVERLAKELQDAKKKYYMQKRKEQQSKERERAI----QQATGPAFVPQR-TDGPRFTGGGFNLRQ 77          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Medaka
Match: cfap58 (cilia and flagella associated protein 58 [Source:NCBI gene;Acc:101173115])

HSP 1 Score: 509.605 bits (1311), Expect = 8.810e-167
Identity = 383/884 (43.33%), Postives = 577/884 (65.27%), Query Frame = 2
Query:  107 DSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQE-----LKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNI-EQNRFTGGGFNLNQ 2740
            D A E++E+ FQ +L +L G    DK R E+EK+  AL KS ++EKRL  KCREL AE+VS+S+KVA A+KLSQED+ T++SLK+E++KAWKMVD+A ++E K  E I+ LK E++ LT+  +      S     V +L K       ERD  M + + LR    ++     +LE    +    +A L  E+Q +  +  RE++ KEK++K+++    ++EA+  EIK+L++ + K K+E     L +K++ +   +S  E  Q Q     A+    Q + +        L  +NQ    ELK RE+EV+ ++ ++ K +K +E   KK   +E+QKADV+ Q E LK++ + L  +L+  +K+ E +K+  +EL +ERD L++ + KA   + KQ   +K+ E  K++LEQEI  Y++EAQKQRKII QLEKERDR+I+E+S L QKV Q M DVK+++++I D+KKK+ E E KL+QQ++L E+V ++RN YSK++ EAQDEITE+KR+++ +++Q+ +L++EIS K       +AE ++++KE + L  ELQ ++ Q  E K + ++Q AE++ L KII + D+E  R K +L+QV  ERD LG QL+ +NDE SLLYEKI+IQQSIL KG+  Y QRL+DIRLLKLEIK+L+ +K+ + +++ N ++L++E+ HLQ+EL+RER R  ALEE+L  P+N+HRWR+L               EG DP  + +IQKIQ LQKRLITKT+E+ E+E+L+QEKEKLYVELK +LAR+PGPE AEQL  Y+ TL+ ++K+LK L +E  M +S++ E+K E  +L+ E  ++K+KY  QKK          L   Q        ++P   +  ++ FTGGGF L+Q
Sbjct:    7 DDASESVEQ-FQAVLSELVGGESADKIRGEFEKLTHALKKSQENEKRLRSKCRELNAEVVSSSTKVAAALKLSQEDETTLTSLKRELDKAWKMVDAAHDREKKDSEAIRVLKEEVSKLTQQTDNNRDQHSELFRKVEELTK-------ERDELMAKGEDLRKRLNEAHAAQQELETQREKASQTLAQLQQELQVQQNDISREVRLKEKLDKEVQQLHTDMEAKLGEIKSLSLQVQKAKEEQQRLELLLKEQRMLNDRSTKELEQMQ-----ARKSKLQQEFEQLASTKERLLVDNQQITNELKMREEEVSQMRQEISKQTKTRETVQKKFWQMEEQKADVEVQMEVLKAQTAALEKDLEAAKKQVETEKKAKDELIRERDILSKNVMKAVQSSEKQQNAMKLLELDKRSLEQEISGYQQEAQKQRKIIQQLEKERDRHIDESSSLMQKVQQRMNDVKVKDVEICDWKKKVAEAECKLKQQESLLESVMSERNLYSKSIAEAQDEITELKRRIRTLSNQVSRLKEEISIKHQDCASSQAEHKRLDKENENLREELQSMKLQLEETKKHFDSQRAEQQNLHKIISDNDSEYTRLKGQLQQVTGERDSLGKQLLHRNDERSLLYEKIRIQQSILAKGDFHYKQRLEDIRLLKLEIKRLQCKKSRMDRTMPNTEELRQELIHLQKELIRERVRNSALEEQL-KPINIHRWRQL---------------EGGDPGKYLLIQKIQCLQKRLITKTQELEEQELLLQEKEKLYVELKTMLARRPGPEAAEQLWQYEFTLRDRSKKLKVLTAELRMLDSEMNEYKSENHRLSSELANIKKKYLCQKK----------LCSEQRTRPKLEQLEPLPQLSSRSHFTGGGFRLDQ 851          
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Medaka
Match: cfap58 (cilia and flagella associated protein 58 [Source:NCBI gene;Acc:101173115])

HSP 1 Score: 458.373 bits (1178), Expect = 1.158e-147
Identity = 356/884 (40.27%), Postives = 544/884 (61.54%), Query Frame = 2
