Iron-sulfur clusters transporter ATM1, mitochondrial

Overview
NameIron-sulfur clusters transporter ATM1, mitochondrial
Smed IDSMED30026771
Length (bp)2133
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Iron-sulfur clusters transporter ATM1, mitochondrial (SMED30026771) t-SNE clustered cells

Violin plots show distribution of expression levels for Iron-sulfur clusters transporter ATM1, mitochondrial (SMED30026771) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Iron-sulfur clusters transporter ATM1, mitochondrial (SMED30026771) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Iron-sulfur clusters transporter ATM1, mitochondrial (SMED30026771) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026771

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30026771h1SMcG0008904 SmedASXL_001335SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Human
Match: ABCB7 (ATP binding cassette subfamily B member 7 [Source:HGNC Symbol;Acc:HGNC:48])

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 355/636 (55.82%), Postives = 468/636 (73.58%), Query Frame = 1
Query:  130 RYCHHEHLS---HADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN-SQVLLD-----NNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSL--PDLIDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            R C H H     H D K         KIIK +  YVWP DRP ++ RV +S+G L G+K  NI +PF+FKY +D LN  S  +L+     N +A M   A++ GYG++R  A+  NE+RNAVF KVAQ+SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+LP +FEV LV+ +LY++ G  ++L+ +G +G+YT +T  VT WR + R EMN AD  AGN A+DSLLNYETVKYFNNE++EA +Y+  LK YE ASLK   +LA LNFGQ+ IFS+GL ++M L       ASQ  ++  LTVGDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L+ V ++   D  +  P  I P  +++ FDNV F Y            G ++L+G+SF V  G+KVAIVGGSGSGKSTI+RLL+RF++  +G I + GQ+I+ V+LESLRR+V V+PQD VLFH++I+YNL YGN+SASP++VY  A++A LHD+I+RMP  Y+T VGERGLKLSGGEKQRVAIARA+LK  P++LYDEATSSLDSITE+ +L A++    + TSI IAHRLSTV+DA  I+VL  G++ E+G+H  L+++PHS YS +WH Q+
Sbjct:   94 RTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSDAPNTVATM-ATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIMFEVMLVSGVLYYKCGAQFALVTLGTLGTYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNERYEAQRYDGFLKTYETASLKSTSTLAMLNFGQSAIFSVGLTAIMVL-------ASQGIVAGTLTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLKVDTQI-KDKVMASPLQITPQTATVAFDNVHFEY----------IEGQKVLSGISFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQS 710          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Human
Match: ABCB7 (ATP binding cassette subfamily B member 7 [Source:HGNC Symbol;Acc:HGNC:48])

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 355/636 (55.82%), Postives = 468/636 (73.58%), Query Frame = 1
Query:  130 RYCHHEHLS---HADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN-SQVLLD-----NNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSL--PDLIDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            R C H H     H D K         KIIK +  YVWP DRP ++ RV +S+G L G+K  NI +PF+FKY +D LN  S  +L+     N +A M   A++ GYG++R  A+  NE+RNAVF KVAQ+SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+LP +FEV LV+ +LY++ G  ++L+ +G +G+YT +T  VT WR + R EMN AD  AGN A+DSLLNYETVKYFNNE++EA +Y+  LK YE ASLK   +LA LNFGQ+ IFS+GL ++M L       ASQ  ++  LTVGDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L+ V ++   D  +  P  I P  +++ FDNV F Y            G ++L+G+SF V  G+KVAIVGGSGSGKSTI+RLL+RF++  +G I + GQ+I+ V+LESLRR+V V+PQD VLFH++I+YNL YGN+SASP++VY  A++A LHD+I+RMP  Y+T VGERGLKLSGGEKQRVAIARA+LK  P++LYDEATSSLDSITE+ +L A++    + TSI IAHRLSTV+DA  I+VL  G++ E+G+H  L+++PHS YS +WH Q+
Sbjct:   93 RTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSDAPNTVATM-ATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIMFEVMLVSGVLYYKCGAQFALVTLGTLGTYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNERYEAQRYDGFLKTYETASLKSTSTLAMLNFGQSAIFSVGLTAIMVL-------ASQGIVAGTLTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLKVDTQI-KDKVMASPLQITPQTATVAFDNVHFEY----------IEGQKVLSGISFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQS 709          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Human
Match: ABCB7 (ATP binding cassette subfamily B member 7 [Source:HGNC Symbol;Acc:HGNC:48])

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 355/636 (55.82%), Postives = 468/636 (73.58%), Query Frame = 1
Query:  130 RYCHHEHLS---HADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN-SQVLLD-----NNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSL--PDLIDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            R C H H     H D K         KIIK +  YVWP DRP ++ RV +S+G L G+K  NI +PF+FKY +D LN  S  +L+     N +A M   A++ GYG++R  A+  NE+RNAVF KVAQ+SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+LP +FEV LV+ +LY++ G  ++L+ +G +G+YT +T  VT WR + R EMN AD  AGN A+DSLLNYETVKYFNNE++EA +Y+  LK YE ASLK   +LA LNFGQ+ IFS+GL ++M L       ASQ  ++  LTVGDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L+ V ++   D  +  P  I P  +++ FDNV F Y            G ++L+G+SF V  G+KVAIVGGSGSGKSTI+RLL+RF++  +G I + GQ+I+ V+LESLRR+V V+PQD VLFH++I+YNL YGN+SASP++VY  A++A LHD+I+RMP  Y+T VGERGLKLSGGEKQRVAIARA+LK  P++LYDEATSSLDSITE+ +L A++    + TSI IAHRLSTV+DA  I+VL  G++ E+G+H  L+++PHS YS +WH Q+
Sbjct:   67 RTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSDAPNTVATM-ATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIMFEVMLVSGVLYYKCGAQFALVTLGTLGTYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNERYEAQRYDGFLKTYETASLKSTSTLAMLNFGQSAIFSVGLTAIMVL-------ASQGIVAGTLTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLKVDTQI-KDKVMASPLQITPQTATVAFDNVHFEY----------IEGQKVLSGISFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQS 683          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Human
Match: ABCB7 (ATP binding cassette subfamily B member 7 [Source:HGNC Symbol;Acc:HGNC:48])

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 355/636 (55.82%), Postives = 468/636 (73.58%), Query Frame = 1
Query:  130 RYCHHEHLS---HADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN-SQVLLD-----NNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSL--PDLIDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            R C H H     H D K         KIIK +  YVWP DRP ++ RV +S+G L G+K  NI +PF+FKY +D LN  S  +L+     N +A M   A++ GYG++R  A+  NE+RNAVF KVAQ+SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+LP +FEV LV+ +LY++ G  ++L+ +G +G+YT +T  VT WR + R EMN AD  AGN A+DSLLNYETVKYFNNE++EA +Y+  LK YE ASLK   +LA LNFGQ+ IFS+GL ++M L       ASQ  ++  LTVGDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L+ V ++   D  +  P  I P  +++ FDNV F Y            G ++L+G+SF V  G+KVAIVGGSGSGKSTI+RLL+RF++  +G I + GQ+I+ V+LESLRR+V V+PQD VLFH++I+YNL YGN+SASP++VY  A++A LHD+I+RMP  Y+T VGERGLKLSGGEKQRVAIARA+LK  P++LYDEATSSLDSITE+ +L A++    + TSI IAHRLSTV+DA  I+VL  G++ E+G+H  L+++PHS YS +WH Q+
Sbjct:   98 RTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSDAPNTVATM-ATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIMFEVMLVSGVLYYKCGAQFALVTLGTLGTYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNERYEAQRYDGFLKTYETASLKSTSTLAMLNFGQSAIFSVGLTAIMVL-------ASQGIVAGTLTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLKVDTQI-KDKVMASPLQITPQTATVAFDNVHFEY----------IEGQKVLSGISFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQS 714          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Human
Match: ABCB7 (ATP binding cassette subfamily B member 7 [Source:HGNC Symbol;Acc:HGNC:48])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 330/575 (57.39%), Postives = 437/575 (76.00%), Query Frame = 1
Query:  304 NIQIPFIFKYGIDYLNN-SQVLLD-----NNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSL--PDLIDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            NI +PF+FKY +D LN  S  +L+     N +A M   A++ GYG++R  A+  NE+RNAVF KVAQ+SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+LP +FEV LV+ +LY++ G  ++L+ +G +G+YT +T  VT WR + R EMN AD  AGN A+DSLLNYETVKYFNNE++EA +Y+  LK YE ASLK   +LA LNFGQ+ IFS+GL ++M L       ASQ  ++  LTVGDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L+ V ++   D  +  P  I P  +++ FDNV F Y            G ++L+G+SF V  G+KVAIVGGSGSGKSTI+RLL+RF++  +G I + GQ+I+ V+LESLRR+V V+PQD VLFH++I+YNL YGN+SASP++VY  A++A LHD+I+RMP  Y+T VGERGLKLSGGEKQRVAIARA+LK  P++LYDEATSSLDSITE+ +L A++    + TSI IAHRLSTV+DA  I+VL  G++ E+G+H  L+++PHS YS +WH Q+
Sbjct:  115 NIVVPFMFKYAVDSLNQMSGNMLNLSDAPNTVATM-ATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIMFEVMLVSGVLYYKCGAQFALVTLGTLGTYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNERYEAQRYDGFLKTYETASLKSTSTLAMLNFGQSAIFSVGLTAIMVL-------ASQGIVAGTLTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLKVDTQI-KDKVMASPLQITPQTATVAFDNVHFEY----------IEGQKVLSGISFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQS 670          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Celegans
Match: abtm-1 (ABC Transporter, Mitochondrial [Source:UniProtKB/TrEMBL;Acc:A0A061AJH7])

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 326/635 (51.34%), Postives = 448/635 (70.55%), Query Frame = 1
Query:  130 RYCHHEHLSHADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNS-----QVLLDNNLA---LMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSG-LTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSR--TWTDNSLPDLIDPS-SITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            R C H   S       + + S Y+++++L  +VWP D+P IKRRV++++ LL+ +K+AN+ +PF+ +  ++Y N       ++  D   +      G+A    YGIAR +AS  NELRNAVFAKVAQ+SIR + +S+FLHLHSLD+SFHL+R+TGAL+K IDRG+RG++FVL++L+FN++PT  E+G+V+++     G  ++ + +G IG Y   T GVT WR K R +MN AD  AGN+A+DSL+NYETVKYFNNEKFEAD+Y+  LKKYE ASLK   SLA LNF QN IFS  L  VM +        +   I++G LT+GDL+L N LLFQLS+PLNFLG++YRE++Q L+DMN MFSL+ ++ +     D    +++D   S+ F+NV F Y               IL GL   +  G+KVAIVGGSGSGKSTI+RLLYR +D + G + I G + + + L+SLR+S+S++PQD+VLFHD+IFYNL YG  SAS ++VY+AA++ADLH+S++ MP  YET VGERGLKLSGGEKQRVAIARA+LK +P ++YDEATSSLD+ITE N++ AL+ A    TS+ IAHRL+T++DA +I VL+DG++ EKGSH  L++     Y+ LW  QN
Sbjct:   56 RTCFHPGASSQVPLQASGQLSGYQLVQRLLKFVWPKDKPEIKRRVLVALCLLIAAKLANVSVPFLLRDIVNYYNGKAPEFLKLTFDGTPSQTIFTAGIATCIAYGIARATASLFNELRNAVFAKVAQNSIRSISRSIFLHLHSLDLSFHLNRQTGALSKAIDRGTRGMSFVLSSLIFNLIPTAVEIGMVSALFTGTLGPEFAYMTMGSIGMYGIATLGVTKWRTKFRHQMNQADNDAGNKAIDSLINYETVKYFNNEKFEADRYDHFLKKYEGASLKTTSSLALLNFTQNAIFSGALIGVMCM--------AGTRIAAGDLTIGDLILANTLLFQLSIPLNFLGSVYREVRQGLVDMNQMFSLLTLKPKIVEAADAKRLEIVDNDISLKFENVHFGYLPEK----------PILKGLDLEIPVGKKVAIVGGSGSGKSTIVRLLYRLYDTESGNVRINGLETRDLTLDSLRQSISIVPQDSVLFHDTIFYNLAYGRPSASMEEVYQAAKLADLHESVLAMPNGYETLVGERGLKLSGGEKQRVAIARAILKNAPFVIYDEATSSLDAITESNIMKALKGAVEKRTSLFIAHRLATIVDADIIYVLQDGKVAEKGSHFDLLA-VDGLYAQLWKSQN 671          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Celegans
Match: hmt-1 (Heavy Metal Tolerance factor; Heavy metal tolerance factor 1 [Source:UniProtKB/TrEMBL;Acc:G5EFD4])

HSP 1 Score: 424.476 bits (1090), Expect = 9.683e-138
Identity = 233/601 (38.77%), Postives = 351/601 (58.40%), Query Frame = 1
Query:  223 YVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN------SQVLLDNNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLI---DP-SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQ 1995
            Y+WP     ++ RVV  + LL+  ++ N+ +P + K+ +D L        S + L   L  + G   MGG+         +N +R  ++  + Q + R +   +F HLHSL + +HLSR+TG + +V+DRG+  +N +L  ++FNV+PT+ ++ +     +  +   + LI  G +  Y T T  +T WR +   E N  D      A DSL+NYETVKY+ NE+FE ++++  ++ Y+    K Q SLA LN  QN          +G++   +F    +     LTVGD VL    L QL  PLNF GT+YR I++A +DM  MF LM+          LP  +   DP  +I+  N+ F Y          + G+ ++  +SF +  GQ VA+VG SGSGKST+IRLL+R F++ EG I   G D+++  + SLR+ + ++PQDTVLF+D+I YN+++G   AS ++V EAA+ A +H+ I  +P  Y T VGERGLKLSGGEKQRVAIAR +LKK   +  DEATS+LD+ TE+ +   L     + T +V+AHRLSTV++A LILVL  G ILE+G+H++L++   +Y S +W  Q
Sbjct:  214 YIWPTKSISLQLRVVFCLFLLIIGRLINVSLPILSKWIVDELATPDTFQYSLLFLATFLKFLQGNGAMGGF---------LNTVRTYLWIPIQQYTTRELEVELFKHLHSLSLRWHLSRKTGQVLRVMDRGTSSVNNILNYILFNVVPTIADIVIAVIFFFSAFNAYFGLIVFGTMALYLTVTISITEWRTQYIREANEKDNATSAIATDSLINYETVKYYGNEEFEVNRFKNAIESYQVTEWKTQASLAFLNCLQNA------IIGIGMIGGSVFVVYMIVHEKTLTVGDYVLFTTYLLQLYTPLNFFGTIYRVIQKAFVDMENMFDLMNDEVEV---KDLPHALPYTDPRGTISVKNLTFEY----------NTGLPVIKNISFEIGNGQTVALVGSSGSGKSTLIRLLFRLFESTEGSIEFDGIDVRNYTMHSLRQQIGIVPQDTVLFNDTIMYNIRFGRPDASDEEVIEAAKAAMIHEKITSLPEGYATMVGERGLKLSGGEKQRVAIARTILKKPQFIFLDEATSALDTPTERAIQKCLEKLCKSRTGVVVAHRLSTVVNADLILVLDKGIILERGNHKELLAQQGTYAS-MWEAQ 785          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Celegans
Match: pgp-2 (ABC transporter PGP-2; p-GlycoProtein related [Source:UniProtKB/TrEMBL;Acc:G5EDF9])

HSP 1 Score: 228.409 bits (581), Expect = 7.524e-63
Identity = 120/263 (45.63%), Postives = 169/263 (64.26%), Query Frame = 1
Query: 1222 NSLPDLIDPSS------------ITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYY 1974
            NS P  IDP S            I+F +V FRYP        +   + +L G+S  +  G K+A+VG SG GKSTI+ LL RF+D  +GR+LI G D++ VN+ SLR  + ++ Q+ VLF  +I+ N++ GN  A+ DQV EA +MA+ +D I R+P  Y T VGE+G++LSGG+KQR+AIARAL+K   ILL DEATS+LD+  E+ V  AL  A +  T+I++AHRLST+ +   I V K G I+E GSH++L+S    +Y
Sbjct:  370 NSHPK-IDPYSLEGILVDNMKGDISFKDVHFRYP--------SRKDIHVLKGISLELKAGDKIALVGSSGCGKSTIVNLLQRFYDPTKGRVLIDGVDLREVNVHSLREQIGIVSQEPVLFDGTIYENIKMGNEHATHDQVVEACKMANANDFIKRLPDGYGTRVGEKGVQLSGGQKQRIAIARALVKNPKILLLDEATSALDTEAEREVQGALDQAQAGRTTIIVAHRLSTIRNVDRIFVFKAGNIVESGSHEELMSKQGIFY 623          

HSP 2 Score: 204.527 bits (519), Expect = 6.109e-55
Identity = 109/263 (41.44%), Postives = 170/263 (64.64%), Query Frame = 1
Query: 1222 NSLPD--LIDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYG-NLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQ 1995
            +SL D  ++ P   +I+  NV F YP             ++L G +  +  G+ VA+VG SG GKSTI+ LL RF++ D+G I+I G +I+++N+ SLR  V ++ Q+  LF  +I  N+ YG N + +  ++ EAA+MA++H+ I+ +P  Y+T VGE+G +LSGG+KQR+AIARAL++   +LL DEATS+LD+ +E+ V  AL  A    T +VIAHRLST+ ++ +I ++ +G+I+EKG+H +LI     Y  F   Q+
Sbjct: 1030 DSLSDSGIVKPITGNISIRNVFFNYP--------TRKDTKVLQGFTLDIKAGKTVALVGHSGCGKSTIMGLLERFYNQDKGMIMIDGDNIRNLNISSLREQVCIVSQEPTLFDCTIGENICYGTNRNVTYQEIVEAAKMANIHNFILGLPDGYDTHVGEKGTQLSGGQKQRIAIARALVRSPSVLLLDEATSALDTESEKIVQEALDAAKQGRTCLVIAHRLSTIQNSDVIAIVSEGKIVEKGTHDELIRKSEIYQKFCETQR 1284          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Celegans
Match: pgp-2 (ABC transporter PGP-2; p-GlycoProtein related [Source:UniProtKB/TrEMBL;Acc:G5EDF9])

HSP 1 Score: 228.409 bits (581), Expect = 7.550e-63
Identity = 120/263 (45.63%), Postives = 169/263 (64.26%), Query Frame = 1
Query: 1222 NSLPDLIDPSS------------ITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYY 1974
            NS P  IDP S            I+F +V FRYP        +   + +L G+S  +  G K+A+VG SG GKSTI+ LL RF+D  +GR+LI G D++ VN+ SLR  + ++ Q+ VLF  +I+ N++ GN  A+ DQV EA +MA+ +D I R+P  Y T VGE+G++LSGG+KQR+AIARAL+K   ILL DEATS+LD+  E+ V  AL  A +  T+I++AHRLST+ +   I V K G I+E GSH++L+S    +Y
Sbjct:  377 NSHPK-IDPYSLEGILVDNMKGDISFKDVHFRYP--------SRKDIHVLKGISLELKAGDKIALVGSSGCGKSTIVNLLQRFYDPTKGRVLIDGVDLREVNVHSLREQIGIVSQEPVLFDGTIYENIKMGNEHATHDQVVEACKMANANDFIKRLPDGYGTRVGEKGVQLSGGQKQRIAIARALVKNPKILLLDEATSALDTEAEREVQGALDQAQAGRTTIIVAHRLSTIRNVDRIFVFKAGNIVESGSHEELMSKQGIFY 630          