Query:  107 DSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQE-----LKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNI-EQNRFTGGGFNLNQ 2740
            D A E++E+ FQ +L +L G    DK R E+EK+  AL KS ++EKRL  KCREL AE+VS+S+KVA A+KLSQED+ T++SLK+E++KAWKMVD+A ++E K  E I+ LK E++ LT+  +      S       +L +  + LTKERD  M + + LR    ++     +LE    +    +A L  E+Q +  +  RE++ KEK++K+++    ++EA+  EIK+L++ + K K+E     L +K++ +   +S  E  Q Q     A+    Q + +        L  +NQ    ELK RE+EV+ ++ ++ K +K +E   KK   +E+QKADV+ Q E LK++ + L  +L+  +K+ E +K+  +EL +ERD L++ + KA   + KQ   +K+ E  K++LEQEI  Y++EAQKQRKII QLEKERDR+I+E+S L QKV Q M DVK+++++I D+KKK+ E E KL+QQ++L E+V ++RN YSK++ EAQDEITE+KR+++ +++Q+ +L++EIS K       +AE ++++KE + L  ELQ ++ Q  E K + ++Q AE++ L KII + D+E  R K +L+QV  ERD LG QL+ +NDE SLLYEKI+IQQSIL KG+  Y QRL+DIRLLKLEIK+L+ +K+ + +++ N ++L++E+ HLQ+EL+RER R  ALEE+L  P+N+HRWR+L               EG DP  + +IQKIQ LQKRLITKT+E+ E+E      + L  EL+                                     M +S++ E+K E  +L+ E  ++K+KY  QKK          L   Q        ++P   +  ++ FTGGGF L+Q
Sbjct:    7 DDASESVEQ-FQAVLSELVGGESADKIRGEFEKLTHALKKSQENEKRLRSKCRELNAEVVSSSTKVAAALKLSQEDETTLTSLKRELDKAWKMVDAAHDREKKDSEAIRVLKEEVSKLTQQTDNNRDQHS-------ELFRKVEELTKERDELMAKGEDLRKRLNEAHAAQQELETQREKASQTLAQLQQELQVQQNDISREVRLKEKLDKEVQQLHTDMEAKLGEIKSLSLQVQKAKEEQQRLELLLKEQRMLNDRSTKELEQMQ-----ARKSKLQQEFEQLASTKERLLVDNQQITNELKMREEEVSQMRQEISKQTKTRETVQKKFWQMEEQKADVEVQMEVLKAQTAALEKDLEAAKKQVETEKKAKDELIRERDILSKNVMKAVQSSEKQQNAMKLLELDKRSLEQEISGYQQEAQKQRKIIQQLEKERDRHIDESSSLMQKVQQRMNDVKVKDVEICDWKKKVAEAECKLKQQESLLESVMSERNLYSKSIAEAQDEITELKRRIRTLSNQVSRLKEEISIKHQDCASSQAEHKRLDKENENLREELQSMKLQLEETKKHFDSQRAEQQNLHKIISDNDSEYTRLKGQLQQVTGERDSLGKQLLHRNDERSLLYEKIRIQQSILAKGDFHYKQRLEDIRLLKLEIKRLQCKKSRMDRTMPNTEELRQELIHLQKELIRERVRNSALEEQL-KPINIHRWRQL---------------EGGDPGKYLLIQKIQCLQKRLITKTQELEEQE---LLLQVLTAELR-------------------------------------MLDSEMNEYKSENHRLSSELANIKKKYLCQKK----------LCSEQRTRPKLEQLEPLPQLSSRSHFTGGGFRLDQ 811          
BLAST of Cilia-and flagella-associated protein 58 vs. Planmine SMEST
Match: SMESG000061980.1 (SMESG000061980.1)

HSP 1 Score: 1603.19 bits (4150), Expect = 0.000e+0
Identity = 885/885 (100.00%), Postives = 885/885 (100.00%), Query Frame = 2
Query:   95 PAIDDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNIEQNRFTGGGFNLNQVKT 2749
            PAIDDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVTDLLKAKDLLTKERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRELKKKEKMEKDLKSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVKEKAEKQKVEKEKDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQRLDDIRLLKLEIKKLRREKNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQITLKQKNKQLKTLVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNIEQNRFTGGGFNLNQVKT
Sbjct:   16 PAIDDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVTDLLKAKDLLTKERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRELKKKEKMEKDLKSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVKEKAEKQKVEKEKDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQRLDDIRLLKLEIKKLRREKNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQITLKQKNKQLKTLVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNIEQNRFTGGGFNLNQVKT 900          
BLAST of Cilia-and flagella-associated protein 58 vs. Planmine SMEST
Match: SMESG000061980.1 (SMESG000061980.1)

HSP 1 Score: 1556.19 bits (4028), Expect = 0.000e+0
Identity = 870/885 (98.31%), Postives = 870/885 (98.31%), Query Frame = 2
Query:   95 PAIDDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVXXXXXXXXXXXXERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRXXXXXXXXXXXXXSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQIXXXXXXXXXXXXVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNIEQNRFTGGGFNLNQVKT 2749
            PAIDDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVTDLLKAKDLLTKERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRELKKKEKMEKDLKSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVKEKAEKQKVEKEKDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQRLDDIRLLKLEIKKLRREKNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKL               EGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQITLKQKNKQLKTLVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNIEQNRFTGGGFNLNQVKT
Sbjct:   16 PAIDDSAFEALEKDFQNILHDLQGNGGLDKFRDEYEKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTISSLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSGQEMSVTDLLKAKDLLTKERDSQMTENKKLRDLAEDSKVRIAKLENDIAEGQNKIADLNSEIQTRNTEAQRELKKKEKMEKDLKSTKAEIEARNEEIKNLTVSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQVTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQKADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLLKKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERDRYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVKEKAEKQKVEKEKDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQRLDDIRLLKLEIKKLRREKNILQKSVANVDDLKREVYHLQRELLRERTRCKALEEELENPMNVHRWRKL---------------EGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLAMYQITLKQKNKQLKTLVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFLQKKREKMLKDRESLLLAQDNGVNNSSIQPQRNIEQNRFTGGGFNLNQVKT 885          
BLAST of Cilia-and flagella-associated protein 58 vs. Planmine SMEST
Match: SMESG000006416.1 (SMESG000006416.1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.898e-13