HSP 2 Score: 204.527 bits (519), Expect = 6.082e-55
Identity = 109/263 (41.44%), Postives = 170/263 (64.64%), Query Frame = 1
Query: 1222 NSLPD--LIDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYG-NLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQ 1995
            +SL D  ++ P   +I+  NV F YP             ++L G +  +  G+ VA+VG SG GKSTI+ LL RF++ D+G I+I G +I+++N+ SLR  V ++ Q+  LF  +I  N+ YG N + +  ++ EAA+MA++H+ I+ +P  Y+T VGE+G +LSGG+KQR+AIARAL++   +LL DEATS+LD+ +E+ V  AL  A    T +VIAHRLST+ ++ +I ++ +G+I+EKG+H +LI     Y  F   Q+
Sbjct: 1013 DSLSDSGIVKPITGNISIRNVFFNYP--------TRKDTKVLQGFTLDIKAGKTVALVGHSGCGKSTIMGLLERFYNQDKGMIMIDGDNIRNLNISSLREQVCIVSQEPTLFDCTIGENICYGTNRNVTYQEIVEAAKMANIHNFILGLPDGYDTHVGEKGTQLSGGQKQRIAIARALVRSPSVLLLDEATSALDTESEKIVQEALDAAKQGRTCLVIAHRLSTIQNSDVIAIVSEGKIVEKGTHDELIRKSEIYQKFCETQR 1267          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Celegans
Match: pgp-2 (ABC transporter PGP-2; p-GlycoProtein related [Source:UniProtKB/TrEMBL;Acc:G5EDF9])

HSP 1 Score: 228.409 bits (581), Expect = 7.752e-63
Identity = 120/263 (45.63%), Postives = 169/263 (64.26%), Query Frame = 1
Query: 1222 NSLPDLIDPSS------------ITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYY 1974
            NS P  IDP S            I+F +V FRYP        +   + +L G+S  +  G K+A+VG SG GKSTI+ LL RF+D  +GR+LI G D++ VN+ SLR  + ++ Q+ VLF  +I+ N++ GN  A+ DQV EA +MA+ +D I R+P  Y T VGE+G++LSGG+KQR+AIARAL+K   ILL DEATS+LD+  E+ V  AL  A +  T+I++AHRLST+ +   I V K G I+E GSH++L+S    +Y
Sbjct:  370 NSHPK-IDPYSLEGILVDNMKGDISFKDVHFRYP--------SRKDIHVLKGISLELKAGDKIALVGSSGCGKSTIVNLLQRFYDPTKGRVLIDGVDLREVNVHSLREQIGIVSQEPVLFDGTIYENIKMGNEHATHDQVVEACKMANANDFIKRLPDGYGTRVGEKGVQLSGGQKQRIAIARALVKNPKILLLDEATSALDTEAEREVQGALDQAQAGRTTIIVAHRLSTIRNVDRIFVFKAGNIVESGSHEELMSKQGIFY 623          

HSP 2 Score: 204.527 bits (519), Expect = 6.752e-55
Identity = 109/263 (41.44%), Postives = 170/263 (64.64%), Query Frame = 1
Query: 1222 NSLPD--LIDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYG-NLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQ 1995
            +SL D  ++ P   +I+  NV F YP             ++L G +  +  G+ VA+VG SG GKSTI+ LL RF++ D+G I+I G +I+++N+ SLR  V ++ Q+  LF  +I  N+ YG N + +  ++ EAA+MA++H+ I+ +P  Y+T VGE+G +LSGG+KQR+AIARAL++   +LL DEATS+LD+ +E+ V  AL  A    T +VIAHRLST+ ++ +I ++ +G+I+EKG+H +LI     Y  F   Q+
Sbjct: 1006 DSLSDSGIVKPITGNISIRNVFFNYP--------TRKDTKVLQGFTLDIKAGKTVALVGHSGCGKSTIMGLLERFYNQDKGMIMIDGDNIRNLNISSLREQVCIVSQEPTLFDCTIGENICYGTNRNVTYQEIVEAAKMANIHNFILGLPDGYDTHVGEKGTQLSGGQKQRIAIARALVRSPSVLLLDEATSALDTESEKIVQEALDAAKQGRTCLVIAHRLSTIQNSDVIAIVSEGKIVEKGTHDELIRKSEIYQKFCETQR 1260          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Fly
Match: ABCB7 (gene:FBgn0035244 transcript:FBtr0072755)

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 338/603 (56.05%), Postives = 444/603 (73.63%), Query Frame = 1
Query:  202 IIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLDNNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWT-DNSLPDLIDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQ 2001
            +++ +  Y+WP + P +++RV +S+GLL GSK+  + +PF+FK  +D +    +    +  L    A+M GYGIAR SA+G NELRNAVFAKVA  SIR++  +VFLHLH+LD++FHL+++TGAL+K IDRGSRGINFVL+A+VFN++PT+FE+ LV+SIL  + GL ++ +++GC+G Y  YT  VT WR + R  MN A+ +AGN+A+DSL+NYETVKYFNNEK+EA  Y  +LKKYE ASLK   SLA LNFGQN IFS  L+ +M L   +I           +TVGDLV+VN LLFQLS+PL FLG++YRE++QAL+DM AMF+LM+V S   T  N+ P  +D   SSI F NV F Y            G  I   LSFT+  G+ VAIVGGSGSGKS+++RLL+RFF+ + G++LIGGQDI +V+LESLR+ ++V+PQD+VLFH++I +N+ YGNLS S  +V  AARMADLHDSI+  P QY T VGERGLKLSGGEKQRVAIARA+LK +PIL++DEATSSLDSITE N+L AL  ATS  TSI IAHRLSTV DA  ILVL++G++ E+G+H +L+   +  Y+ LW  Q Q
Sbjct:  104 MLRAMMAYIWPKEDPLVRKRVGISLGLLAGSKLLTVCVPFLFKGAVDTMTTLNMDTAPDAVLSAATALMLGYGIARASAAGFNELRNAVFAKVAHHSIRKIASNVFLHLHNLDLAFHLNKQTGALSKTIDRGSRGINFVLSAMVFNIVPTIFELALVSSILGVKCGLAFAGVSMGCVGIYAAYTLSVTQWRTQFRVFMNQAENEAGNKAVDSLINYETVKYFNNEKYEAGCYNEVLKKYEAASLKTSSSLALLNFGQNAIFSSALSLIMVLAAKEI-------AQGNMTVGDLVMVNALLFQLSIPLGFLGSVYREVRQALLDMRAMFTLMNVDSSIQTAANAQPLFVDTTNSSIEFRNVSFEY----------EPGKPIFRDLSFTIPAGKNVAIVGGSGSGKSSMVRLLFRFFEPNSGKVLIGGQDISAVDLESLRKVIAVVPQDSVLFHNTIEHNIHYGNLSKSHAEVQNAARMADLHDSIMSWPGQYSTQVGERGLKLSGGEKQRVAIARAILKNTPILIFDEATSSLDSITEHNILQALTRATSGRTSICIAHRLSTVKDADEILVLENGRVGERGTHSELLRQ-NGLYARLWETQTQ 688          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Fly
Match: ABCB7 (gene:FBgn0035244 transcript:FBtr0072754)

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 338/603 (56.05%), Postives = 444/603 (73.63%), Query Frame = 1
Query:  202 IIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLDNNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWT-DNSLPDLIDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQ 2001
            +++ +  Y+WP + P +++RV +S+GLL GSK+  + +PF+FK  +D +    +    +  L    A+M GYGIAR SA+G NELRNAVFAKVA  SIR++  +VFLHLH+LD++FHL+++TGAL+K IDRGSRGINFVL+A+VFN++PT+FE+ LV+SIL  + GL ++ +++GC+G Y  YT  VT WR + R  MN A+ +AGN+A+DSL+NYETVKYFNNEK+EA  Y  +LKKYE ASLK   SLA LNFGQN IFS  L+ +M L   +I           +TVGDLV+VN LLFQLS+PL FLG++YRE++QAL+DM AMF+LM+V S   T  N+ P  +D   SSI F NV F Y            G  I   LSFT+  G+ VAIVGGSGSGKS+++RLL+RFF+ + G++LIGGQDI +V+LESLR+ ++V+PQD+VLFH++I +N+ YGNLS S  +V  AARMADLHDSI+  P QY T VGERGLKLSGGEKQRVAIARA+LK +PIL++DEATSSLDSITE N+L AL  ATS  TSI IAHRLSTV DA  ILVL++G++ E+G+H +L+   +  Y+ LW  Q Q
Sbjct:  138 MLRAMMAYIWPKEDPLVRKRVGISLGLLAGSKLLTVCVPFLFKGAVDTMTTLNMDTAPDAVLSAATALMLGYGIARASAAGFNELRNAVFAKVAHHSIRKIASNVFLHLHNLDLAFHLNKQTGALSKTIDRGSRGINFVLSAMVFNIVPTIFELALVSSILGVKCGLAFAGVSMGCVGIYAAYTLSVTQWRTQFRVFMNQAENEAGNKAVDSLINYETVKYFNNEKYEAGCYNEVLKKYEAASLKTSSSLALLNFGQNAIFSSALSLIMVLAAKEI-------AQGNMTVGDLVMVNALLFQLSIPLGFLGSVYREVRQALLDMRAMFTLMNVDSSIQTAANAQPLFVDTTNSSIEFRNVSFEY----------EPGKPIFRDLSFTIPAGKNVAIVGGSGSGKSSMVRLLFRFFEPNSGKVLIGGQDISAVDLESLRKVIAVVPQDSVLFHNTIEHNIHYGNLSKSHAEVQNAARMADLHDSIMSWPGQYSTQVGERGLKLSGGEKQRVAIARAILKNTPILIFDEATSSLDSITEHNILQALTRATSGRTSICIAHRLSTVKDADEILVLENGRVGERGTHSELLRQ-NGLYARLWETQTQ 722          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Fly
Match: Hmt-1 (gene:FBgn0038376 transcript:FBtr0083188)

HSP 1 Score: 437.573 bits (1124), Expect = 7.524e-142
Identity = 241/602 (40.03%), Postives = 356/602 (59.14%), Query Frame = 1
Query:  196 YKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLDNNLALM-TGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTW-TDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQ 1995
            ++ ++ +F Y+WP     ++  V++ + LLL  +V  + +P   K  +D L  + ++   +  L+   L+ + G G    S    N LR  ++ +V Q + R +   +F HLH L + +HL R+TG + +V+DRG+  IN +L  +VF++ PT+ ++ +  +   + +   + LI    +  Y   T  +T WR K +  MN AD +   R++DSLLN+ETVKY+  E +E D Y   + KY++       +L  LN  QN+I  LGL +   L  + +           LTVGD VL +  L +L +PLN+ GT YR I++  +DM  MF L+             P L     I F NV F          G S    +L  +SFTV  G+ VAIVG SG+GKSTI+RLL+RF+D   G ILI GQ+IK V  +SLR+++ V+PQDTVLF+++IFYN++Y  L AS + VYEAAR AD+H+ I+  P +YET VGERGL+LSGGEKQRVAIAR LLK   I+L DEATS+LD+ TE+N+ +AL    +N T+I++AHRLST++ A  ILVL+ G I E+G H++L+      Y+ +W QQ
Sbjct:  229 WRKLRTVFPYLWPKKNIALQIAVIVCIILLLAGRVIKLFLPIYRKKLVDSLTIAPIVFRWDFVLIYVALSFLQGGGTG--SMGLFNNLRTFLWIRVQQYTTREIEIELFRHLHQLSLRWHLQRKTGEVLRVMDRGTDSINNLLNYIVFSIAPTILDLLVAVAYFVYAFNWWFGLIVFLTMFLYIASTIAITEWRTKYQRRMNLADNEQRARSVDSLLNFETVKYYGAEHYEVDCYREAILKYQKEEFLSMLTLNMLNTAQNIILCLGLLAGSLLCVYLVVH------HQTLTVGDFVLFSTYLMELYMPLNWFGTYYRAIQKNFVDMENMFDLLKEEEEIVDAPGCSPLLTAGGGIEFSNVTF----------GYSPEKIVLRNVSFTVPAGKTVAIVGPSGAGKSTIMRLLFRFYDVQTGAILIDGQNIKLVQQQSLRKAIGVVPQDTVLFNNTIFYNIEYAKLGASDEAVYEAARAADIHERILGFPEKYETKVGERGLRLSGGEKQRVAIARTLLKAPIIVLLDEATSALDTHTERNIQAALARVCANRTTIIVAHRLSTIIHADEILVLQQGSIAERGRHEELVLREDGIYADMWQQQ 812          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Fly
Match: Mdr49 (gene:FBgn0004512 transcript:FBtr0087801)

HSP 1 Score: 220.32 bits (560), Expect = 4.470e-60
Identity = 158/526 (30.04%), Postives = 263/526 (50.00%), Query Frame = 1
Query:  475 KVAQDSIRRVGKSVFLHLHSLDMSFHL----SRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMG--LMTFDIFTASQMGISSGLTV--------------GDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLIDP------------SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLIS 1956
            ++A + I R+ K     +   D++++     S     + + +D+   GI   +  +VF ++   F +G+V++ +Y   G   +L+ + C+      T  V   +  +  +   + + A N   +      TV  F+ ++ E +++  LL   E    K                  GL S MG  L    I+    + I  G+T+                LV+V   +   +  L F       I  A      +F+++D           P  +DP              I F+ ++FRYP            V+IL GL+  V  GQ VA VG SG GKST+I+L+ RF+D + G + + G+D++++N+  LR  + V+ Q+ VLF  +I  N++YG  SA+   + +AAR A+ HD I R+P  Y+T VGE+G ++SGG+KQR+AIARAL+++  +LL DEATS+LD  +E+ V SAL  A+   T++V+AHRLST+ +A  I+ LKDG + E+G+H++L+ 
Sbjct:  142 RIALNQIDRIRKLFLEAMLRQDIAWYDTSSGSNFASKMTEDLDKLKEGIGEKIVIVVFLIM--TFVIGIVSAFVY---GWKLTLVVLSCVPFIIAATSVVARLQGSLAEKELKSYSDAANVVEEVFSGIRTVFAFSGQEKEKERFGKLLIPAENTGRK-----------------KGLYSGMGNALSWLIIYLCMALAIWYGVTLILDERDLPDRVYTPAVLVIVLFAVIMGAQNLGFASPHVEAIAVATAAGQTLFNIID----------RPSQVDPMDEKGNRPENTAGHIRFEGIRFRYP--------ARPDVEILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQRFYDPEAGSVKLDGRDLRTLNVGWLRSQIGVVGQEPVLFATTIGENIRYGRPSATQADIEKAARAANCHDFITRLPKGYDTQVGEKGAQISGGQKQRIAIARALVRQPQVLLLDEATSALDPTSEKRVQSALELASQGPTTLVVAHRLSTITNADKIVFLKDGVVAEQGTHEELME 627          

HSP 2 Score: 180.644 bits (457), Expect = 6.661e-47
Identity = 110/278 (39.57%), Postives = 164/278 (58.99%), Query Frame = 1
Query: 1189 LMDVRSRTWTDNSLP----DLIDPSS--ITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGN---LSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQ 1995
            LMD+  RT T  + P    + ++ S   I ++NV F YP           G  IL GL+ T+ K   VA+VG SGSGKST ++LL R++D   G + + G       L++LR  + ++ Q+ VLF  +I  N+ YGN      S  ++ EAA+ +++H+ I  +P  Y+T +G+   +LSGG+KQR+AIARAL++   IL+ DEATS+LD  +E+ V  AL  A S  T + IAHRL+TV +A LI VLK G ++E G+H +L++    Y +    QQ
Sbjct: 1031 LMDLFKRTSTQPNPPQSPYNTVEKSEGDIVYENVGFEYP--------TRKGTPILQGLNLTIKKSTTVALVGPSGSGKSTCVQLLLRYYDPVSGSVNLSGVPSTEFPLDTLRSKLGLVSQEPVLFDRTIAENIAYGNNFRDDVSMQEIIEAAKKSNIHNFISALPQGYDTRLGKTS-QLSGGQKQRIAIARALVRNPKILILDEATSALDLESEKVVQQALDEARSGRTCLTIAHRLTTVRNADLICVLKRGVVVEHGTHDELMALNKIYANLYLMQQ 1299          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Fly
Match: Mdr49 (gene:FBgn0004512 transcript:FBtr0302198)

HSP 1 Score: 217.624 bits (553), Expect = 2.813e-59
Identity = 147/462 (31.82%), Postives = 235/462 (50.87%), Query Frame = 1
Query:  655 FEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMG--LMTFDIFTASQMGISSGLTV--------------GDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLIDP------------SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLIS 1956
            F +G+V++ +Y   G   +L+ + C+      T  V   +  +  +   + + A N   +      TV  F+ ++ E +++  LL   E    K                  GL S MG  L    I+    + I  G+T+                LV+V   +   +  L F       I  A      +F+++D           P  +DP              I F+ ++FRYP            V+IL GL+  V  GQ VA VG SG GKST+I+L+ RF+D + G + + G+D++++N+  LR  + V+ Q+ VLF  +I  N++YG  SA+   + +AAR A+ HD I R+P  Y+T VGE+G ++SGG+KQR+AIARAL+++  +LL DEATS+LD  +E+ V SAL  A+   T++V+AHRLST+ +A  I+ LKDG + E+G+H++L+ 
Sbjct:    3 FVIGIVSAFVY---GWKLTLVVLSCVPFIIAATSVVARLQGSLAEKELKSYSDAANVVEEVFSGIRTVFAFSGQEKEKERFGKLLIPAENTGRK-----------------KGLYSGMGNALSWLIIYLCMALAIWYGVTLILDERDLPDRVYTPAVLVIVLFAVIMGAQNLGFASPHVEAIAVATAAGQTLFNIID----------RPSQVDPMDEKGNRPENTAGHIRFEGIRFRYPA--------RPDVEILKGLTVDVLPGQTVAFVGASGCGKSTLIQLMQRFYDPEAGSVKLDGRDLRTLNVGWLRSQIGVVGQEPVLFATTIGENIRYGRPSATQADIEKAARAANCHDFITRLPKGYDTQVGEKGAQISGGQKQRIAIARALVRQPQVLLLDEATSALDPTSEKRVQSALELASQGPTTLVVAHRLSTITNADKIVFLKDGVVAEQGTHEELME 426          

HSP 2 Score: 180.644 bits (457), Expect = 4.948e-47
Identity = 110/278 (39.57%), Postives = 164/278 (58.99%), Query Frame = 1
Query: 1189 LMDVRSRTWTDNSLP----DLIDPSS--ITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGN---LSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQ 1995
            LMD+  RT T  + P    + ++ S   I ++NV F YP           G  IL GL+ T+ K   VA+VG SGSGKST ++LL R++D   G + + G       L++LR  + ++ Q+ VLF  +I  N+ YGN      S  ++ EAA+ +++H+ I  +P  Y+T +G+   +LSGG+KQR+AIARAL++   IL+ DEATS+LD  +E+ V  AL  A S  T + IAHRL+TV +A LI VLK G ++E G+H +L++    Y +    QQ
Sbjct:  830 LMDLFKRTSTQPNPPQSPYNTVEKSEGDIVYENVGFEYP--------TRKGTPILQGLNLTIKKSTTVALVGPSGSGKSTCVQLLLRYYDPVSGSVNLSGVPSTEFPLDTLRSKLGLVSQEPVLFDRTIAENIAYGNNFRDDVSMQEIIEAAKKSNIHNFISALPQGYDTRLGKTS-QLSGGQKQRIAIARALVRNPKILILDEATSALDLESEKVVQQALDEARSGRTCLTIAHRLTTVRNADLICVLKRGVVVEHGTHDELMALNKIYANLYLMQQ 1098          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Zebrafish
Match: abcb7 (ATP-binding cassette, sub-family B (MDR/TAP), member 7 [Source:ZFIN;Acc:ZDB-GENE-050517-10])