Identity = 97/334 (29.04%), Postives = 176/334 (52.69%), Query Frame = 2
Query: 1481 FDYKKKIYELETKLRQQQNLYEAVRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVXXXXXXXXXXXXXDQLNSELQR---LRSQAAENKAYIEAQEAEEKKLTKIIVEADAERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEVQYNQXXXXXXXXXXXXXXXXXXXNILQKSVANVDDLKREV--YHLQRELLRERTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQKIQTLQKRLITKTEEVVEKEMLIQEKEKLYVEL--KHILARQPGPEVAEQLAMYQI 2461
             DY+KK  E++ KL     LY  ++ +RN+ +  +       +EM+ K++I+N++I+ LR  +  K+  + K++++  ++   +D L SE+ +   L S+  E +  I   + E  +L ++  +A+   V  +K+ +  +  R+    QL+ +N+E+ +L EK   ++ I++ GE +   R+D I  +K  IK+L+R+  IL+K+  N +  +REV  Y +Q E+ R+  R   LE E ENP    R +KL                G DPS  E+  K + L  +LI K E  +EKE+L++   +L  EL  K + +R    ++A+ L  Y+ 
Sbjct:  527 LDYEKKKKEIQLKLEDFAKLYNVIQMERNKCANLINTVTHRSSEMREKIRILNNEIEILRTNLVQKDKYVQKQRSKLTEIIATRDSLQSEVSKKNMLLSKQKEKRNEI---QLEINRLNQLGNQAEETMVLLRKQNDLALQNRNDRALQLIERNEEVCILQEKFNFKEEIISAGEKEIQIRMDKIDFMKQNIKELKRQIEILRKTSMNKNQFEREVVNYKIQLEICRD--RLAELEFEAENPDLETRIKKL---------------NGEDPSPIELQSKFEELHIKLIYKEECFMEKELLLEAVSRLANELQNKVLSSRVDTVDLAKTLNNYKF 840          
The following BLAST results are available for this feature:
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CFAP580.000e+058.94cilia and flagella associated protein 58 [Source:H... [more]
CFAP585.426e-2667.95cilia and flagella associated protein 58 [Source:H... [more]
CCDC1468.495e-1325.71coiled-coil domain containing 146 [Source:HGNC Sym... [more]
LAMA24.778e-1121.41laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HG... [more]
LAMA29.558e-1120.99laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epi-12.938e-921.30Laminin-like protein epi-1 [Source:UniProtKB/Swis... [more]
epi-12.940e-921.30Laminin-like protein epi-1 [Source:UniProtKB/Swis... [more]
epi-12.989e-921.30Laminin-like protein epi-1 [Source:UniProtKB/Swis... [more]
epi-13.040e-921.30Laminin-like protein epi-1 [Source:UniProtKB/Swis... [more]
epi-13.041e-921.30Laminin-like protein epi-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ORY6.292e-2528.10gene:FBgn0046323 transcript:FBtr0346720[more]
CG60592.811e-2138.14gene:FBgn0039491 transcript:FBtr0085130[more]
CG58824.654e-2124.54gene:FBgn0039490 transcript:FBtr0085109[more]
back to top
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cfap580.000e+054.75cilia and flagella associated protein 58 [Source:Z... [more]
cfap580.000e+055.70cilia and flagella associated protein 58 [Source:Z... [more]
back to top
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mrps175.530e-15154.61mitochondrial ribosomal protein S17 [Source:Xenbas... [more]