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 344/636 (54.09%), Postives = 465/636 (73.11%), Query Frame = 1
Query:  124 QVRYCHHEHLS---HADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLDN-----NLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLI---DPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            Q R C H +      AD K    + +  KI+  +F YVWP DRP ++ RVV+S+ LL G+K+ N+ +PF+FKY +D LN     + N     N  +    A++ GYG++R  ++  NELRNAVF KVAQ SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+ PT+FE+ LV+ ILY++ G  ++L+ +G + +YT +T  VT WR + R EMN AD +AGN A+DSLLNYETVKYFNNEK+EA++Y+  LK YE +SLK   +LA LNFGQ+ IFS+GL ++M L       AS+  +S  +TVGDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L+ V ++       P LI     ++I F++V F Y            G ++LNG+SF V  G+KVAIVGGSGSGKSTI+RLL+RF++  +G I I GQ+I+ V LESLR++V V+PQD VLFH++IFYNL YGN++A+ + VY  AR+A +HD+I++MP +Y+T VGERGLKLSGGEKQRVAIARA+LK  PILLYDEATSSLDS+TE+N+L++++    + TS+ IAHRLST++DA  I+VL  G++ E+G+HQ L+  P S Y+ LW+ QN
Sbjct:   82 QERQCWHGNAGGGLSADPKNVLKEVNSSKILGAMFTYVWPKDRPDLRARVVISLSLLAGAKITNVMVPFMFKYAVDSLNQMSGHMLNLSDAPNTVVTMATAVLIGYGVSRTGSALFNELRNAVFGKVAQSSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLGPTLFEMMLVSGILYYKCGGHFALVTLGTLSAYTAFTVAVTQWRTQFRIEMNKADNEAGNAAIDSLLNYETVKYFNNEKYEAERYDGFLKVYESSSLKTTSTLAMLNFGQSAIFSVGLTAIMVL-------ASKGIMSGTMTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLSVDTKIKEKEMAPPLIVTPQEATIRFEDVYFEY----------LEGQKVLNGVSFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQQGNIYIAGQNIRDVGLESLRKAVGVVPQDAVLFHNTIFYNLMYGNINATAEDVYRVARLAGIHDAILKMPHKYDTQVGERGLKLSGGEKQRVAIARAILKNPPILLYDEATSSLDSVTEENILTSMKEMVKDRTSVFIAHRLSTIVDADEIIVLNQGKVAERGNHQTLLDTPGSLYANLWNTQN 700          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Zebrafish
Match: abcb6b (ATP-binding cassette, sub-family B (MDR/TAP), member 6b [Source:ZFIN;Acc:ZDB-GENE-070912-584])

HSP 1 Score: 419.468 bits (1077), Expect = 1.102e-137
Identity = 251/617 (40.68%), Postives = 365/617 (59.16%), Query Frame = 1
Query:  139 HHEHLSHADGKGNNTKTSDYK-IIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLD-NNLALMTGLAIM------GGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYW--RYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLIS 1956
             HE   + +     +   D++  +  L  Y+WP     ++  V+L +GLL   +V N+ +P    Y  + +N    + +   LA+   + ++      GG G    ++  ++ LR+ ++  V Q + R V   +F HLH L + +HL RRTG + + IDRG+  +N +L+ +VF+++PT+ ++  V +I+Y+   +   + LI   C+  Y T T  +T WR K R EMNT D  A ++A+DSLLN+ETVKY+N+E FE  ++E  + KY+    K   SLA LN  QN+I  LGL +   L  + +             VGD VL    + QL  PLN+ GT YR I+ A +DM +MF L+          +  DL      + F NV F Y          + G +IL+ +SFTV  GQ  A+VG SGSGKSTIIRLL+RF+D   G ILI GQDI  V   SLR  + V+PQDTVLF+D+I  N++YG +SAS  +V EAA  AD+HD I+ +P  Y+T VGERGLKLSGGEKQRVAIAR +LK   I+L DEATS+LDS TE+N+ ++L    +N T++V+AHRLST++ +  ILVL DG+I E+G H++L++
Sbjct:   29 EHERDGNVEQISRRSAWQDFRRKVCLLVPYMWPRGSVWLQVLVILCVGLLGLERVINVFVPI---YSRNIVNQLSAMENWRTLAITVCVYVLLKFFQGGGVG----TSGFVSNLRSFLWTHVQQYTSRVVQVRLFAHLHGLSLRWHLGRRTGDVLRSIDRGTSSVNNLLSYIVFSIVPTIADI--VIAIIYFVTYFSAWFGLIVFICMFLYLTLTIIITEWRTKYRREMNTQDNNAKSKAVDSLLNFETVKYYNSEGFEVRRFEDAILKYQACEWKTNASLALLNQTQNLIIGLGLLAGSLLCAYYVTV-------DKFQVGDYVLFGTYIVQLYTPLNWFGTYYRMIQSAFVDMESMFDLLTEEKEVKDTVNAGDLSFTKGRVDFKNVCFSY----------TAGKEILSDVSFTVMPGQTFALVGPSGSGKSTIIRLLFRFYDVQSGCILIDGQDIAKVRQNSLRSYIGVVPQDTVLFNDNIRENIRYGRISASDQEVEEAAVAADIHDKILSLPDGYDTEVGERGLKLSGGEKQRVAIARTILKSPRIILLDEATSALDSQTERNIQASLAKVCANHTTLVVAHRLSTIVSSDQILVLHDGRIAEQGRHEELLA 619          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Zebrafish
Match: abcb6a (ATP-binding cassette, sub-family B (MDR/TAP), member 6a [Source:ZFIN;Acc:ZDB-GENE-050517-9])

HSP 1 Score: 425.246 bits (1092), Expect = 3.320e-137
Identity = 253/607 (41.68%), Postives = 368/607 (60.63%), Query Frame = 1
Query:  199 KIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN--SQVLLDNNLALMTGLAIMGGYGIARISASG-MNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYW--RYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQ 2001
            K ++ L  Y+WP     ++  V++ +G+L   +  N+ +P  +K  ++ L +  S   L   + +   L  + G G     ASG ++ LR+ ++ +V Q + R V   +F HLH+L + +HL RRTG + + IDRG+  IN +L+ +VF++ PT+ ++  V +I+Y+   +   + LI   C+  Y T T  +T WR K R +MNT D  A ++A+DSLLN+ETVKY+N E +E  ++E  + KY+ +  K   SLA LN  QN+I  LGL +   L  + +             VGD VL    + QL  PLN+ GT YR I+ + IDM +MF L         + +  +L      + F+NV F Y          + G +IL  +SFTV  GQ VA+VG SGSGKSTIIRLL+RF+D   G I I GQDI  V   SLR  + V+PQDTVLF+D+I  N++YG ++A+  +V EAA  AD+HD II  P  YET VGERGLKLSGGEKQRVAIAR +LK   I+L DEATS+LD+ TE+N+ ++L    +N T++V+AHRLST++ A +ILVL+DGQI+E+G H++L++     YS +W +Q Q
Sbjct:  236 KKVRLLVPYMWPKGSVLLQLLVLMCLGMLGIERAINVFVPIYYKNIVNQLTDGSSWKTLAMTVCVYCLLKFLQGGGAG---ASGFVSNLRSFLWIRVQQYTNRVVQVRLFAHLHALSLRWHLGRRTGDVLRSIDRGTSSINSLLSYIVFSIFPTIADI--VIAIVYFISNFNAWFGLIVFVCMALYLTLTIFITEWRTKYRRDMNTQDNNAKSKAVDSLLNFETVKYYNAESYEVGRFEDAILKYQVSEWKTNASLALLNQTQNLIIGLGLLTGSLLCAYFV-------TEGKFQVGDYVLFGTYIIQLYTPLNWFGTYYRMIQNSFIDMESMFKLFTEEEEVKDEVNAGNLYFRQGKVEFENVFFSY----------TQGKEILKDVSFTVLPGQTVALVGQSGSGKSTIIRLLFRFYDVQGGCIKIDGQDISKVKQSSLRAHIGVVPQDTVLFNDNIRDNIRYGRVTATDQEVEEAAIAADIHDKIIGFPDGYETQVGERGLKLSGGEKQRVAIARTILKAPQIILLDEATSALDTQTERNIQASLAKVCANRTTVVVAHRLSTIIGADVILVLRDGQIVERGRHEELLAK-GGLYSDMWQKQQQ 819          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Zebrafish
Match: abcb6a (ATP-binding cassette, sub-family B (MDR/TAP), member 6a [Source:ZFIN;Acc:ZDB-GENE-050517-9])

HSP 1 Score: 411.764 bits (1057), Expect = 1.488e-132
Identity = 246/585 (42.05%), Postives = 355/585 (60.68%), Query Frame = 1
Query:  199 KIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN--SQVLLDNNLALMTGLAIMGGYGIARISASG-MNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYW--RYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKG 1935
            K ++ L  Y+WP     ++  V++ +G+L   +  N+ +P  +K  ++ L +  S   L   + +   L  + G G     ASG ++ LR+ ++ +V Q + R V   +F HLH+L + +HL RRTG + + IDRG+  IN +L+ +VF++ PT+ ++  V +I+Y+   +   + LI   C+  Y T T  +T WR K R +MNT D  A ++A+DSLLN+ETVKY+N E +E  ++E  + KY+ +  K   SLA LN  QN+I  LGL +   L  + +             VGD VL    + QL  PLN+ GT YR I+ + IDM +MF L         + +  +L      + F+NV F Y          + G +IL  +SFTV  GQ VA+VG SGSGKSTIIRLL+RF+D   G I I GQDI  V   SLR  + V+PQDTVLF+D+I  N++YG ++A+  +V EAA  AD+HD II  P  YET VGERGLKLSGGEKQRVAIAR +LK   I+L DEATS+LD+ TE+N+ ++L    +N T++V+AHRLST++ A +ILVL+DGQI+E+G
Sbjct:  236 KKVRLLVPYMWPKGSVLLQLLVLMCLGMLGIERAINVFVPIYYKNIVNQLTDGSSWKTLAMTVCVYCLLKFLQGGGAG---ASGFVSNLRSFLWIRVQQYTNRVVQVRLFAHLHALSLRWHLGRRTGDVLRSIDRGTSSINSLLSYIVFSIFPTIADI--VIAIVYFISNFNAWFGLIVFVCMALYLTLTIFITEWRTKYRRDMNTQDNNAKSKAVDSLLNFETVKYYNAESYEVGRFEDAILKYQVSEWKTNASLALLNQTQNLIIGLGLLTGSLLCAYFV-------TEGKFQVGDYVLFGTYIIQLYTPLNWFGTYYRMIQNSFIDMESMFKLFTEEEEVKDEVNAGNLYFRQGKVEFENVFFSY----------TQGKEILKDVSFTVLPGQTVALVGQSGSGKSTIIRLLFRFYDVQGGCIKIDGQDISKVKQSSLRAHIGVVPQDTVLFNDNIRDNIRYGRVTATDQEVEEAAIAADIHDKIIGFPDGYETQVGERGLKLSGGEKQRVAIARTILKAPQIILLDEATSALDTQTERNIQASLAKVCANRTTVVVAHRLSTIIGADVILVLRDGQIVERG 798          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Zebrafish
Match: tap1 (transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) [Source:ZFIN;Acc:ZDB-GENE-050517-43])

HSP 1 Score: 217.624 bits (553), Expect = 1.553e-60
Identity = 134/408 (32.84%), Postives = 226/408 (55.39%), Query Frame = 1
Query:  775 NKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
             K+ A++  +  +A   A ++  + +TV+ F NE  E ++Y   L+    A  K++ +   ++   N + SL L   +      ++   ++   S ++ GDLV       Q +  +  L + +  +K+A+     +F  +D +     D SL        + F NV F YP              +L  +S  +  G+  A+VG SGSGK+T++ LL RF+    G IL+  + + S   + L   +SV+ Q+ VLF  S+  N++YG  +A+ +++Y AAR+A+ HD I  +P  Y+T  GE+G ++SGG+KQR+AIARAL++K  IL+ D+ATSSLD+ +E  V SAL+    + T ++I+HRLS V +A  IL L++G+++E+G+HQQL+ D   +Y+    QQN
Sbjct:  325 QKLSAQVQDSLAKANEVATETFSSMKTVRSFANEDGETERYRKCLED-TFALNKVEAAAYAVSTWTNSMSSLALKVSI------LYYGGRLVTGSDVSSGDLVSFVLYELQFTSAVEVLMSYWPHVKKAVGASEKIFEYVDRKPDVPPDGSLAPKTLKGHVQFRNVTFAYP--------KRPDTDVLKNVSLELKAGKITALVGPSGSGKTTVVSLLERFYQPQNGEILLDQKPLLSYKDQYLHEKISVVSQEPVLFARSVRENIKYGKENATNEEIYAAARLANAHDFISSLPKGYDTDAGEKGGQVSGGQKQRIAIARALIQKPQILVLDDATSSLDTESEHRVYSALKKELQSCTVLLISHRLSGVENADHILFLREGELVEEGNHQQLL-DKQGFYAEFVKQQN 716          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Xenopus
Match: ABCB7 (ATP binding cassette subfamily B member 7 [Source:NCBI gene;Acc:100487650])

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 350/637 (54.95%), Postives = 470/637 (73.78%), Query Frame = 1
Query:  121 SQVRYCHHEHLS---HADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLDN-----NLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            +Q+R C H +     H D K    +    KI+K +F YVWP DRP ++ RV +S+GLL G+K  NI +PF+FKY +D LN     + N     N       A++ GYG++R  ++  NE+RNAVF KVAQ SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+ PT+FEV LV+SILY++ G  ++L  +G +G+YT +T G+T WR K R EMN AD +AGN A+DSLLNYETVKYFNNEK+EA++Y+  LK YE +SLK   +LA LNFGQ+ IFS+GL ++M L       ASQ  ++  LT+GDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L+ V ++       P L I P  ++ITF++V F Y            G ++LNG+SF V  G+K+A+VGGSGSGKST++RLL+RFF+   G I + GQ+IK V+LESLR+++ V+PQD VLFH++++YNL YGN++ASP++VY  A++A LHD+I+RMP  Y T VGERGLKLSGGEKQRVAIARA+LK  PI+LYDEATSSLDSITE+ +LS++R    + TS+ IAHRLST++DA  I+VL +G++ E+G+H  L+++P S YS LWH Q+
Sbjct:   26 TQIRTCWHGNAGGNLHTDPKQGLKEVDSKKILKAMFSYVWPKDRPDLRARVAISLGLLAGAKGMNIVVPFMFKYAVDSLNEMSGNVMNLSNAPNTVATMATAVLIGYGVSRAGSALFNEMRNAVFGKVAQSSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLGPTMFEVLLVSSILYYKCGAQFALATLGTLGAYTAFTIGITQWRTKFRIEMNKADNEAGNAAIDSLLNYETVKYFNNEKYEAERYDGFLKTYENSSLKTTSTLALLNFGQSAIFSVGLTAIMVL-------ASQGILAGNLTIGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLSVDTKIKNKEMAPPLLITPQAATITFEDVYFEY----------LEGQKVLNGVSFEVPAGKKIAVVGGSGSGKSTLVRLLFRFFEPQRGNIYVAGQNIKDVSLESLRKAIGVVPQDAVLFHNTLYYNLHYGNINASPEEVYHVAKLAGLHDAILRMPHGYNTQVGERGLKLSGGEKQRVAIARAMLKNPPIILYDEATSSLDSITEETILSSMRDIVKHRTSVFIAHRLSTIVDADEIIVLDEGKVAERGTHFGLLANPSSLYSELWHTQS 645          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Xenopus
Match: ABCB7 (ATP binding cassette subfamily B member 7 [Source:NCBI gene;Acc:100487650])

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 350/637 (54.95%), Postives = 470/637 (73.78%), Query Frame = 1
Query:  121 SQVRYCHHEHLS---HADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLDN-----NLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            +Q+R C H +     H D K    +    KI+K +F YVWP DRP ++ RV +S+GLL G+K  NI +PF+FKY +D LN     + N     N       A++ GYG++R  ++  NE+RNAVF KVAQ SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+ PT+FEV LV+SILY++ G  ++L  +G +G+YT +T G+T WR K R EMN AD +AGN A+DSLLNYETVKYFNNEK+EA++Y+  LK YE +SLK   +LA LNFGQ+ IFS+GL ++M L       ASQ  ++  LT+GDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L+ V ++       P L I P  ++ITF++V F Y            G ++LNG+SF V  G+K+A+VGGSGSGKST++RLL+RFF+   G I + GQ+IK V+LESLR+++ V+PQD VLFH++++YNL YGN++ASP++VY  A++A LHD+I+RMP  Y T VGERGLKLSGGEKQRVAIARA+LK  PI+LYDEATSSLDSITE+ +LS++R    + TS+ IAHRLST++DA  I+VL +G++ E+G+H  L+++P S YS LWH Q+
Sbjct:   82 TQIRTCWHGNAGGNLHTDPKQGLKEVDSKKILKAMFSYVWPKDRPDLRARVAISLGLLAGAKGMNIVVPFMFKYAVDSLNEMSGNVMNLSNAPNTVATMATAVLIGYGVSRAGSALFNEMRNAVFGKVAQSSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLGPTMFEVLLVSSILYYKCGAQFALATLGTLGAYTAFTIGITQWRTKFRIEMNKADNEAGNAAIDSLLNYETVKYFNNEKYEAERYDGFLKTYENSSLKTTSTLALLNFGQSAIFSVGLTAIMVL-------ASQGILAGNLTIGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLSVDTKIKNKEMAPPLLITPQAATITFEDVYFEY----------LEGQKVLNGVSFEVPAGKKIAVVGGSGSGKSTLVRLLFRFFEPQRGNIYVAGQNIKDVSLESLRKAIGVVPQDAVLFHNTLYYNLHYGNINASPEEVYHVAKLAGLHDAILRMPHGYNTQVGERGLKLSGGEKQRVAIARAMLKNPPIILYDEATSSLDSITEETILSSMRDIVKHRTSVFIAHRLSTIVDADEIIVLDEGKVAERGTHFGLLANPSSLYSELWHTQS 701          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Xenopus
Match: ABCB7 (ATP binding cassette subfamily B member 7 [Source:NCBI gene;Acc:100487650])

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 348/623 (55.86%), Postives = 467/623 (74.96%), Query Frame = 1
Query:  157 HADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLN--NSQVL----LDNNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            H D K    +    KI+K +F YVWP DRP ++ RV +S+GLL G+K  NI +PF+FKY +D LN  +  V+      N +A M   A++ GYG++R  ++  NE+RNAVF KVAQ SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+ PT+FEV LV+SILY++ G  ++L  +G +G+YT +T G+T WR K R EMN AD +AGN A+DSLLNYETVKYFNNEK+EA++Y+  LK YE +SLK   +LA LNFGQ+ IFS+GL ++M L       ASQ  ++  LT+GDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L+ V ++       P L I P  ++ITF++V F Y            G ++LNG+SF V  G+K+A+VGGSGSGKST++RLL+RFF+   G I + GQ+IK V+LESLR+++ V+PQD VLFH++++YNL YGN++ASP++VY  A++A LHD+I+RMP  Y T VGERGLKLSGGEKQRVAIARA+LK  PI+LYDEATSSLDSITE+ +LS++R    + TS+ IAHRLST++DA  I+VL +G++ E+G+H  L+++P S YS LWH Q+
Sbjct:   19 HTDPKQGLKEVDSKKILKAMFSYVWPKDRPDLRARVAISLGLLAGAKGMNIVVPFMFKYAVDSLNEMSGNVMNLSNAPNTVATM-ATAVLIGYGVSRAGSALFNEMRNAVFGKVAQSSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLGPTMFEVLLVSSILYYKCGAQFALATLGTLGAYTAFTIGITQWRTKFRIEMNKADNEAGNAAIDSLLNYETVKYFNNEKYEAERYDGFLKTYENSSLKTTSTLALLNFGQSAIFSVGLTAIMVL-------ASQGILAGNLTIGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLSVDTKIKNKEMAPPLLITPQAATITFEDVYFEY----------LEGQKVLNGVSFEVPAGKKIAVVGGSGSGKSTLVRLLFRFFEPQRGNIYVAGQNIKDVSLESLRKAIGVVPQDAVLFHNTLYYNLHYGNINASPEEVYHVAKLAGLHDAILRMPHGYNTQVGERGLKLSGGEKQRVAIARAMLKNPPIILYDEATSSLDSITEETILSSMRDIVKHRTSVFIAHRLSTIVDADEIIVLDEGKVAERGTHFGLLANPSSLYSELWHTQS 623          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Xenopus
Match: ABCB7 (ATP binding cassette subfamily B member 7 [Source:NCBI gene;Acc:100487650])

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 343/608 (56.41%), Postives = 459/608 (75.49%), Query Frame = 1
Query:  199 KIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLDN-----NLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            KI+K +F YVWP DRP ++ RV +S+GLL G+K  NI +PF+FKY +D LN     + N     N       A++ GYG++R  ++  NE+RNAVF KVAQ SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+ PT+FEV LV+SILY++ G  ++L  +G +G+YT +T G+T WR K R EMN AD +AGN A+DSLLNYETVKYFNNEK+EA++Y+  LK YE +SLK   +LA LNFGQ+ IFS+GL ++M L       ASQ  ++  LT+GDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L+ V ++       P L I P  ++ITF++V F Y            G ++LNG+SF V  G+K+A+VGGSGSGKST++RLL+RFF+   G I + GQ+IK V+LESLR+++ V+PQD VLFH++++YNL YGN++ASP++VY  A++A LHD+I+RMP  Y T VGERGLKLSGGEKQRVAIARA+LK  PI+LYDEATSSLDSITE+ +LS++R    + TS+ IAHRLST++DA  I+VL +G++ E+G+H  L+++P S YS LWH Q+
Sbjct:   78 KILKAMFSYVWPKDRPDLRARVAISLGLLAGAKGMNIVVPFMFKYAVDSLNEMSGNVMNLSNAPNTVATMATAVLIGYGVSRAGSALFNEMRNAVFGKVAQSSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLGPTMFEVLLVSSILYYKCGAQFALATLGTLGAYTAFTIGITQWRTKFRIEMNKADNEAGNAAIDSLLNYETVKYFNNEKYEAERYDGFLKTYENSSLKTTSTLALLNFGQSAIFSVGLTAIMVL-------ASQGILAGNLTIGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLSVDTKIKNKEMAPPLLITPQAATITFEDVYFEY----------LEGQKVLNGVSFEVPAGKKIAVVGGSGSGKSTLVRLLFRFFEPQRGNIYVAGQNIKDVSLESLRKAIGVVPQDAVLFHNTLYYNLHYGNINASPEEVYHVAKLAGLHDAILRMPHGYNTQVGERGLKLSGGEKQRVAIARAMLKNPPIILYDEATSSLDSITEETILSSMRDIVKHRTSVFIAHRLSTIVDADEIIVLDEGKVAERGTHFGLLANPSSLYSELWHTQS 668          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Xenopus
Match: ABCB7 (ATP binding cassette subfamily B member 7 [Source:NCBI gene;Acc:100487650])

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 343/608 (56.41%), Postives = 459/608 (75.49%), Query Frame = 1
Query:  199 KIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLDN-----NLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            KI+K +F YVWP DRP ++ RV +S+GLL G+K  NI +PF+FKY +D LN     + N     N       A++ GYG++R  ++  NE+RNAVF KVAQ SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+ PT+FEV LV+SILY++ G  ++L  +G +G+YT +T G+T WR K R EMN AD +AGN A+DSLLNYETVKYFNNEK+EA++Y+  LK YE +SLK   +LA LNFGQ+ IFS+GL ++M L       ASQ  ++  LT+GDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L+ V ++       P L I P  ++ITF++V F Y            G ++LNG+SF V  G+K+A+VGGSGSGKST++RLL+RFF+   G I + GQ+IK V+LESLR+++ V+PQD VLFH++++YNL YGN++ASP++VY  A++A LHD+I+RMP  Y T VGERGLKLSGGEKQRVAIARA+LK  PI+LYDEATSSLDSITE+ +LS++R    + TS+ IAHRLST++DA  I+VL +G++ E+G+H  L+++P S YS LWH Q+
Sbjct:   50 KILKAMFSYVWPKDRPDLRARVAISLGLLAGAKGMNIVVPFMFKYAVDSLNEMSGNVMNLSNAPNTVATMATAVLIGYGVSRAGSALFNEMRNAVFGKVAQSSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLGPTMFEVLLVSSILYYKCGAQFALATLGTLGAYTAFTIGITQWRTKFRIEMNKADNEAGNAAIDSLLNYETVKYFNNEKYEAERYDGFLKTYENSSLKTTSTLALLNFGQSAIFSVGLTAIMVL-------ASQGILAGNLTIGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLSVDTKIKNKEMAPPLLITPQAATITFEDVYFEY----------LEGQKVLNGVSFEVPAGKKIAVVGGSGSGKSTLVRLLFRFFEPQRGNIYVAGQNIKDVSLESLRKAIGVVPQDAVLFHNTLYYNLHYGNINASPEEVYHVAKLAGLHDAILRMPHGYNTQVGERGLKLSGGEKQRVAIARAMLKNPPIILYDEATSSLDSITEETILSSMRDIVKHRTSVFIAHRLSTIVDADEIIVLDEGKVAERGTHFGLLANPSSLYSELWHTQS 640          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Mouse
Match: Abcb7 (ATP-binding cassette, sub-family B (MDR/TAP), member 7 [Source:MGI Symbol;Acc:MGI:109533])

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 357/635 (56.22%), Postives = 466/635 (73.39%), Query Frame = 1
Query:  130 RYCHHEHLS---HADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN-SQVLLD-----NNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            R C H H     H D K         KIIK +  YVWP DRP ++ RV +S+G L G+K  NI +PF+FKY +D LN  S  +L+     N +A M   A++ GYG++R  A+  NE+RNAVF KVAQ+SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+LP VFE+ LV+S+LY++ G  ++L+ +G +G+YT +T  VT WR + R EMN AD  AGN A+DSLLNYETVKYFNNEK+EA +Y+  LK YE ASLK   +LA LNFGQN IFS+GL ++M L       ASQ  ++  LTVGDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L+ V +R       P L I P  +++ FDNV F Y            G ++LNG+SF V  G+KVAIVGGSGSGKSTI+RLL+RF++  +G I + GQ+++ V+LESLRR+V V+PQD VLFH++I+YNL YGN++ASP++VY  A++A LHD+I+RMP  Y+T VGERGLKLSGGEKQRVAIARA+LK  P++LYDEATSSLDSITE+ +L A+R    + TSI IAHRLSTV+DA  I+VL  G++ E+G+H  L+++  S YS +WH Q+
Sbjct:   93 RTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPEDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSDAPNTVATM-ATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIVFEMMLVSSVLYYKCGAQFALVTLGTLGAYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNEKYEAQRYDGFLKTYETASLKSTSTLAMLNFGQNAIFSVGLTAIMVL-------ASQGIVAGALTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLKVDTRIKDKVMAPPLQITPQTATVAFDNVHFEYI----------EGQKVLNGVSFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNLQDVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNINASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKNPPVILYDEATSSLDSITEETILGAMRDVVKHRTSIFIAHRLSTVVDADEIIVLSQGKVAERGTHYGLLANSSSIYSEMWHTQS 709          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Mouse
Match: Abcb6 (ATP-binding cassette, sub-family B (MDR/TAP), member 6 [Source:MGI Symbol;Acc:MGI:1921354])

HSP 1 Score: 407.527 bits (1046), Expect = 1.903e-130
Identity = 247/636 (38.84%), Postives = 361/636 (56.76%), Query Frame = 1
Query:  133 YCHHEHLSHADGKGNNTKTSDYKIIKKLFG--------YVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVL--LDNNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWR--YGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTW-TDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQ 2001
            Y  H H    D  GN  +++D +   +  G        Y+WP   P ++  V++ +GL+   +  N+ +P  ++  ++ L        L   +     L  + G G    S   ++ LR  ++ +V Q + R V   +F HLH L + +HL RRTG + +++DRG+  +  +L+ LVF+++PT+ ++  +  I+Y+   +   + LI   C+  Y   T  VT WR K R +MNT +     RA+DSLLN+ETVKY+  E +E D+Y   + K++    K   SL  LN  QN++  LGL +   L  +  F + Q      L VGD VL    + QL +PLN+ GT YR I+   IDM  MF L+   +       + P       I F+NV F Y          ++G + L  +SFTV  GQ VA+VG SG+GKSTI+RLL+RF+D   G I I GQDI  V   SLR  + V+PQDTVLF+D+I  N++YG ++A   +V  AA+ A +HD+I+  P  YET VGERGLKLSGGEKQRVAIAR +LK   I+L DEATS+LD+  E+ + ++L    +N T+IVIAHRLSTV++A  ILV+KDG I+E+G H+ L+S     Y+ +W  Q Q
Sbjct:  214 YTLHVHEEDQDVGGNQGRSTDRRSTWRDLGRKLRLLSSYLWPRGSPSLQLIVLICLGLMGLERALNVLVPIFYRDIVNLLTAKAPWSSLAWTVTTYVFLKFLQGGGTG--STGFVSNLRTFLWIRVQQFTSRGVELRLFSHLHELSLRWHLGRRTGEVLRIVDRGTSSVTGLLSYLVFSIIPTLADI--IIGIIYFSMFFNAWFGLIVFLCMSLYLILTIVVTEWRAKFRRDMNTQENATRARAVDSLLNFETVKYYGAEGYEVDRYREAILKFQGLEWKSTASLVVLNQTQNLVIGLGLLAGSLLCAY--FVSEQK-----LQVGDFVLFGTYITQLYMPLNWFGTYYRMIQTNFIDMENMFDLLKEETEVKDVPGAGPLRFHKGRIEFENVHFSY----------ADGQETLQDVSFTVMPGQTVALVGPSGAGKSTILRLLFRFYDISSGCIRIDGQDISQVTQISLRSHIGVVPQDTVLFNDTIANNIRYGRVTAGDSEVEAAAQAAGIHDAILSFPEGYETQVGERGLKLSGGEKQRVAIARTILKAPDIILLDEATSALDTSNERAIQASLAKVCTNRTTIVIAHRLSTVVNADQILVIKDGCIIERGRHEALLSR-GGVYAEMWQLQQQ 827          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Mouse
Match: Abcb8 (ATP-binding cassette, sub-family B (MDR/TAP), member 8 [Source:MGI Symbol;Acc:MGI:1351667])

HSP 1 Score: 225.713 bits (574), Expect = 1.736e-63
Identity = 195/647 (30.14%), Postives = 313/647 (48.38%), Query Frame = 1
Query:  181 TKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMG----LLLGSKVANIQIPFIF--------KYGIDYLNNSQVLLDNNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGAL---------------NKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLV--LVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDN--SLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLR-RSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQY*SLACRP 2025
            T+  + +   KLF   W    PH+     L++G    L LG+ + N+QIP +         KY  D++ +    +  +  L   L ++  YG+  +   G   L + +  ++A D    + K++F  L   D++F  +++TG L                 VI +G R    V+ +LV              S+L  R  L  +++    +G  T    G+     K+  +      +A   A ++L N  TV+ F  EK E ++Y+  L+     + ++ R +A      N+ F+     V+G     +F    +     L  GDL+  LV     Q S  +  L  ++ ++ + L     +F  M +           +P+     SITF NV F YP   G          +L   +  +  G+ VA+VG SG GK+T+  LL RF+D + G + + G D++++N   LR + +  I Q+ VLF  +I  N+++G L AS ++VY AAR A+ H+ I   P  Y T VGERG  LSGG+KQR+AIARAL+K+  +L+ DEATS+LD+ +E+ V  AL  A++  T +VIAHRLSTV  AH I+V+ +GQ+ E G+H++L+      YS L  +Q    SL   P
Sbjct:  107 TRAPELRFNWKLF---WHFLHPHL-----LALGAAIVLALGAALVNVQIPLLLGQLVEIVAKYTRDHMGS---FVSESRKLSVQLLLL--YGVQGLLTFGYLVLLSHIGERMAMD----MRKALFSSLLRQDIAFFDAKKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVIGSLV------------SLSMLSPRLTLMLAVVTPALMGVGTLMGSGL----RKLSRQCQEQIARATGVADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSNIAFN---CMVLG----TLFIGGSLVAGQQLKGGDLMSFLVASQTVQRS--MASLSVLFGQVVRGLSAGARVFEYMALSPVIPLTGGYCIPNKDIRGSITFQNVTFSYPCRPGF--------NVLKDFTLKLPSGKIVALVGQSGGGKTTVASLLERFYDPEAGSVTLDGHDLRTLNPSWLRGQVIGFISQEPVLFATTIMENIRFGKLDASDEEVYTAAREANAHEFISSFPDGYSTVVGERGTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRASAGRTVLVIAHRLSTVRAAHSIIVMANGQVCEAGTHEELLKK-GGLYSELIRRQTLDASLTSTP 702          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Mouse
Match: Abcb8 (ATP-binding cassette, sub-family B (MDR/TAP), member 8 [Source:MGI Symbol;Acc:MGI:1351667])

HSP 1 Score: 225.713 bits (574), Expect = 1.736e-63
Identity = 195/647 (30.14%), Postives = 313/647 (48.38%), Query Frame = 1
Query:  181 TKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMG----LLLGSKVANIQIPFIF--------KYGIDYLNNSQVLLDNNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGAL---------------NKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLV--LVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDN--SLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLR-RSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQY*SLACRP 2025
            T+  + +   KLF   W    PH+     L++G    L LG+ + N+QIP +         KY  D++ +    +  +  L   L ++  YG+  +   G   L + +  ++A D    + K++F  L   D++F  +++TG L                 VI +G R    V+ +LV              S+L  R  L  +++    +G  T    G+     K+  +      +A   A ++L N  TV+ F  EK E ++Y+  L+     + ++ R +A      N+ F+     V+G     +F    +     L  GDL+  LV     Q S  +  L  ++ ++ + L     +F  M +           +P+     SITF NV F YP   G          +L   +  +  G+ VA+VG SG GK+T+  LL RF+D + G + + G D++++N   LR + +  I Q+ VLF  +I  N+++G L AS ++VY AAR A+ H+ I   P  Y T VGERG  LSGG+KQR+AIARAL+K+  +L+ DEATS+LD+ +E+ V  AL  A++  T +VIAHRLSTV  AH I+V+ +GQ+ E G+H++L+      YS L  +Q    SL   P
Sbjct:  107 TRAPELRFNWKLF---WHFLHPHL-----LALGAAIVLALGAALVNVQIPLLLGQLVEIVAKYTRDHMGS---FVSESRKLSVQLLLL--YGVQGLLTFGYLVLLSHIGERMAMD----MRKALFSSLLRQDIAFFDAKKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVIGSLV------------SLSMLSPRLTLMLAVVTPALMGVGTLMGSGL----RKLSRQCQEQIARATGVADEALGNVRTVRAFAMEKREEERYQAELESCCCKAEELGRGIALFQGLSNIAFN---CMVLG----TLFIGGSLVAGQQLKGGDLMSFLVASQTVQRS--MASLSVLFGQVVRGLSAGARVFEYMALSPVIPLTGGYCIPNKDIRGSITFQNVTFSYPCRPGF--------NVLKDFTLKLPSGKIVALVGQSGGGKTTVASLLERFYDPEAGSVTLDGHDLRTLNPSWLRGQVIGFISQEPVLFATTIMENIRFGKLDASDEEVYTAAREANAHEFISSFPDGYSTVVGERGTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRASAGRTVLVIAHRLSTVRAAHSIIVMANGQVCEAGTHEELLKK-GGLYSELIRRQTLDASLTSTP 702          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Mouse
Match: Abcb5 (ATP-binding cassette, sub-family B (MDR/TAP), member 5 [Source:MGI Symbol;Acc:MGI:1924956])

HSP 1 Score: 220.705 bits (561), Expect = 4.945e-60
Identity = 157/489 (32.11%), Postives = 265/489 (54.19%), Query Frame = 1
Query:  556 SRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILY-WRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIF---SLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRT------WTDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQ 1992
            +R TG +NK+ D    GI   +  +  N+  + F +GLV S++  W+  L     +   + S    +  + S  +K   E++ A ++AG  A ++L + +TV  F  ++ E  +Y   LK  ++A +K + + + L+ G    F   + GLA   G       T+   G   G T+G ++ V    F +      +G++   ++   +   A F++  V  +        T   +P+ I+  +I F NV F YP        +    ++L GL+  +  G+ VA+VG SGSGKST ++LL R +D ++G I +   DI++ N+   R  + V+ Q+ VLF  +I  N+++G       ++ +AAR A+ +D I+  P ++ T VGE+G ++SGG+KQR+AIARAL++   IL+ DEATS+LD+ +E  V +AL  A+   T+IV+AHRLST+  A LI+ +KDG ++EKG+H +L++    YYS    Q
Sbjct:  166 TRMTGDINKLCD----GIGDKIPLMFQNI--SGFSIGLVISLIKSWKLSLVVLSTSPLIMASSALCSRMIISLTSK---ELD-AYSKAGAVAEEALSSIQTVTAFGAQEKEIQRYTQHLKDAKDAGIK-RATASKLSLGAVYFFMNGAYGLAFWYG-------TSLIFGGEPGYTIGTILAV---FFSVIHSSYCIGSVAPHLETFTVARGAAFNIFQVIDKKPNIDNFSTAGFVPECIE-GNIEFKNVSFSYP--------SRPSAKVLKGLNLKIKAGETVALVGPSGSGKSTTVQLLQRLYDPEDGCITVDENDIRAQNVRHYREQIGVVRQEPVLFGTTIGNNIKFGREGVGEKEMEQAAREANAYDFIMAFPKKFNTLVGEKGAQMSGGQKQRIAIARALVRNPKILILDEATSALDTESESLVQTALEKASKGRTTIVVAHRLSTIRGADLIVTMKDGMVVEKGTHAELMAKQGLYYSLAMAQ 624          