CCDC1467.236e-1628.43coiled-coil domain containing 146 [Source:NCBI gen... [more]
CCDC1468.714e-1628.43coiled-coil domain containing 146 [Source:NCBI gen... [more]
CCDC1461.983e-1428.12coiled-coil domain containing 146 [Source:NCBI gen... [more]
back to top
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Cfap580.000e+059.34cilia and flagella associated protein 58 [Source:M... [more]
Cfap584.642e-5367.16cilia and flagella associated protein 58 [Source:M... [more]
Ccdc1464.033e-1124.84coiled-coil domain containing 146 [Source:MGI Symb... [more]
Lama22.879e-618.80laminin, alpha 2 [Source:MGI Symbol;Acc:MGI:99912][more]
back to top
BLAST of Cilia-and flagella-associated protein 58 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B2RW38|CFA58_MOUSE0.000e+059.34Cilia- and flagella-associated protein 58 OS=Mus m... [more]
sp|Q5T655|CFA58_HUMAN0.000e+058.94Cilia- and flagella-associated protein 58 OS=Homo ... [more]
sp|A8HUA1|CFA58_CHLRE0.000e+049.53Cilia- and flagella-associated protein 58 OS=Chlam... [more]
sp|Q8IYE0|CC146_HUMAN4.080e-1225.71Coiled-coil domain-containing protein 146 OS=Homo ... [more]
sp|Q66H60|CC146_RAT1.921e-1024.84Coiled-coil domain-containing protein 146 OS=Rattu... [more]
back to top
BLAST of Cilia-and flagella-associated protein 58 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|177144320.000e+065.80tr|A0A2G8L5A5|A0A2G8L5A5_STIJA Putative coiled-coi... [more]
gnl|BL_ORD_ID|157697500.000e+066.06tr|A0A1I8GJV9|A0A1I8GJV9_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|203297650.000e+064.40tr|A0A1S3I8U9|A0A1S3I8U9_LINUN cilia- and flagella... [more]
gnl|BL_ORD_ID|235052810.000e+065.42tr|A0A210PV48|A0A210PV48_MIZYE Uncharacterized pro... [more]
gnl|BL_ORD_ID|191354620.000e+060.86tr|A0A4E0RKB9|A0A4E0RKB9_FASHE Cilia-and flagella-... [more]
back to top
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000040425.11.976e-2261.04pep primary_assembly:Astyanax_mexicanus-2.0:12:132... [more]
back to top
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005099.10.000e+061.83pep scaffold:Pmarinus_7.0:GL476392:969020:986502:-... [more]
ENSPMAT00000005509.11.128e-822.01pep scaffold:Pmarinus_7.0:GL476755:198637:219471:-... [more]
back to top
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO427224.145e-7184.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427219.542e-3583.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496719.252e-2228.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427232.187e-1849.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cilia-and flagella-associated protein 58 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cfap588.810e-16743.33cilia and flagella associated protein 58 [Source:N... [more]