HSP 2 Score: 202.601 bits (514), Expect = 4.834e-54
Identity = 107/253 (42.29%), Postives = 165/253 (65.22%), Query Frame = 1
Query: 1231 PDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLS--ASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFL 1983
            PD  +  ++ F  V F YP            V +L  +S ++ KG+ VA VG SG GKST ++LL RF+D  +G++L+ G D+K +N++ LR   +++ Q+ VLF+ SI  N+ YG+ S     +++ E A  A++H  I  +P +Y T VG RG++LSGG+KQR+AIARALL+K  ILL DEATS+LD+ +E+ V  AL  A    T +V+AHRLST+ +A +I+VL++G I E+G+HQ+L+ +  +Y+  +
Sbjct: 1009 PDTCE-GNLEFREVSFVYPC--------RPEVPVLQNMSLSIEKGKTVAFVGSSGCGKSTCVQLLQRFYDPMKGQVLLDGVDVKELNVQWLRSQTAIVSQEPVLFNCSIAENIAYGDNSRMVPLEEIKEVADAANIHSFIEGLPRKYNTLVGLRGVQLSGGQKQRLAIARALLRKPKILLLDEATSALDNESEKVVQQALDKARRGKTCLVVAHRLSTIQNADMIVVLQNGSIKEQGTHQELLRNGDTYFKLV 1252          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q61102|ABCB7_MOUSE (ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus OX=10090 GN=Abcb7 PE=1 SV=3)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 357/635 (56.22%), Postives = 466/635 (73.39%), Query Frame = 1
Query:  130 RYCHHEHLS---HADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN-SQVLLD-----NNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            R C H H     H D K         KIIK +  YVWP DRP ++ RV +S+G L G+K  NI +PF+FKY +D LN  S  +L+     N +A M   A++ GYG++R  A+  NE+RNAVF KVAQ+SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+LP VFE+ LV+S+LY++ G  ++L+ +G +G+YT +T  VT WR + R EMN AD  AGN A+DSLLNYETVKYFNNEK+EA +Y+  LK YE ASLK   +LA LNFGQN IFS+GL ++M L       ASQ  ++  LTVGDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L+ V +R       P L I P  +++ FDNV F Y            G ++LNG+SF V  G+KVAIVGGSGSGKSTI+RLL+RF++  +G I + GQ+++ V+LESLRR+V V+PQD VLFH++I+YNL YGN++ASP++VY  A++A LHD+I+RMP  Y+T VGERGLKLSGGEKQRVAIARA+LK  P++LYDEATSSLDSITE+ +L A+R    + TSI IAHRLSTV+DA  I+VL  G++ E+G+H  L+++  S YS +WH Q+
Sbjct:   93 RTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPEDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSDAPNTVATM-ATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIVFEMMLVSSVLYYKCGAQFALVTLGTLGAYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNEKYEAQRYDGFLKTYETASLKSTSTLAMLNFGQNAIFSVGLTAIMVL-------ASQGIVAGALTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLKVDTRIKDKVMAPPLQITPQTATVAFDNVHFEYI----------EGQKVLNGVSFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNLQDVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNINASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKNPPVILYDEATSSLDSITEETILGAMRDVVKHRTSIFIAHRLSTVVDADEIIVLSQGKVAERGTHYGLLANSSSIYSEMWHTQS 709          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q704E8|ABCB7_RAT (ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus OX=10116 GN=Abcb7 PE=1 SV=1)

HSP 1 Score: 710.294 bits (1832), Expect = 0.000e+0
Identity = 356/636 (55.97%), Postives = 468/636 (73.58%), Query Frame = 1
Query:  130 RYCHHEHLS---HADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN-SQVLLD-----NNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSL--PDLIDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            R C H H     H D K         KIIK +  YVWP DRP ++ RV +S+G L G+K  NI +PF+FKY +D LN  S  +L+     N +A M   A++ GYG++R  A+  NE+RNAVF KVAQ+SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+LP VFE+ LV+S+LY++ G  ++L+ +G +G+YT +T  VT WR + R EMN AD  AGN A+DSLLNYETVKYFNNEK+EA +Y+  LK YE ASLK   +LA LNFGQ+ IFS+GL ++M L       ASQ  ++  LTVGDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L+ V +R   D ++  P  I P  +++ FDNV F Y            G ++L+G+SF V  G+KVAIVGGSGSGKSTI+RLL+RF++  +G I + GQ+I+ V+LESLRR+V V+PQD VLFH++I+YNL YGN++ASP++VY  A++A LHD+I+RMP  Y+T VGERGLKLSGGEKQRVAIARA+LK  P++LYDEATSSLDSITE+ +L A+R    + TSI IAHRLSTV+DA  I+VL  G++ E+G+H  L+++  S YS +WH Q+
Sbjct:   93 RTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSDAPNTVATM-ATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIVFEMTLVSSVLYYKCGAQFALVTLGTLGAYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNEKYEAQRYDGFLKTYETASLKSTSTLAMLNFGQSAIFSVGLTAIMVL-------ASQGIVAGALTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLKVDTRI-KDKAMASPLQITPQTATVAFDNVHFEYI----------EGQKVLSGVSFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNINASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATSSLDSITEETILGAMRDVVKHRTSIFIAHRLSTVVDADEIIVLSQGKVAERGTHYGLLANSSSIYSEMWHTQS 709          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. UniProt/SwissProt
Match: sp|O75027|ABCB7_HUMAN (ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB7 PE=1 SV=2)

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 355/636 (55.82%), Postives = 468/636 (73.58%), Query Frame = 1
Query:  130 RYCHHEHLS---HADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN-SQVLLD-----NNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSL--PDLIDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            R C H H     H D K         KIIK +  YVWP DRP ++ RV +S+G L G+K  NI +PF+FKY +D LN  S  +L+     N +A M   A++ GYG++R  A+  NE+RNAVF KVAQ+SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+LP +FEV LV+ +LY++ G  ++L+ +G +G+YT +T  VT WR + R EMN AD  AGN A+DSLLNYETVKYFNNE++EA +Y+  LK YE ASLK   +LA LNFGQ+ IFS+GL ++M L       ASQ  ++  LTVGDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L+ V ++   D  +  P  I P  +++ FDNV F Y            G ++L+G+SF V  G+KVAIVGGSGSGKSTI+RLL+RF++  +G I + GQ+I+ V+LESLRR+V V+PQD VLFH++I+YNL YGN+SASP++VY  A++A LHD+I+RMP  Y+T VGERGLKLSGGEKQRVAIARA+LK  P++LYDEATSSLDSITE+ +L A++    + TSI IAHRLSTV+DA  I+VL  G++ E+G+H  L+++PHS YS +WH Q+
Sbjct:   93 RTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPKDRPDLRARVAISLGFLGGAKAMNIVVPFMFKYAVDSLNQMSGNMLNLSDAPNTVATM-ATAVLIGYGVSRAGAAFFNEVRNAVFGKVAQNSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIMFEVMLVSGVLYYKCGAQFALVTLGTLGTYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNERYEAQRYDGFLKTYETASLKSTSTLAMLNFGQSAIFSVGLTAIMVL-------ASQGIVAGTLTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLKVDTQI-KDKVMASPLQITPQTATVAFDNVHFEY----------IEGQKVLSGISFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQS 709          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9LVM1|AB25B_ARATH (ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABCB25 PE=1 SV=1)

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 319/621 (51.37%), Postives = 435/621 (70.05%), Query Frame = 1
Query:  175 NNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQ-------VLLDNNLALMTGLA----IMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSG-LTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSR-TWTDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            +++  +D KI++ L GY+W  D P  + RV+ ++G L+G+KV N+Q+PF+FK  +D+L ++             N  L+T  A    ++ GYGIAR  +S  NELR AVF+KVA  +IR V + VF HLH LD+ +HLSR TG LN++IDRGSR INF+L+A+VFNV+PT+ E+ +V+ IL +++G  ++ I    +GSY  +T  VT WR K R  MN AD  A  RA+DSL+NYETVKYFNNE +EA++Y+  LKKYE+A+L+ QRSLA LNFGQ++IFS  L++ M L +         GI +G +TVGDLV+VNGLLFQLS+PLNFLG++YRE  Q+L+DM +MF L++ +S  T T ++ P ++   +I F+NV F Y              +IL+G+SF V  G+ VAIVG SGSGKSTI+R+L+RFFD D G I I GQDIK V L+SLR S+ V+PQDTVLF+D+IF+N+ YG LSA+ ++VYEAAR A +H++I   P +Y T VGERGLKLSGGEKQRVA+AR  LK   ILL DEATS+LDS TE  +L+AL+   SN TSI IAHRL+T +    I+VL++G+++E+G H +L+      Y+ LW QQN
Sbjct:  114 SDSAMADMKILRTLAGYLWMRDNPEFRFRVIAALGFLVGAKVLNVQVPFLFKLAVDWLASATGTGASLTTFAATNPTLLTVFATPAAVLIGYGIARTGSSAFNELRTAVFSKVALRTIRSVSRKVFSHLHDLDLRYHLSRETGGLNRIIDRGSRAINFILSAMVFNVVPTILEISMVSGILAYKFGAAFAWITSLSVGSYIVFTLAVTQWRTKFRKAMNKADNDASTRAIDSLINYETVKYFNNEGYEAEKYDQFLKKYEDAALQTQRSLAFLNFGQSIIFSTALSTAMVLCS--------QGIMNGQMTVGDLVMVNGLLFQLSLPLNFLGSVYRETIQSLVDMKSMFQLLEEKSDITNTSDAKPLVLKGGNIEFENVHFSYLPER----------KILDGISFVVPAGKSVAIVGTSGSGKSTILRMLFRFFDTDSGNIRIDGQDIKEVRLDSLRSSIGVVPQDTVLFNDTIFHNIHYGRLSATEEEVYEAARRAAIHETISNFPDKYSTIVGERGLKLSGGEKQRVALARTFLKSPAILLCDEATSALDSTTEAEILNALKALASNRTSIFIAHRLTTAMQCDEIVVLENGKVVEQGPHDELLGK-SGRYAQLWTQQN 715          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9FUT3|AB23B_ARATH (ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ABCB23 PE=1 SV=1)

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 312/620 (50.32%), Postives = 429/620 (69.19%), Query Frame = 1
Query:  175 NNTKT-SDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN--SQVLLDNNLALMTGLA----IMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSG-LTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTW---TDNSLPDLI-DPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            + TKT S  KI++ +  Y+W  D P ++ RV+ ++  L+G+K  N+Q+PF+FK  ID L++  S  + D+N  L+   A    ++ GYGIAR  +S  NELR AVF+KV+  +IR V + V  HLH LD+ +HL+R TGALN++IDRGSR IN +L+A+VFNV+PT+ E+ +VT IL + +G  ++LI    +GSY  +T  VT +R K R  MN AD  A  RA+DSL+NYETVKYFNNE +EA +Y+ LL +YE+A+L+ Q+SLA L+FGQ+ IFS  L++ M L +         GI +G +TVGDLV+VNGLLFQLS+PL FLG +YRE  Q L+DM ++F L++ RS      T+  LP L+    SI+F+NV F Y              +IL+G+SF V  G+ VAIVG SGSGKSTI+R+++RFFD D G + I GQDIK V LESLR  + V+PQDTVLF+D+IF+N+ YGNLSA+ ++VY+AAR A +HD+I++ P +Y T VGERGL LSGGEKQRVA+ARA LK   ILL DEAT++LDS TE  ++   R+  SN T I IAHRL+T +    I+V++ G+++EKG+HQ L+ +    Y+ LW QQN
Sbjct:   73 DQTKTASSKKILRTISSYLWMKDNPELRFRVIAALACLIGAKFLNVQVPFLFKLSIDLLSSYSSSTITDSNPYLLAAFATPSSVLIGYGIARSGSSAFNELRTAVFSKVSLRTIRSVSRKVLSHLHDLDLRYHLNRETGALNRIIDRGSRAINTILSAMVFNVVPTILEISMVTGILAYNFGPVFALITSLSVGSYIAFTLVVTQYRTKFRKAMNQADNDASTRAIDSLVNYETVKYFNNEDYEARKYDDLLGRYEDAALQTQKSLAFLDFGQSFIFSTALSTSMVLCS--------QGIMNGEMTVGDLVMVNGLLFQLSLPLYFLGGVYRETVQGLVDMKSLFQLLEERSDIGDKDTETKLPPLVLRGGSISFENVHFSYLPER----------KILDGISFEVPAGKSVAIVGSSGSGKSTILRMIFRFFDTDSGNVRIDGQDIKEVTLESLRSCIGVVPQDTVLFNDTIFHNIHYGNLSATEEEVYDAARRAVIHDTIMKFPDKYSTAVGERGLMLSGGEKQRVALARAFLKSPAILLCDEATNALDSKTEAEIMKTFRSLASNRTCIFIAHRLTTAMQCDEIIVMEKGKVVEKGTHQVLL-EKSGRYAKLWTQQN 673          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. TrEMBL
Match: R7VA42 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_149358 PE=4 SV=1)

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 363/610 (59.51%), Postives = 481/610 (78.85%), Query Frame = 1
Query:  199 KIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLD----NNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSG--LTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWT-DNSLPDLIDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQ 2001
            +IIK +  YVWP D+P ++ RVV+++ LLLG+K+AN+Q+PFIFKY +D+LN    LL+        + T +A++ GYG+AR  A GMNELRNAVFAKVAQ SIRR+ K+VFLHLH LD+SFHLSR+TGAL+K IDRG+RGINFVL+ALVFNV+PT+FEV LV++ILY++YG  ++L+++GCI +Y T+T  +T+WR K R +MN AD  AGN+A+DSL+NYETVKYFNNE +EA++Y+  L  YE+ASLK   SLA LN+GQNVIFS GL ++M       + A Q GI++G  +TVGDLV+VNGLLFQLSVPLNFLG++YRE++Q++IDM  +F+LMDV +     +N++P L+ P  + ++F+N+ F+Y            G +IL GLSF V  G+KVA+VGGSGSGKSTI+R+LYRFFD   G+ILI GQDI  V+++SLR+ + V+PQD+VLFHD+IF+N++YGNL ++ ++VY AARMAD+H++I+RMP QYET VGERGLKLSGGEKQRVAIARA+LK  PIL+YDEATSSLDSITEQ +L+AL+  T N T++VIAHRLSTV+DA  ILVL  G+I E+G+H  L+++P S Y  LW +QNQ
Sbjct:   16 RIIKTMLSYVWPRDQPGLRARVVVALSLLLGAKLANVQVPFIFKYLVDHLNEPSNLLNIASPEGTIITTAVALVLGYGLARAGAHGMNELRNAVFAKVAQSSIRRLAKNVFLHLHKLDLSFHLSRQTGALSKAIDRGTRGINFVLSALVFNVVPTIFEVSLVSAILYYKYGGQFALVSLGCIAAYATFTLSITAWRTKFRVQMNQADQHAGNKAIDSLINYETVKYFNNENYEAEKYDKYLALYEKASLKTTTSLAMLNWGQNVIFSAGLTAIM-------YLACQ-GIAAGRTMTVGDLVMVNGLLFQLSVPLNFLGSVYREVRQSIIDMQTLFTLMDVETSIKVKENAIPLLVTPVTADVSFENIHFQY----------LEGKEILKGLSFKVPAGKKVALVGGSGSGKSTIVRMLYRFFDPKSGQILINGQDISKVDIDSLRKVIGVVPQDSVLFHDTIFHNIKYGNLESTDEEVYNAARMADIHEAILRMPHQYETQVGERGLKLSGGEKQRVAIARAILKNPPILIYDEATSSLDSITEQKILNALQRVTQNRTTVVIAHRLSTVVDADEILVLDQGRIAERGTHFDLLTNPSSLYFNLWQKQNQ 607          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. TrEMBL
Match: T1JCD1 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 731.48 bits (1887), Expect = 0.000e+0
Identity = 359/619 (58.00%), Postives = 478/619 (77.22%), Query Frame = 1
Query:  169 KGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLN----NSQVLLDNNLALMT-GLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTG-ALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            K  + K ++ ++++ +  YVWP D P +++RV+++M LL+GSK+ N+Q+PFIFK+ +DYLN    N   L D    ++T   A++ GYG+AR  ++  NELRNA+FAKVAQ+SIR V ++VFLHLHSLD++FHLSR TG  L+K IDRGSRGINFVL+ALVFNV+PT+FEVGLV++ILY++ G  ++LI++GCIG+YTTYT G+T WR   R +MN A+ +AG +A+DSL+NYETVKYFNNE +EADQY+ +LKKYE+A+LK   SLA LNFGQNVIFS+ L+++M L + +I + S       +T+GDLV+VNGLLFQLS+PLNFLG++YRE++QALIDM  MFSL++V        + P L + P  ++I F+NV F Y           +G  IL  L+FTV  G+K+AIVGGSGSGKSTIIRLLYR+FD   GRILIGGQDI++V+L+SLR++++V+PQD VLFHD+I YNLQYG+   + +QV   ++MA+LHDSI+  P +YET VGERGLKLSGGEKQRVAIARA+LK SPIL++DEATSSLDS+TE N++ AL+ AT+N TSI IAHRLST++DA  ILVL  G ILE+G H+ L+++ +S YS LW  QN
Sbjct:   45 KEKSEKVTNLEVVRTMLQYVWPPDNPSLRKRVIIAMSLLVGSKILNVQVPFIFKHAVDYLNQETGNLLSLSDPTTTVITFSTALLLGYGVARTGSAFFNELRNAIFAKVAQNSIRCVARNVFLHLHSLDLTFHLSRHTGDRLSKAIDRGSRGINFVLSALVFNVIPTIFEVGLVSTILYYKCGGTFALISLGCIGAYTTYTLGITQWRTAFRIKMNKAENEAGAKAIDSLINYETVKYFNNESYEADQYDKVLKKYEDAALKTSTSLAFLNFGQNVIFSVSLSAIMILASKEIMSGS-------MTIGDLVMVNGLLFQLSLPLNFLGSVYREVRQALIDMENMFSLLNVEPNIQNKLNAPLLSVAPPQTNIVFENVCFHY----------MDGKPILQNLNFTVPAGKKIAIVGGSGSGKSTIIRLLYRYFDPQYGRILIGGQDIRNVSLDSLRQAIAVVPQDAVLFHDTILYNLQYGDFKKTIEQVENVSKMAELHDSIVTWPKKYETQVGERGLKLSGGEKQRVAIARAILKDSPILVFDEATSSLDSLTELNIMKALQRATTNRTSICIAHRLSTIMDADEILVLGSGHILERGDHRSLLANRNSVYSKLWKTQN 646          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. TrEMBL
Match: T1L1Y9 (Uncharacterized protein OS=Tetranychus urticae OX=32264 GN=107369424 PE=4 SV=1)

HSP 1 Score: 730.324 bits (1884), Expect = 0.000e+0
Identity = 361/627 (57.58%), Postives = 470/627 (74.96%), Query Frame = 1
Query:  148 HLSHADG-KGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLDN-----NLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQ 2001
            H S A+G    N K   + IIK++  YVWP D+P +K+RVV+++GLL+ +K  N+ +PFIFKY ID+LN SQ    N       A+ + ++++  YG+ R SAS  NELRNAVFAKVA DSIR V ++VFLHLH LD+SFHLSR+TGAL+K IDRG+RGINFVL+A+VFNV PT+ EV L +SILY++ G  ++ I + CIGSY+ +TFGVTSWR K R +MN A+  AGN A+DSL+NYETVKYFNNE+ EA  YE +LKKYEEASLK   SLA LNFGQN IFS  LA VMGL    I       I+  +TVGDLV+VNGL+FQLS+PLNFLGT+YRE++Q+LIDM  MFS++ ++S   +    P L + P  +S+ FDNV F Y     ++N       ILN LSF V  G+KVA +GGSGSGK+TIIRL+YRFF+  +G++L+ GQDIK ++++SLR+++SV+PQD VLF+++I YNLQYGN SAS ++++EA+ MA+LHDSI R P  Y+T VGERGLKLSGGEKQRVAIARA++K SPIL++DEATSSLDSITE  +L AL  A    TSI IAHRLSTV+DA LI VL+DG+++E G+H  L+++P S Y+ LW +Q++
Sbjct:   42 HGSEANGLTSANNKVGSWSIIKQMTSYVWPKDKPELKKRVVVALGLLVAAKAVNVSVPFIFKYLIDFLNTSQGTPLNFSDPATTAITSAISLVVAYGVFRASASLFNELRNAVFAKVAHDSIRTVARNVFLHLHKLDLSFHLSRQTGALSKAIDRGTRGINFVLSAIVFNVAPTILEVALASSILYYKCGPQFAAITLICIGSYSAFTFGVTSWRTKFRLQMNKAENDAGNHAIDSLINYETVKYFNNEQHEAALYEKVLKKYEEASLKTSTSLAMLNFGQNAIFSSALAGVMGLAVVQI-------INGNMTVGDLVMVNGLVFQLSMPLNFLGTVYREVRQSLIDMKTMFSILSLKSAIQSKPGAPFLKVTPENASVVFDNVYFEY-----VKNQ-----PILNNLSFEVPAGKKVAFIGGSGSGKTTIIRLMYRFFEPQQGKVLVAGQDIKDIDVDSLRQAISVVPQDPVLFNNTIEYNLQYGNFSASQERIHEASSMAELHDSIQRWPKAYQTQVGERGLKLSGGEKQRVAIARAIVKNSPILIFDEATSSLDSITEHKILKALSRAAHGRTSICIAHRLSTVVDADLIYVLQDGRVVETGNHSSLVANPSSLYALLWSKQHE 651          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. TrEMBL
Match: A0A504Y7F4 (ATP-binding cassette sub-family B member 7 mitochondrial OS=Fasciola gigantica OX=46835 GN=FGIG_02940 PE=4 SV=1)

HSP 1 Score: 727.243 bits (1876), Expect = 0.000e+0
Identity = 361/626 (57.67%), Postives = 466/626 (74.44%), Query Frame = 1
Query:  190 SDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGID-YLNNSQVLLDNNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGL--------------------TVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLI---DPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQ 1995
            SD+ I+ +L GY+WPADRP I+ RVV ++ LLL SKV N+ +PF+FK+ +D +  N    L +       L ++  YG+ R +ASG+NELR AVFA+ AQ SIR+VG  VF H+H LD+S+HL RRTGAL K IDRG+RGI F+L ALVFN+LPT  EV +VT ILY++YGLP SLIA+ CIG+YT++TF VT WR + R EMN AD++AG++A DSL+NYETVKYFNNE+ E   Y+ L  +YE AS+K   SLA LNFGQ  IFS GLA+ M      +   SQ+ +S+GL                    T+GDLVLVNGLLFQLSVPLNFLGTMYRE++Q+LIDM+ MFSLM+++    +    P+LI     +SI F++V+F Y  + G  N +  G  I +GLSF V  G++VA+VGGSG+GKST++RL+YRFFD   GR+LIGGQD+++VNL+SLRR++SV+PQDTVLFH++I+YNLQYGNL+A+ +QVYEAA++ADL  +I RMP  YET VGERGLKLSGGEKQR+AIARALLK SPIL+YDEATSSLD+ITEQ +L  L   T  +TS+VIAHRLST++DA  ILVL+DG++ E+G+H  L+S P+SYY  LW QQ
Sbjct:   96 SDWTIVTRLLGYIWPADRPEIRWRVVAALCLLLSSKVVNVLVPFVFKHAVDCFSGNVPAPLSSWSPSSAALTVLVCYGLFRATASGLNELRTAVFARAAQSSIRQVGVQVFRHMHDLDLSYHLGRRTGALGKAIDRGARGIQFILTALVFNLLPTGLEVAMVTGILYYKYGLPASLIALTCIGAYTSFTFAVTRWRTQFRVEMNRADSRAGSQATDSLINYETVKYFNNEQREISIYDHLQSQYERASIKTTTSLAVLNFGQAAIFSAGLAAAM------VIVGSQVAVSTGLEPNTATSLIGAFAANAAQGLTIGDLVLVNGLLFQLSVPLNFLGTMYREVRQSLIDMSTMFSLMELKPAVRSLPGAPNLIIDKSNASIEFEDVRFAY-YSRGPGNQDVVGKNICDGLSFKVEPGKRVAVVGGSGAGKSTLVRLVYRFFDVQGGRVLIGGQDVRTVNLDSLRRAISVVPQDTVLFHNTIYYNLQYGNLNATKEQVYEAAQLADLASAIQRMPHGYETQVGERGLKLSGGEKQRLAIARALLKGSPILIYDEATSSLDTITEQTILRRLTKVTPGLTSLVIAHRLSTIVDADEILVLRDGRVSERGNHFSLLSQPNSYYGQLWEQQ 714          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. TrEMBL
Match: A0A4E0RMH9 (ATP-binding cassette sub-family B member 7 mitochondrial OS=Fasciola hepatica OX=6192 GN=D915_000381 PE=4 SV=1)

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 361/626 (57.67%), Postives = 465/626 (74.28%), Query Frame = 1
Query:  190 SDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLN-NSQVLLDNNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGL--------------------TVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLI---DPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQ 1995
            SD+KI+ +L GY+WPADRP I+ RVV ++ LLL SKV N+ +PF+FK+ +D  + N    L +       L ++  YG+ R +ASG+NELR AVFA+ AQ SIR+VG  VF H+H LD+S+HL RRTGAL K IDRG+RGI F+L ALVFN+LPT  EV +VT ILY +YGLP SLIA+ CIG+YT++TF VT WR + R EMN AD++AG++A DSL+NYETVKYFNNE+ E   Y+ L  +YE AS+K   SLA LNFGQ  IFS GLA+ M      +   SQ+ +S+GL                    T+GDLVLVNGLLFQLSVPLNFLGTMYRE++Q+LIDM+ MFSLM+++    +    P+LI     +SI F++V+F Y  + G  N +  G  I +GLSF V  G++VA+VGGSG+GKST++RL+YRFFD   GR+LIGGQD+++VNL+SLRR++SV+PQDTVLFH++I+YNLQYGNL+A+ +QVYEAA++ADL  +I  MP  YET VGERGLKLSGGEKQR+AIARALLK SPIL+YDEATSSLD+ITEQ +L  L   T  +TS+VIAHRLST++DA  ILVL+DG++ E+G+H  L+S P+SYY  LW QQ
Sbjct:   96 SDWKIVTRLLGYIWPADRPEIRWRVVAALCLLLSSKVVNVLVPFVFKHAVDCFSGNVPAPLSSWSPSSAALTVLVCYGLFRATASGLNELRTAVFARAAQSSIRQVGVQVFRHMHDLDLSYHLGRRTGALGKAIDRGARGIQFILTALVFNLLPTGLEVAMVTGILYHKYGLPASLIALTCIGAYTSFTFAVTRWRTQFRVEMNRADSRAGSQATDSLINYETVKYFNNEQREISIYDHLQSQYERASIKTTTSLAVLNFGQAAIFSAGLAAAM------VIVGSQVAVSTGLEPNTATSLIGAFAANAAQGLTIGDLVLVNGLLFQLSVPLNFLGTMYREVRQSLIDMSTMFSLMELKPAVRSLPGAPNLIIDKSNASIEFEDVRFAY-YSRGPGNQDVVGKNICDGLSFKVEPGKRVAVVGGSGAGKSTLVRLVYRFFDVQGGRVLIGGQDVRTVNLDSLRRAISVVPQDTVLFHNTIYYNLQYGNLNATKEQVYEAAQLADLASAIQCMPHGYETQVGERGLKLSGGEKQRLAIARALLKGSPILIYDEATSSLDTITEQTILRRLTKVTPGLTSLVIAHRLSTIVDADEILVLRDGRVSERGNHFSLLSQPNSYYGQLWEQQ 714          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Cavefish
Match: abcb7 (ATP-binding cassette, sub-family B (MDR/TAP), member 7 [Source:ZFIN;Acc:ZDB-GENE-050517-10])

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 347/635 (54.65%), Postives = 466/635 (73.39%), Query Frame = 1
Query:  130 RYCHHEHLS---HADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN-SQVLLD-----NNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLI---DPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            R C H +     +AD K    + +  KII  +  YVWP DRP ++ RV +S+GLL G+K+ N+ +PF+FKY +D LN  S  +L+     N +A M   A++ GYG++R  ++  NELRNAVF KVAQ SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+ PTVFE+ LV++ILY++ G  ++L+ +G + +YT +T  VT WR + R EMN AD +AGN A+DSLLNYETVKYFNNEK+EA++Y+  LK YE +SLK   +LA LNFGQ+ IFS GL ++M L       ASQ  ++  +TVGDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDM+ +F+L+ V ++       P L+     ++I F++V F Y            G ++LNG+SF V  G+KVAIVGGSGSGKSTI+RLL+RF++   G I I  Q+I+ V+L+SLR+S+ V+PQD VLFH++IFYNLQYGN++A+ + VY  AR+A +HD+I+RMP  YET VGERGLKLSGGEKQRVAIARA+LK  P+LLYDEATSSLDSITE+N+L++++    + TS+ IAHRLST++DA  I+VL  G++ E+G HQ L+  P S Y+ LWH QN
Sbjct:   87 RTCWHGNAGGGLNADPKNVLKEVNSTKIISAMLSYVWPKDRPDLRARVAISLGLLAGAKMTNVMVPFMFKYAVDSLNQMSGHMLNLSDAPNTVATM-ATAVLIGYGVSRAGSALFNELRNAVFGKVAQSSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLGPTVFEMALVSAILYYKCGGQFALVTLGTLSAYTAFTIAVTQWRTRFRIEMNKADNEAGNAAIDSLLNYETVKYFNNEKYEAERYDGYLKVYESSSLKTTSTLAMLNFGQSAIFSFGLTAIMVL-------ASQGIMAGTMTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMDTLFTLLSVDTKVKEKALAPPLLVTPQEATIRFEDVYFEY----------LEGQKVLNGVSFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQRGNIYIANQNIRDVSLDSLRKSLGVVPQDAVLFHNTIFYNLQYGNINATAEDVYRVARLAGIHDAILRMPHGYETQVGERGLKLSGGEKQRVAIARAILKNPPVLLYDEATSSLDSITEENILASMKEMVKDRTSVFIAHRLSTIVDADEIIVLNQGKVAERGDHQTLLRMPGSLYADLWHTQN 703          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Cavefish
Match: abcb6a (ATP binding cassette subfamily B member 6 (Langereis blood group) [Source:NCBI gene;Acc:103035668])

HSP 1 Score: 402.905 bits (1034), Expect = 8.101e-129
Identity = 246/606 (40.59%), Postives = 362/606 (59.74%), Query Frame = 1
Query:  199 KIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVL--LDNNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYW--RYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQ 2001
            K ++ L  Y+WP+    ++  V+L + LL   +  N+ +P  +K  ++ L        +   + +   L  + G G    S+  ++ +R+ ++ +V Q + R V   +F HLH+L + +HL RRTG + + IDRG+  ++ +L+ +VF++ PT+ ++  V +I+Y+   +   + LI   C+  Y T T  +T WR K R +MNT D  A  +A+DSLLN+ETVKY+N E +E  ++E  ++KY+    K   SLA LN  QN+I   GL +   L  + +             VGD VL    + QL  PLN+ GT YR I+++ IDM  MF L         D +  +L      I F+NV F Y          + G +IL  +SFTV  GQ VA+VG SGSGKSTIIRLL+RF+D   G I I GQDI  V  +SLR  + V+PQDTVLF+D+I  N++YG +SA+ ++V EAA  AD+H+ I+  P  Y T VGERGLKLSGGEKQRVAIAR +LK   I+L DEATS+LD+ TE+N+ ++L    +N T+IV+AHRLST++ A  ILV++DGQI E+G H++L++     YS +W +Q Q
Sbjct:  236 KKVRLLVPYMWPSGSVFLQLLVILCLCLLGVERAINVFVPIYYKNIVNQLTGGSAWKTVSVTVCVYVLLKFLQGGGAG--SSGFISNMRSFLWIRVQQYTSRVVQVRLFAHLHALSLRWHLGRRTGEVIRSIDRGTSSVDSLLSYIVFSIFPTIADI--VIAIIYFISYFNAWFGLITFVCMALYLTLTIIITEWRTKYRRDMNTHDNNAKAKAVDSLLNFETVKYYNAESYEVGRFEEAIQKYQLLEWKTNASLALLNQTQNLIIGSGLLAGSLLCAYFV-------TEGKFEVGDYVLFGTYILQLYTPLNWFGTYYRVIQRSFIDMENMFQLFTEEQEVKDDVNAGNLNYRQGRIEFENVFFSY----------TEGKEILKDVSFTVLPGQTVALVGQSGSGKSTIIRLLFRFYDVQGGCIRIDGQDIAKVKQDSLRAHIGVVPQDTVLFNDNIRENVRYGRVSATDEEVEEAAMAADIHERILSFPEGYTTQVGERGLKLSGGEKQRVAIARTILKAPQIILLDEATSALDTQTERNIQASLAKVCANRTTIVVAHRLSTIIGADQILVIRDGQIAERGGHEELLAK-GGLYSDMWLKQQQ 819          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Cavefish
Match: abcb6b (ATP-binding cassette, sub-family B (MDR/TAP), member 6b [Source:ZFIN;Acc:ZDB-GENE-070912-584])

HSP 1 Score: 369.777 bits (948), Expect = 2.815e-119
Identity = 237/591 (40.10%), Postives = 352/591 (59.56%), Query Frame = 1
Query:  214 LFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLDNNLALMTGLAIMGGYGIARISASG-MNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYW--RYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLAS----VMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTD---NSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLIS 1956
            L  Y+WP+    ++  V++ + LL   +V N+ +P I+   I+ L++ +    N LA+   + +   +     + SG ++ +R+ ++ +V Q + R V   +F HLH+L + +HL R+TG + + IDRG+  ++ +L  +VF +LPT+ ++  + +I+Y+   +   + LI   C+  Y   T  +T WR K R +MNT D  A ++A+DSLLN+ETVKY+N+E +E  ++E  + KY+E   K   SLA LN  QN+I   GL +        +T D F            VGD VL    + QL  PLN+ GT Y  I+ A +DM  MF L+            N++  L     + F +V F Y              +IL  +SFTV  GQ VA+VG SGSGKSTIIRLL+RF+D  +G ILI  QDI  V   SLR  + V+PQDTVLF+D+I  N++YG +SAS  +V +AA  AD+H  I+ +P  Y++ VGERGLKLSGGEKQRVAIAR +LK   I+L DEATS+LD+ TE+N+ ++L    ++ T IV+AH LST++ A LILVL +GQI E+G H++L++
Sbjct:   13 LMPYMWPSGSGPLQLLVLVCVTLLGLERVINVFVP-IYSKDINQLSDKENW--NTLAITVCIYVFLKFLQGGGATSGFVSNMRSFLWTRVQQHTSRTVQLQLFAHLHALSLRWHLGRKTGDVLRSIDRGTSSVSNLLY-IVFTILPTIADI--IIAIVYFVSYFNAWFGLIVFICMFLYLL-TIVITEWRTKYRRDMNTQDNNAKSKAVDSLLNFETVKYYNSEGYEVSRFEEAILKYQE--WKASASLALLNQTQNLIIGSGLLAGSLLCAYFVTVDKFQ-----------VGDYVLFGTYIVQLYTPLNWFGTYYM-IQTAFVDMENMFELLTEEKELQVKDDVNAVDLLCTEGRVEFRDVCFSY-----------TAKEILRNVSFTVMPGQTVALVGQSGSGKSTIIRLLFRFYDVQDGSILIDDQDISKVKQSSLRSFIGVVPQDTVLFNDNIRENIRYGRISASDKEVEDAALAADIHHKILSLP-DYDSQVGERGLKLSGGEKQRVAIARTILKGPRIILLDEATSALDTQTERNIQASLTRVCASRTCIVVAH-LSTIISADLILVLHEGQIAERG-HEELLA 568          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Cavefish
Match: abcb5 (ATP-binding cassette, sub-family B (MDR/TAP), member 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6414])

HSP 1 Score: 214.542 bits (545), Expect = 4.374e-58
Identity = 147/410 (35.85%), Postives = 223/410 (54.39%), Query Frame = 1
Query:  799 TADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSG--LTVGDLV-----LVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMD-VRSRTWTDNSLPDLIDPSS----ITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQ 1992
            +A  +AG  A + L+   TV  FN ++  A++YE  L             +   +FG     +  ++  MGL  F IF A  +    G  LTV D V      V  + F + +    LG     ++       A +S+ + +      D+S  +   P S    I F NV F YP        +   V+IL G+S  V  G+ +A+VG SG GKST I+LL RF+D + G + + G+DI+S+N+  LR ++ ++ Q+ VLF  +I  N++YG   A+   +  A R A+ ++ I ++P    T VGERG +LSGG+KQR+AIARAL+K   ILL DEATS+LD+ +E  V +AL  A +  T+IVIAHRLST+  A +I   KDG+++E+G+H +L+S    Y+S +  Q
Sbjct:  218 SAYAKAGAVAEEILVAIRTVVAFNGQQKAAEKYEKNL-------------ITAKDFGVKKAVTTNVS--MGLTQFFIFGAYALAFWYGTKLTVDDPVNYSIGKVIIVFFSVMIGAFSLGQGAPNLESVAKARGAAYSIYNTIDMPRPIDSSSEEGYKPDSVRGDIEFRNVHFSYP--------SRKDVKILQGMSLKVPHGKTIALVGASGCGKSTTIQLLQRFYDPEAGEVTLDGRDIRSLNVRWLRENMGIVSQEPVLFGTTIAENIRYGREDATDQDIDRAVREANAYEFISKLPDGLNTMVGERGAQLSGGQKQRIAIARALVKNPKILLLDEATSALDTQSEAIVQAALDKARAGRTTIVIAHRLSTIRTADVIAGFKDGEVVEQGTHGELMSKKGVYHSLVMQQ 604          

HSP 2 Score: 204.912 bits (520), Expect = 6.274e-55
Identity = 109/248 (43.95%), Postives = 165/248 (66.53%), Query Frame = 1
Query: 1255 ITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLS--ASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQ 1992
            I F +V F YP    I+        IL GL+ +V +GQ +A+VGGSG GKST I+LL RF++   G++   G D + +NL  LR  + ++ Q+ +LF  +I  N+QYG+ S   S ++V EAA  A++H+ I  +P +Y T VG++G +LSGG+KQR+AIARAL++K  +LL DEATS+LD+ +E+ V  AL  A    T IVIAHRL+TV +A +I V+++GQ++E+G H +L++   +YY+ +  Q
Sbjct: 1026 IEFRDVHFFYPTRPNIK--------ILQGLNVSVTQGQTLALVGGSGCGKSTSIQLLERFYNPAGGQVFADGMDTRGLNLAWLRSQLGLVSQEPILFDCTITENIQYGDNSRVVSQEEVVEAAISANIHNFISDLPEKYNTRVGDKGTQLSGGQKQRIAIARALVRKPKVLLLDEATSALDTESEKIVQKALDEARKGRTCIVIAHRLTTVQNADIIAVIQNGQVVEQGMHSELMAKHGAYYALVNAQ 1265          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Cavefish
Match: abcb4 (multidrug resistance protein 1 [Source:NCBI gene;Acc:103043081])