cfap581.158e-14740.27cilia and flagella associated protein 58 [Source:N... [more]
back to top
BLAST of Cilia-and flagella-associated protein 58 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000061980.10.000e+0100.00SMESG000061980.1[more]
SMESG000061980.10.000e+098.31SMESG000061980.1[more]
SMESG000006416.11.898e-1329.04SMESG000006416.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026782 ID=SMED30026782|Name=Cilia-and flagella-associated protein 58|organism=Schmidtea mediterranea sexual|type=transcript|length=2808bp
CTATAAGTAACCATAGCGTTGTCCTTAGCGCATTTCAAGAAATTTGAAAA
TGTCTGAGGAATTTGAAAAGAAAGAAATAAAAGAGTCCATCAAACCAGCC
ATAGATGACAGTGCATTTGAAGCATTAGAGAAGGATTTTCAAAATATTCT
TCATGATCTTCAAGGAAATGGTGGCTTAGATAAATTCAGAGATGAATATG
AGAAAATAATGAGAGCTTTAAATAAATCCCACGACAGTGAAAAACGCTTA
ATGCAAAAATGCCGTGAATTAAAAGCTGAAATTGTTTCAAATTCATCTAA
AGTTGCAACCGCAGTCAAGTTATCTCAAGAAGATCAAAATACTATTTCTT
CTTTAAAGAAAGAAATTGAAAAAGCTTGGAAAATGGTTGACTCAGCAACA
GAAAAAGAAAACAAAGCCAGGGAAACCATTCAAAGTTTGAAATTGGAAAT
AGCGAATTTGACTAAATTGGTTGAGCAAGGCGCGGGATTGTCAAGTGGGC
AAGAAATGAGCGTCACTGATCTGTTAAAGGCTAAAGATTTACTGACAAAA
GAACGAGATTCCCAAATGACAGAAAACAAGAAATTGCGCGATCTCGCTGA
AGATAGTAAAGTTCGAATTGCAAAATTAGAAAATGATATTGCGGAGGGTC
AGAATAAAATTGCTGATTTGAATTCAGAAATACAGACTAGGAACACTGAG
GCCCAGCGTGAGTTGAAGAAAAAAGAAAAAATGGAAAAAGATTTGAAATC
AACAAAGGCTGAAATTGAAGCAAGAAATGAAGAAATAAAAAATCTCACCG
TTTCAATTGATAAACAAAAACAAGAATTGAAAATCAAAGATGAAGAGCTT
AGCAGGTTTAAGAGTGATTTTGAGCACACTCAGCGTCAACATGCTATAAC
CGACGCCAAATTAAGAGACCAACAGACAAAACTGGATTCTCAGGTTCAAG
TAACAAATTCTCTTTTTCAAGAAAATCAAAATCGAATGCTCGAGTTAAAA
AATCGAGAAGACGAAGTGACTATTTTAAAAAATGACGTTCAAAAGCTTTC
AAAACTCAAAGAAGCTACTAATAAAAAATTACGTTCCGTCGAAGATCAAA
AAGCAGATGTCGATAGACAACGAGAAAAGTTGAAATCGGAAATTTCACGA
CTCAATACTGAATTAGACAATATTAGAAAGGAACAAGAAGAAGACAAAAG
GAAGTGTGAGGAATTGACTAAAGAACGAGATAATCTGAATCGACTACTGA
AAAAAGCATCAGATCAGACAAACAAGCAAGTCGAACTAGTTAAAATGCAT
GAAACTTCGAAAAAGAATCTAGAACAAGAAATTCTAAATTATAAAGAAGA
AGCTCAAAAACAAAGAAAGATAATTTTTCAATTGGAAAAAGAACGAGATA
GGTATATTAATGAGGCATCTGATTTGACACAAAAAGTTCTCCAACACATG
GAAGATGTGAAGATCCGTGAAATGCAAATATTTGACTATAAGAAAAAAAT
CTATGAGCTAGAAACTAAACTAAGACAACAACAGAATTTGTATGAAGCAG
TTAGAGCTGATAGAAATCAATACAGTAAGAATCTTATAGAAGCTCAAGAT
GAAATTACAGAAATGAAAAGGAAGCTAAAAATAATGAATCATCAGATAGA
TCAACTTAGAGATGAAATTTCAACGAAAGAAACTTGTCTAGTTAAGGAAA
AAGCTGAAAAACAAAAGGTGGAAAAAGAAAAGGATCAATTAAACAGCGAA
CTTCAACGATTAAGATCCCAAGCAGCTGAAAACAAAGCTTATATCGAAGC
TCAAGAAGCAGAAGAAAAGAAATTAACAAAAATTATTGTCGAAGCCGATG
CTGAACGTGTTCGTCAGAAAAAAGAACTGGAACAGGTTATTAGTGAGCGA
GATATCCTGGGCACTCAATTGGTTAGGAAAAATGATGAGTTGTCTCTACT