HSP 1 Score: 209.92 bits (533), Expect = 8.428e-57
Identity = 138/411 (33.58%), Postives = 235/411 (57.18%), Query Frame = 1
Query:  796 NTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEA-SLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDI--FTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIK---QALIDMNAMFSLMDVRSR--TWTDNSL-PDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQ 2001
             TA  +AG  A + L    TV  F  +K E  +Y+   K  E+A ++ I++++        V  S+G    M  M++ +  +  S + I+    VG+L+ V    F + +    +G     I+    A    + +FS++D +    ++++    PD++   +I F N+ F YP        +   V++LNG++  +  GQ +A+VG SG GKST ++LL RF+D  EG + I   DI+S+N+  LR  + V+ Q+ VLF  SI  N++YG    + +++ +A R A+ +D I+++P ++ET VG+RG ++SGG+KQR+AIARAL++   ILL DEATS+LD+ +E  V +AL       T+I++AHRLST+ +A +I   ++G+I+E G+H +L+     Y S +  Q+ +
Sbjct:   37 QTAYAKAGAVAEEVLSAIRTVFAFGGQKKELKRYQ---KNLEDAKNVGIRKAIM-------VNISVGFVYFMIYMSYALAFWYGSTLIIAKEYQVGNLLTV---FFAVIIGAFGIGQTSPNIQAFASARGAAHKVFSIIDHKPSIDSFSEEGYKPDVVK-GNIEFRNIHFNYP--------SRQDVKVLNGMNLKIRSGQTIALVGSSGCGKSTTVQLLQRFYDPQEGTVTIDDHDIRSMNVRCLRELIGVVSQEPVLFATSIAENIRYGREDVTQEEIEQATREANAYDFIMKLPDKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAIVQAALDKVRLGRTTIIVAHRLSTIRNADVIAGFQNGKIVELGTHDELMGMKGVYQSLVTMQEEK 425          

HSP 2 Score: 199.519 bits (506), Expect = 2.867e-53
Identity = 102/249 (40.96%), Postives = 161/249 (64.66%), Query Frame = 1
Query: 1252 SITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLS--ASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQ 1992
            ++ F +V F+YP        +   V +L GL   V KGQ +A+VG SG GKST I+LL RF+D  +G +++  +D K +N+  LR  + ++ Q+ VLF  S+  N+ YG+ S   + +++  AA+ A++H  I  +P +Y T  G++G +LSGG+KQR+AIARA+L+   +LL DEATS+LD+ +E+ V  AL  A    T IV+AHRLST+ +A +I V ++G ++E+G+HQQL++    YY+ +  Q
Sbjct:  762 NVRFHDVHFKYP--------SRPDVPVLQGLRLRVKKGQSLALVGSSGCGKSTTIQLLERFYDPMQGAVMLDDKDAKQLNIHWLRSQIGIVSQEPVLFDCSLAENIAYGDNSRQVTQEEIERAAKAANIHSFIQELPQKYLTQAGDKGTQLSGGQKQRIAIARAILRNPKLLLLDEATSALDTESEKIVQEALDKAREGRTCIVVAHRLSTIQNADVIAVFQNGVVVEQGTHQQLLNQQGVYYTLVNSQ 1002          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Sea Lamprey
Match: abcb6b (ATP-binding cassette, sub-family B (MDR/TAP), member 6b [Source:ZFIN;Acc:ZDB-GENE-070912-584])

HSP 1 Score: 366.311 bits (939), Expect = 5.516e-120
Identity = 206/461 (44.69%), Postives = 291/461 (63.12%), Query Frame = 1
Query:  628 LVFNVLPTVFEVGLVTSILYWR--YGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTD-NSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQ 2001
            +VF++LPT+  V +V +I+Y+   +   + LI   C+  Y   T  +T WR K R EMNT D Q+ ++A+DSLLN+ETVKY+N E +E  ++   + +Y++A  K   SLA LN  QNV+       +   +      ++       L VGD VL    + QL VPLN+ GT YR I+ + IDM  MF L         D N++   +    + FDNV F Y           NG  IL  +SFTV  G+ +A+VG SG+GKST++RLL+RF+D   G I I GQDI  V  +SLR+ + V+PQDTVLF+D+I  N++YG ++AS ++V EAAR AD+HD I+  P  Y T VGERGLKLSGGEKQRVAIAR +LK   ++L DEATS+LD+ TE+N+ ++L    +N TS+VIAHRLST+++A  ILVL+DGQI+E+G H +L++     Y+ +W +Q+Q
Sbjct:    3 IVFSILPTI--VDIVIAIIYFVTFFNAWFGLIVFVCMCVYLGITIAITEWRTKYRREMNTKDNQSKSKAVDSLLNFETVKYYNAESYEVQRFNQTIVEYQDAEWKTNASLAVLNQAQNVV-------IALGLLAGSLLSASFVTHKKLQVGDFVLFGTYIIQLYVPLNWFGTYYRMIQSSFIDMENMFELFGEEKEVVDDVNAVSLHLAHGKVEFDNVSFNY----------VNGKDILKNVSFTVPSGKTIALVGPSGAGKSTVMRLLFRFYDVKSGCISIDGQDISKVKQKSLRQHIGVVPQDTVLFNDTIRNNIRYGRVTASDEEVEEAARAADIHDRILSFPEGYNTQVGERGLKLSGGEKQRVAIARTILKAPELILLDEATSALDTQTERNIQASLAKICANRTSVVIAHRLSTIINADQILVLQDGQIVERGRHDELLT-KGGIYTDMWSKQSQ 443          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001786.1 (pep scaffold:Pmarinus_7.0:GL477870:201625:214977:-1 gene:ENSPMAG00000001622.1 transcript:ENSPMAT00000001786.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 225.328 bits (573), Expect = 3.618e-66
Identity = 152/410 (37.07%), Postives = 228/410 (55.61%), Query Frame = 1
Query:  793 MNTADTQAGNRALDSLLNYETVKYFN-NEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMG---ISSG-LTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLM--DVRSRTWTDNSL-PDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLS--ASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQ 1992
            +  A  QA   + +++ N  TV      EKF     + LL+ Y      I+R        +  +FS+      G++ F      ++G   ++ G LT  D+  V G +   ++ +     M     +A +    + +L+  ++   ++++  + PD  D   +    V FRYP             ++L G+S  VA GQ +A+VG SGSGKSTI++LL RF+D+  G++L+ G +++ +NL  LRR + V+ Q+ VLF  SI  N+ YG++S   S D+V  AAR A+LHD +  +P  Y+T VGERG +LSGG+KQRVAIARALL+   +LL DEATS+LD+ +E+ V  AL  A    T IVIAHRLSTV  A +I VL+DG I E GSH++L+S    YY  +  Q
Sbjct:   94 IKRAYEQASKISTEAVQNIRTVASLCLEEKFSGMFEQCLLEPYR----VIKR--------RGYLFSVTFGFTQGILCFAYAAVFRLGGFLVAQGELTFQDVYKVFGAIIFGALAVGQAMAMAPNYGRAKVSAARILALLRREMAIDSYSEGGIQPDAFD-GELQLSGVHFRYP--------TRPHAEVLRGVSLRVAPGQTLALVGPSGSGKSTIMQLLLRFYDSSAGQLLLNGVEVRQLNLGWLRRQLGVVSQEPVLFGCSIAENIAYGDVSRAVSRDEVVAAARAANLHDFVESLPQAYDTVVGERGAQLSGGQKQRVAIARALLRDPRVLLLDEATSALDAESEKVVQDALEKAQQGRTCIVIAHRLSTVRAADVIAVLQDGDICELGSHEELLSARGLYYRLVEAQ 482          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Sea Lamprey
Match: abcb11b (ATP-binding cassette, sub-family B (MDR/TAP), member 11b [Source:ZFIN;Acc:ZDB-GENE-050517-14])

HSP 1 Score: 218.394 bits (555), Expect = 4.231e-60
Identity = 149/399 (37.34%), Postives = 214/399 (53.63%), Query Frame = 1
Query:  832 DSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSL-AGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMY-------REIKQALIDMNAMFSLMDVRSRTWTDNSLPDLIDP-----SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGN--LSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFL 1983
            +S++N  TV     E+    QY   L     A+++      A  +F Q+VIF               FT +      G  V    L   L+F++   L F GT          +  +A I    +F L D   RT   +S PD           +TF N  F YP        +    Q+LNGLS +V  GQ +A+VG SG GKST ++LL RF+D D G++LI G+D ++VN+  LR  + ++ Q+ VLF  SI  N++YG      + D+V  A++ A LHD ++ +P +YET VG++G +LS GEKQRVAIARA+++   ILL DEATS+LD+ +EQ V SAL  A    T IVIAHRLST+ +A  I V+  G ++EKG+H +L+    +YY  +
Sbjct:  928 ESIVNIRTVAGLGKERTFVKQYTDSLTVPHRAAIRKANVFGATFSFSQSVIF---------------FTYAASFRYGGFLVAHDGLKFPLVFRVFSALVFSGTALGRASSYAPDYAKAKISAARLFKLFD---RTPAIDSSPDKGVSWDGFRGDVTFTNCTFTYP--------SRPDTQVLNGLSVSVQPGQTLALVGTSGCGKSTSVQLLERFYDPDGGQVLIDGRDSRTVNVGFLRSKIGIVSQEPVLFDCSIADNIRYGANFRELTWDEVINASKAAQLHDFVMGLPEKYETNVGDKGAQLSRGEKQRVAIARAIIRDPRILLLDEATSALDTESEQTVQSALDQARQGRTCIVIAHRLSTIQNADQIAVISQGLVIEKGTHNELMDAQGAYYKLV 1300          

HSP 2 Score: 162.155 bits (409), Expect = 1.537e-41
Identity = 97/243 (39.92%), Postives = 154/243 (63.37%), Query Frame = 1
Query: 1255 ITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFL 1983
            I F NVKF YP    +          L+  +  V  G+  A VG SG+GKST ++L+ RF+D  EG++ + G DI+S+NL  +R  + V+ Q+ +LF  +I  N++YG  + +  +V +AAR A+ ++ I+ +P +++T VGE G ++SGG+KQR+AIARAL++   ILL D+ATS+LD+ +E  V SAL       T+I IAHRLST+  A +I+  + G  +E+GSH+ L++    Y++ +
Sbjct:  423 IEFHNVKFSYPTRLDL--------TALHSFNLKVNAGETTAFVGPSGAGKSTAMQLIQRFYDPQEGKVTLDGHDIRSLNLRWMRSLIGVVEQEPILFATTIAENIRYGRDNVTVSEVEQAARRANAYNFIMELPHKFDTMVGEGGGQMSGGQKQRIAIARALVRNPRILLLDQATSALDNESEAVVQSALDKVRKGCTTISIAHRLSTIHSADVIVGFELGCAVERGSHEALMARQGVYFTLV 657          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Sea Lamprey
Match: ABCB1 (ATP binding cassette subfamily B member 1 [Source:HGNC Symbol;Acc:HGNC:40])

HSP 1 Score: 209.534 bits (532), Expect = 2.830e-57
Identity = 110/252 (43.65%), Postives = 167/252 (66.27%), Query Frame = 1
Query: 1252 SITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLS--ASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQ 2001
            ++ F +V F YP+           V++L GLS  V  GQ +A+VG SG GKST ++LL RF+D   G +LI G+D++S++++ LR  + ++ Q+ VLF  S+  N+ YG+ S     D++  AAR A++H  I  +P +Y T VG++G +LSGG+KQR+AIARAL+++  ILL DEATS+LD+ +E+ V  AL  A    T IVIAHRLSTV  A  I V+++GQ++E+G+HQQL++   +Y+  +  Q +Q
Sbjct:  817 NVEFQSVGFNYPM--------RPNVEVLKGLSLKVENGQTLALVGSSGCGKSTSVQLLERFYDTLSGNVLIDGKDVRSLHIQWLRAQMGIVSQEPVLFDCSMAENIAYGDNSRIVPQDEIVAAARAANIHTFIDSLPEKYNTKVGDKGTQLSGGQKQRIAIARALVRQPKILLLDEATSALDTESEKIVQEALDRAREGRTCIVIAHRLSTVQTADKIAVIQNGQVIEQGTHQQLLAKKGAYHLLVNAQVSQ 1060          

HSP 2 Score: 196.052 bits (497), Expect = 9.456e-53
Identity = 100/229 (43.67%), Postives = 154/229 (67.25%), Query Frame = 1
Query: 1324 VQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFL----WHQQN 1998
             Q+L G++  V  GQ VA+VG SG GKST I+LL RF+D  +G I++ G+D++++NL SLR+ + V+ Q+ VLF  +I  N+++G+   + + +  AAR A+ +D I +MP ++ T VG+RG +LSGG+KQR+AIARAL++   +LL DEATS+LD  +E  V  AL  A    T+IVIAHRLST+ +A +I     G I+E G+H +L+     Y++ +    +HQ++
Sbjct:  193 CQVLKGVNLQVKSGQTVALVGSSGCGKSTTIQLLQRFYDPQQGTIMVDGRDVRTLNLRSLRQLIGVVSQEPVLFATTIAENIRFGHEKVTMEDIERAARNANAYDFISQMPERFNTLVGDRGAQLSGGQKQRIAIARALIRNPKLLLLDEATSALDGESEAIVQEALDKAREGRTTIVIAHRLSTIRNADIIAGFDGGVIVELGTHDELMKRNGVYHTLVSMQTFHQKD 421          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007737.1 (pep scaffold:Pmarinus_7.0:GL484343:2108:11575:-1 gene:ENSPMAG00000006997.1 transcript:ENSPMAT00000007737.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.504 bits (480), Expect = 1.165e-55
Identity = 102/221 (46.15%), Postives = 148/221 (66.97%), Query Frame = 1
Query: 1333 LNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQ 1995
            L G+SF+V  G  VA+VG SG GKSTI+ LL RF+D   G I+ GG D++ ++ +  R++++V+ Q+ VLF  +I  N+ YG   A+ ++V EAA+ A+ HD I+     YET VGERG++LSGG+KQR+AIARAL+    +LL DEATS+LD+ +E  V  A+  A  + T +VIAHRLSTV  A  ++V+  GQI+E+G+H  L++     Y  L  +Q
Sbjct:    1 LQGVSFSVEPGTVVALVGPSGGGKSTIVALLQRFYDPSAGSIIFGGTDLRELDPQWFRQTMAVVSQEPVLFATTIHKNISYGR-EATFEEVVEAAKQANAHDFILSFEEGYETLVGERGVRLSGGQKQRIAIARALIMNPVLLLLDEATSALDAESEHLVQEAIDRAMQDRTVLVIAHRLSTVRSASQVVVVDKGQIVERGTHDVLLAHQGGVYRRLVLRQ 220          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Yeast
Match: ATM1 (Mitochondrial inner membrane ATP-binding cassette (ABC) transporter; exports mitochondrially synthesized precursors of iron-sulfur (Fe/S) clusters to the cytosol; human homolog ABCB7 can complement yeast null mutant [Source:SGD;Acc:S000004916])

HSP 1 Score: 517.309 bits (1331), Expect = 7.321e-176
Identity = 272/610 (44.59%), Postives = 398/610 (65.25%), Query Frame = 1
Query:  190 SDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLDNNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNS-----LPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRT--ATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            S+ KI+K LF Y+WP     ++ RV++++GLL+ +K+ N+Q+PF FK  ID +N +       L    GL I+  YG+AR  +    ELRNAVFAKVAQ++IR V    F HL  LD+ +HLSR+TG L + +DRG++GI+ VL A+VF+++P  FE+ +V  IL +++G  ++ I    +  Y+ +T   T+WR   R + N AD +A + ALDSL+N+E VKYFNNEK+ AD+Y   L  Y ++ +K+ +SLA LN GQN+IF+  L ++M       +      I   LTVGDLVL+N L+FQLSVPLNFLG++YR++KQ+LIDM  +F L   ++     N+     LP+ + P  ITF+NV F Y              +IL   SFT+  G K AIVG SGSGKSTI++L++RF+D + GRILI G+DIK  ++++LR+ + V+PQDT LF+D+I+ N+++G + A+ ++V      A L   I ++P  ++T VGERGL +SGGEKQR+AIAR LLK + I+ +DEATS+LD+ TEQ +L  +R    + + TS+ IAHRL T+ DA  I+VL +G++ E+G H +L++ P S Y  LW  Q 
Sbjct:   87 SELKILKDLFRYIWPKGNNKVRIRVLIALGLLISAKILNVQVPFFFKQTIDSMNIAWDDPTVALPAAIGLTILC-YGVARFGSVLFGELRNAVFAKVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLYSIFTIKTTAWRTHFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNSGQNLIFTTALTAMM-------YMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKLR--KNEVKIKNAERPLMLPENV-PYDITFENVTFGY----------HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENVKFGRIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADADKIIVLDNGRVREEGKHLELLAMPGSLYRELWTIQE 675          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Yeast
Match: MDL2 (Mitochondrial inner membrane half-type ABC transporter; required for respiratory growth at high temperature; localizes to vacuole membrane in response to H2O2; similar to human TAP1 and TAP2 implicated in bare lymphocyte syndrome and Wegener-like granulomatosis [Source:SGD;Acc:S000006191])

HSP 1 Score: 174.481 bits (441), Expect = 3.268e-46
Identity = 139/427 (32.55%), Postives = 215/427 (50.35%), Query Frame = 1
Query:  754 FGVTSWRNKIR---AEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTA--SQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVR---SRTWTDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASP--DQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQ--NVLSALRTATSNVTSIVIAHRLSTVLDAHLILVL-KDGQILEKGSHQQLISDPHSYYSFLWHQQ 1995
            F  + +  +IR    ++  A  Q    A + L   +TV+ F  E  E  +Y + ++       ++ ++ A   F     F+    S++G ++F    A  S + + S L++GDL             +  L T Y EI Q     + +F L D +   S T      PD      I F +V F YP            VQI   L+F +A G  V IVG SG GKSTI  LL R+++   G I I  QDI  +N +SLRR + ++ Q+ VL   +I  N+ YG L+ +P  +++   A+    H+ I + P  Y+T +G  G  LSGG+KQR+AIARAL+KK  IL+ DEATS+LD  +E   N        + ++T + IAHRLST+  +  ++VL  DG ++E G  ++L ++P S  S L +++
Sbjct:  283 FSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDI----FQVGKTAA---FTNAKFFTT--TSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDR---GVIEFKDVSFSYP--------TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYG-LTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEK 688          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Yeast
Match: MDL1 (Mitochondrial inner membrane half-type ABC transporter; mediates export of peptides generated upon proteolysis of mitochondrial proteins; plays a role in the regulation of cellular resistance to oxidative stress [Source:SGD;Acc:S000004178])

HSP 1 Score: 167.548 bits (423), Expect = 3.716e-44
Identity = 133/407 (32.68%), Postives = 199/407 (48.89%), Query Frame = 1
Query:  826 ALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDL-------VLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMD----VRSRTWTDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYG---NLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSAL-RTATSNVTSIVIAHRLSTVLDAHLILVL-KDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            A + L    T++ +  EK E  +Y   ++      LK +   +GL FG     S GL     +++  +   + M  S  +TVG+L       V     LF LS       + Y E+ +       +F L D    +R     D   P  +    I F NV F YP             QI   L+ T+  G+ V  VG SGSGKSTI  LL R++D + G I  G +DI++ NL   RR +  + Q+ +LF+ +I  N+ Y     ++   D++  A   A+    +   P   +T VG RG +LSGG+KQR+A+ARA L    +L+ DEATS+LDS +E+ V   L R      T+I IAHRLST+  +  ++VL K G ++E GS + LI+ P+S  + L  +Q 
Sbjct:  295 AEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLK-EAVTSGLFFG-----STGLVGNTAMLSL-LLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLS-------SFYSELMKGAGAAARVFELNDRKPLIRPTIGKD---PVSLAQKPIVFKNVSFTYP--------TRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRAIGKANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQRRVERGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLIAIPNSELNALLAEQQ 676          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Yeast
Match: STE6 (Plasma membrane ATP-binding cassette (ABC) transporter; required for the export of a-factor, catalyzes ATP hydrolysis coupled to a-factor transport; contains 12 transmembrane domains and two ATP binding domains; expressed only in MATa cells; human homolog ABCB1 mediates multidrug resistance in many chemotherapy-resistant tumors by effluxing toxic compounds from the cell [Source:SGD;Acc:S000001692])