TTATGAAAAAATCAAAATTCAACAATCCATTTTGAATAAAGGAGAAGTCC
AGTACAATCAAAGATTGGATGATATCCGTTTGTTGAAGCTGGAAATTAAA
AAACTTAGACGAGAAAAAAATATTCTACAGAAAAGTGTTGCCAATGTTGA
TGATCTTAAGCGAGAAGTTTATCATTTACAACGGGAATTACTGAGAGAAA
GAACTCGGTGCAAGGCTTTGGAAGAGGAATTGGAGAATCCAATGAATGTG
CACAGATGGCGGAAACTGGAGATGAACTATTTTGAAGAATGGAGAGAATT
CGAGTATTTGCCCGAGGGAAGTGATCCTTCTACCTTTGAGATGATTCAAA
AAATACAAACCCTGCAAAAACGTTTGATAACAAAAACCGAAGAAGTTGTG
GAAAAAGAAATGTTGATACAAGAAAAAGAGAAGCTATATGTGGAATTGAA
ACATATTTTAGCTCGCCAGCCAGGTCCCGAAGTTGCCGAGCAACTCGCAA
TGTATCAGATTACTTTGAAACAGAAAAACAAACAGTTGAAAACTCTAGTT
TCAGAAACGAACATGTATGAAAGCCAAATAAAAGAACACAAATTTGAATT
GGAAAAATTAGCAAAAGAACATCAAGATGTAAAACAAAAATATTTTTTGC
AGAAAAAGCGGGAAAAAATGTTGAAAGACAGAGAATCTTTACTCCTTGCC
CAGGATAACGGAGTAAATAATTCGTCAATACAACCCCAGAGGAACATTGA
ACAAAACCGATTTACAGGGGGTGGTTTTAATCTTAACCAAGTCAAAACAT
GATAGAGTGATATTTTCCTTAAATTATTACTACTTCGCTTCAAATTTATG
TTGTAATG
back to top

protein sequence of SMED30026782-orf-1

>SMED30026782-orf-1 ID=SMED30026782-orf-1|Name=SMED30026782-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=901bp
MSEEFEKKEIKESIKPAIDDSAFEALEKDFQNILHDLQGNGGLDKFRDEY
EKIMRALNKSHDSEKRLMQKCRELKAEIVSNSSKVATAVKLSQEDQNTIS
SLKKEIEKAWKMVDSATEKENKARETIQSLKLEIANLTKLVEQGAGLSSG
QEMSVTDLLKAKDLLTKERDSQMTENKKLRDLAEDSKVRIAKLENDIAEG
QNKIADLNSEIQTRNTEAQRELKKKEKMEKDLKSTKAEIEARNEEIKNLT
VSIDKQKQELKIKDEELSRFKSDFEHTQRQHAITDAKLRDQQTKLDSQVQ
VTNSLFQENQNRMLELKNREDEVTILKNDVQKLSKLKEATNKKLRSVEDQ
KADVDRQREKLKSEISRLNTELDNIRKEQEEDKRKCEELTKERDNLNRLL
KKASDQTNKQVELVKMHETSKKNLEQEILNYKEEAQKQRKIIFQLEKERD
RYINEASDLTQKVLQHMEDVKIREMQIFDYKKKIYELETKLRQQQNLYEA
VRADRNQYSKNLIEAQDEITEMKRKLKIMNHQIDQLRDEISTKETCLVKE
KAEKQKVEKEKDQLNSELQRLRSQAAENKAYIEAQEAEEKKLTKIIVEAD
AERVRQKKELEQVISERDILGTQLVRKNDELSLLYEKIKIQQSILNKGEV
QYNQRLDDIRLLKLEIKKLRREKNILQKSVANVDDLKREVYHLQRELLRE
RTRCKALEEELENPMNVHRWRKLEMNYFEEWREFEYLPEGSDPSTFEMIQ
KIQTLQKRLITKTEEVVEKEMLIQEKEKLYVELKHILARQPGPEVAEQLA
MYQITLKQKNKQLKTLVSETNMYESQIKEHKFELEKLAKEHQDVKQKYFL
QKKREKMLKDRESLLLAQDNGVNNSSIQPQRNIEQNRFTGGGFNLNQVKT
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0005615extracellular space
GO:0005929cilium
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 113..140
NoneNo IPR availableCOILSCoilCoilcoord: 547..616
NoneNo IPR availableCOILSCoilCoilcoord: 414..462
NoneNo IPR availableCOILSCoilCoilcoord: 176..273
NoneNo IPR availableCOILSCoilCoilcoord: 820..847
NoneNo IPR availableCOILSCoilCoilcoord: 316..409
NoneNo IPR availableCOILSCoilCoilcoord: 484..539
NoneNo IPR availableCOILSCoilCoilcoord: 652..710
NoneNo IPR availablePANTHERPTHR32083FAMILY NOT NAMEDcoord: 15..898
NoneNo IPR availablePANTHERPTHR32083:SF31CILIA- AND FLAGELLA-ASSOCIATED PROTEIN 58coord: 15..898