HSP 1 Score: 164.466 bits (415), Expect = 1.717e-42
Identity = 92/262 (35.11%), Postives = 150/262 (57.25%), Query Frame = 1
Query: 1249 SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYG------NLSASPDQ----VYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQY 2004
            S +TF NV F YP        +     +L  +S   + GQ   IVG SGSGKST+  LL RF+D   G I I G +I++++ + L  +++V+ Q   LF+D++  N+  G      N   S ++    + +A +MA L   I+ +P   ET +G  G+ LSGG++QRVAIARA ++ +PIL  DEA S+LD +    ++ A+R      T+I++ H LS +     + ++K+G+++E G+  +L++DP + +S  +H QN Y
Sbjct:  355 SDLTFANVSFSYP--------SRPSEAVLKNVSLNFSAGQFTFIVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLRKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILTHELSQIESDDYLYLMKEGEVVESGTQSELLADPTTTFSTWYHLQNDY 608          

HSP 2 Score: 139.813 bits (351), Expect = 1.500e-34
Identity = 81/247 (32.79%), Postives = 139/247 (56.28%), Query Frame = 1
Query: 1255 ITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPD-QVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQ 1992
            ++  N+ F YP A            +   ++F +  GQ + I+G SG+GKST++ LL + ++ + G+I I G D+   NL SLR+ +SV+ Q  +LF+ +I  NL YG      + ++Y+A +   +HD +I  P   +T +      LSGG+ QR+ IARALL+KS IL+ DE TS+LDS++   +   ++     + ++VI H    +   + I VLKDG+++E+G+   L ++    +  + +Q
Sbjct: 1052 VSIQNLTFAYPSAPT--------AFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTRIDTT--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIVKKGPPALLTMVITHSEQMMRSCNSIAVLKDGKVVERGNFDTLYNNRGELFQIVSNQ 1288          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Yeast
Match: YKR104W (Putative transporter of the MRP subfamily; contains a stop codon in S288C; adjacent ORFs YKR103W and YKR104W are merged in different strain backgrounds; MRP stands for multidrug resistance-associated protein [Source:SGD;Acc:S000001812])

HSP 1 Score: 132.494 bits (332), Expect = 1.131e-34
Identity = 85/249 (34.14%), Postives = 130/249 (52.21%), Query Frame = 1
Query: 1327 QILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNL----QYGNLSASPDQVYEAARMADLHDSIIRMPLQYE-------------------TPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQY 2004
            + L+ +SF V  G KV IVG +G+GKS+II  +YR  D + G I I  +DIK + LE LR S+S IPQD  LF  ++  NL    +Y ++     Q+Y       L +    + L +E                   T V   G  LS G++Q + +AR++L    I+L DEAT+S+D I++  +   +R    N T + IAHRL +V+D   ILV++ G++ E      LISD ++ +  L  Q  ++
Sbjct:   48 KALDNVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLDPFDRYSDV-----QIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRFIDLNTVVKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETMKNTTILTIAHRLRSVIDYDKILVMEMGRVKEYDHPYTLISDRNTIFYRLCRQSGEF 291          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Nematostella
Match: EDO33526 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRZ3])

HSP 1 Score: 685.256 bits (1767), Expect = 0.000e+0
Identity = 335/587 (57.07%), Postives = 451/587 (76.83%), Query Frame = 1
Query:  262 VVLSMGLLLGSKVANIQIPFIFKYGIDYLN--NSQVLLDNNLALMT-GLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTD-NSLPDLIDP----SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            + +++ LLLG+KV N+Q+PF+FKY +DYLN  +   L      L T   +++ GYG+AR+SAS  NELRNAVFAKVAQ SIR V +  FLHLH+LD++FHL+R+TGAL++ IDRG+RGINFV++ALVFN++PT+FEV LV+ IL +R G  ++L+ +GC+G YT +T  VT WR + R++MN AD +AG +A+DSL+NYETVKYFNNE +EAD+Y+ LL +YE+ASLK   SLA LN+GQN IFS  L+++M L       AS+  +   +TVGDLV+VNGLLFQLSVPLNFLG++YR+++QAL+DM  +FSL  +++      ++ P L+      S +TF++V F+Y            G +IL+GLSF++  G+KVAIVGGSGSGKSTI+RLL+RFFD   GR+L+ GQDI+  +LESLR+ V V+PQ+ VLFH+S++YN+ YG + A+  +V+EAARMA++HD+I+RMP  Y+TPVGERGLKLSGGEKQR+AIARA++K  PIL+YDEATSSLDSITE N+LSALR  T   TSI IAHRLSTV+DA  ILVL+ G++ E+G+H  LI+DPHS Y+ LWH+Q+
Sbjct:    1 MAMAVPLLLGAKVVNVQVPFLFKYAVDYLNTFDPATLAKTGGFLATFSTSLLLGYGVARMSASLFNELRNAVFAKVAQGSIRTVARRTFLHLHNLDLTFHLNRQTGALSRAIDRGTRGINFVMSALVFNIVPTIFEVSLVSGILAYRCGAEFALVVLGCLGVYTVFTLRVTQWRTQFRSQMNKADNEAGAQAIDSLINYETVKYFNNEVYEADRYDKLLARYEQASLKTTTSLAFLNWGQNFIFSASLSAIMLL-------ASKQIMEGTMTVGDLVMVNGLLFQLSVPLNFLGSVYRDLRQALVDMETLFSLHRLQTSIQERADAAPLLLKAGDSQSHVTFEDVSFQY----------IEGQRILDGLSFSIPAGKKVAIVGGSGSGKSTIVRLLFRFFDPQGGRVLVAGQDIRDFSLESLRKVVGVVPQECVLFHNSVYYNINYGRVQATEHEVHEAARMAEIHDAILRMPKGYDTPVGERGLKLSGGEKQRIAIARAIIKDPPILIYDEATSSLDSITEMNILSALRRVTKGRTSIFIAHRLSTVVDADEILVLEHGKVRERGTHYSLITDPHSLYAHLWHKQH 570          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Nematostella
Match: EDO42945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S028])

HSP 1 Score: 385.956 bits (990), Expect = 1.179e-124
Identity = 238/602 (39.53%), Postives = 353/602 (58.64%), Query Frame = 1
Query:  163 DGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLDNNLALMTGLAIMGGYGIARISASG-------MNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYW--RYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGS 1938
            D +G +     ++    L+ ++WP DR  ++ +VV+   LL   +  N+ +P+ +K  ++ L       DNN  +   L ++  Y   R  + G       +N +R+ ++  + Q + R +   +F HLHSL + +H++R+TG +  +++RG+  I  +L+ ++F+V+PT+  V +V +I+Y+   +   + LI    +  Y   T  +T WR   R  MN  D  A  +A+DSLLN+ETVKY++ E FE ++   L+  Y+++  ++  SLA LN  QNVI + GL +  G M         +  +  L VGD VL    + QL VPLNF GT YR I+Q+ IDM  MF L   +       + P L +    I F NV F Y               +L  +SFTV  GQ +A+VG SG GKSTIIRLLYRF+D   G I I GQDI  V  +SLR+ + V+PQDTVLF++ I +N++YG L A    V EAA+ AD+H+ I+  P  Y + VGERGLKLSGGEKQRVAIAR +LK  P++L DEATS+LD+ TE+N+ ++L     N T+IV+AHRLST+++A  ILVL +G+ILEKG+
Sbjct:  100 DRRGQSPFKDFWRKTMILWPFMWPKDR-FLQLKVVICFILLAMGRAVNVLVPYTYKLIVNRLTG-----DNNQVITDPLKLIALYVFLRFLSGGGTGGMGLLNNIRSFLWITIQQFTSRTLQVKLFEHLHSLSLRWHITRKTGEVVTMVNRGATSIYNLLSYILFSVVPTI--VDIVIAIVYFIAAFNGWFGLIVFLTMALYLIVTIVLTEWRTSFRRSMNVKDNDAKAKAVDSLLNFETVKYYSGEAFEVNRLNQLILGYQDSEWQVLGSLAVLNTVQNVIITSGLLA--GAMY-----CGYLVQNGTLGVGDFVLYVTYIVQLYVPLNFFGTYYRMIQQSFIDMENMFDLFGQKREVVDVPNAPALTVTNGLIEFRNVSFSY----------DQRQPVLKNISFTVFPGQTLALVGNSGGGKSTIIRLLYRFYDVGSGCISIDGQDISKVTSKSLRQVIGVVPQDTVLFNNDIRFNVRYGRLEADDAAVEEAAQAADIHNRILTFPEGYSSLVGERGLKLSGGEKQRVAIARTVLKNPPVVLLDEATSALDTETERNIQASLNNMCINRTTIVVAHRLSTIVNADQILVLHEGEILEKGT 676          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Nematostella
Match: EDO27684 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8K1])

HSP 1 Score: 219.55 bits (558), Expect = 1.005e-65
Identity = 126/298 (42.28%), Postives = 176/298 (59.06%), Query Frame = 1
Query:  652 VFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTD-NSLPDLIDP----SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQ 1530
            V  V L+     +R G  ++L+ +GC+G YT +T  VT WR + R++MN AD +AG +A+DSL+NYETVK  ++   + D     L  YE                          +V G MT                VGDLV+VNGLLFQLSVPLNFLG++YR+++QAL+DM  +FSL  +++      ++ P L+      S +TF++V F+Y            G +IL+GLSF++  G+KVAIVGGSGSGKSTI+RLL+RFFD   GR+L+ GQDI+  +LESLR+ V V+PQ
Sbjct:   49 VMAVVLLIGAKAYRCGAEFALVVLGCLGVYTVFTLRVTQWRTQFRSQMNKADNEAGAQAIDSLINYETVKVESSLTPDIDS----LINYE--------------------------TVKGTMT----------------VGDLVMVNGLLFQLSVPLNFLGSVYRDLRQALVDMETLFSLHRLQTSIQERADAAPLLLKAGDSQSHVTFEDVSFQY----------IEGQRILDGLSFSIPAGKKVAIVGGSGSGKSTIVRLLFRFFDPQGGRVLVAGQDIRDFSLESLRKVVGVVPQ 290          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Nematostella
Match: EDO41930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S348])

HSP 1 Score: 230.72 bits (587), Expect = 3.755e-65
Identity = 184/555 (33.15%), Postives = 287/555 (51.71%), Query Frame = 1
Query:  391 TGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNV-LPTVFEVGLVTSILYW------RYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTF--DIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNS--LPDLIDPSSITFDNVKFRYP---------IATGIRNGNSNG-VQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQ 1992
            T L ++G Y    I+A     +R  +F    Q  + R+ + +F  +   +++F  + RTG L   I+R S     +  A+  NV +   + V ++ S+++         G+  S+I I  +G+     F V   R K + E+  A T A     +S+ +  TV+ F+ EK      +L  +   E+ L   R          V+ ++G A+++ ++ +   +    +M +   LT   L  VN     +++   FL ++Y +  QA+     MF LMD   +   +    LP   +P  I FD+V+F YP         I    R  N++  +     LSF +  G+ VA+VG SG GKST+I L+ RF+D   G I IG  DI  ++L   R+ ++++ Q+ VLF  +I  N+ YG   AS +++ EAAR A+ HD I      Y+T VGERG+KLSGG+KQRVAIARALL    ILL DEATS+LD+ +E  V  A+  A  N T +VIAHRLSTV  A+L+LV+  G+I+E+G+H  L++    Y   +  Q
Sbjct:  264 TILTLLGLYVGGSIAAM----IRAWLFTLAGQRLVARIRRELFNAIIKQEVAFFDTNRTGEL---INRLSSDTQVIQNAVTVNVSMLLRYIVQIIGSLVFMFTLSAKLTGVLISVIPIVGVGAQKYGQF-VQGLRKKFQDELGNASTVAE----ESIGSIRTVRSFSQEK---KTMKLYAEAIHESYLVGARLAIASGAFSGVVMAVGQAAIVLVLWYGGKLVNEGEMNVGI-LTAFALYTVN-----VAMAFAFLSSLYGDFMQAVGASFRMFELMDRVPKIKMEGGVILPSFKEP--IVFDDVRFSYPSREDTEVLKIEEAARQANAHDFITTFEALSFKINPGETVALVGPSGGGKSTVISLIERFYDPMTGNIRIGDTDISLLDLAWYRKKIALVSQEPVLFATTIASNIAYGR-DASQEEIEEAARQANAHDFITTFEDGYKTQVGERGVKLSGGQKQRVAIARALLMDPEILLLDEATSALDAESEHFVKEAIDRAMVNRTVLVIAHRLSTVRSANLVLVMDKGKIVERGNHDSLLAKGGVYRKLVLRQ 794          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Nematostella
Match: EDO49737 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFK3])

HSP 1 Score: 227.254 bits (578), Expect = 6.027e-63
Identity = 177/558 (31.72%), Postives = 284/558 (50.90%), Query Frame = 1
Query:  388 MTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALN--------KVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILY-WRYGL------PYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLA-GLNFG--QNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWT-DNSLPDLIDPSS----ITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQ 1992
            MT LAI   Y    I A  +  L+   F   A    +R+  + F  +   D+ +  +   G LN        KV+D     +  V+         T F  G +    Y W+  L      P  +IA G +G        ++ + +K   E+  A  +AG  A + L +  TV  F  EK E ++Y   L   E  +  +++ L+ GL FG  Q ++F        G  +   +  + +     +  GDL++V    F + V    LG     I+       A + L  +  R    D+S  + + P+S    I F ++ F+YP        +   V++L GL  T+  GQ VA+VG SG GKST+I+L+ RF+D  EG + + G DI+S+NL+ LR+ + V+ Q+ +LF  ++  N++YG    +  ++ +A +MA+ HD I  +P  Y T VGERG ++SGG+KQR+AIARAL+K   +L+ DEATS+LD+ +E+ V +AL  A+   T++VIAHRLST+ +A +I  ++DG ++EKGSH +L++    Y   +  Q
Sbjct:    1 MTDLAIY--YIYLAIGALIVAYLQAGFFQYTAVRQAKRIRCNFFKAVMRQDIGWFDTYDAGELNNRLTEDISKVVDGLGSKVGLVVQ------FTTTFLAGFIMGFAYSWKLTLVILALTPLMVIAGGIMGKV------ISVFTSK---ELE-AYAKAGAIAEEVLSSIRTVAAFGGEKKECERYNSHLG--EAQAFGVKKGLSTGLGFGFFQLIMF--------GSYSLAFWYGAVLVADKAINSGDLLVV---FFSVMVGATQLGQAGPNIEAIATARGAAYELYSIIDRQPPIDSSSEEGLKPASVKGDIDFTDIHFQYP--------SRPDVKVLKGLHLTIRSGQTVALVGESGCGKSTLIKLVQRFYDPAEGTVCMDGIDIRSLNLKWLRQHIGVVSQEPILFATTVAENIRYGREGITQAEIEKATKMANAHDFIRNLPQGYNTVVGERGAQMSGGQKQRIAIARALVKNPTLLILDEATSALDTESEKIVQAALDKASEGRTTLVIAHRLSTIRNATVIAAIQDGVVVEKGSHNELMATDGLYRQLITLQ 519          

HSP 2 Score: 196.052 bits (497), Expect = 1.670e-52
Identity = 106/263 (40.30%), Postives = 168/263 (63.88%), Query Frame = 1
Query: 1180 MFSLMDVRSR--TWTDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLS--ASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLIS 1956
            +F L+D      + ++N L       ++   +V+F+YP            V++L GLS  V +GQ +A+VG SG GKST + LL RF+D ++G + I   +++ +NL+ LR  + ++ Q+ VLF  SI  N+ YG+ S   S  ++  AA+ A++H+ I  +P  Y+T VG++G  +SGG+KQR+AIARAL++  PILL DEATS+LD+ +E+ V  AL  A+   T I+IAHRLSTV +A +I V+  G++ E+G+HQ+L++
Sbjct:  845 IFKLLDRTPAIDSASENGLQPAAVRGTVQVRSVRFKYP--------TRPNVKVLRGLSLEVNQGQTLALVGPSGCGKSTTVSLLERFYDPEDGEMAIDNANVRQLNLKWLRSKIGIVSQEPVLFGYSIAQNIAYGDNSREVSMAEIETAAKAANIHNFICGLPKGYDTEVGDKGTLISGGQKQRIAIARALIRNPPILLLDEATSALDTESEKVVQDALDAASEGRTVIMIAHRLSTVKNADVICVIDHGRVAEQGTHQELMA 1099          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Medaka
Match: abcb7 (ATP binding cassette subfamily B member 7 [Source:NCBI gene;Acc:101168300])

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 350/636 (55.03%), Postives = 476/636 (74.84%), Query Frame = 1
Query:  130 RYCHHEHLS---HADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN-SQVLLDNN-----LALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSG-LTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            R C H +     +AD K    +    KI+  +  YVWP DRP ++ RV +S+GLL G+K+ N+ +PF+FKY +D LN  S  +L+ N     +A MT  A++ GYG++R  ++  NELRN VF KVAQ SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+ PTVFE+ LV++ILY++ G  ++ +A+G + +YT +T  VT WR + R EMN AD +AGN A+DSLLNYETVKYFNNEK+EA++Y+  LK YE +SLK   +LA LNFGQ+ IFS+GL ++M L        +  GI++G +TVGDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L++V ++    +  P L + P  ++I F++V F Y            G ++LNG+SF V  G+KVAIVGGSGSGKSTI+RLL+RF++  +G I I GQ+I+ V+LESLR+++ V+PQD VLFH++IFYNLQYGN++A+P++VY+ AR+A LHD+I+RMP  Y+T VGERGLKLSGGEKQRVAIARA+LK  PILLYDEATSSLDSITE+N++++++    + TS+ IAHRLST++DA  ILVL  G++ E+G+HQ L+  P S Y+ LW+ QN
Sbjct:   58 RTCWHGNAGGRLNADPKNVLKEVHSAKILSAMLSYVWPKDRPDLRARVAVSLGLLAGAKLTNVMVPFMFKYAVDELNQMSGHMLNLNDAPSTVATMT-TAVLIGYGVSRAGSALFNELRNTVFGKVAQSSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLGPTVFEMFLVSAILYYKCGGEFAAVALGTLSAYTIFTILVTQWRTRFRIEMNKADNEAGNAAIDSLLNYETVKYFNNEKYEAERYDGYLKLYESSSLKTTSTLAMLNFGQSAIFSVGLTAIMLL--------ASKGIAAGNMTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLNVDTKIKEKDLAPPLAVTPQDATIRFEDVYFEY----------MEGQKVLNGVSFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQQGNIYISGQNIRDVSLESLRKALGVVPQDAVLFHNNIFYNLQYGNINATPEEVYQVARLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKNPPILLYDEATSSLDSITEENIMTSMKEMVKDRTSVFIAHRLSTIVDADEILVLSQGKVAERGTHQALLDTPGSLYAELWNAQN 674          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Medaka
Match: abcb7 (ATP binding cassette subfamily B member 7 [Source:NCBI gene;Acc:101168300])

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 350/636 (55.03%), Postives = 476/636 (74.84%), Query Frame = 1
Query:  130 RYCHHEHLS---HADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN-SQVLLDNN-----LALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSG-LTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDL-IDP--SSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQN 1998
            R C H +     +AD K    +    KI+  +  YVWP DRP ++ RV +S+GLL G+K+ N+ +PF+FKY +D LN  S  +L+ N     +A MT  A++ GYG++R  ++  NELRN VF KVAQ SIRR+ K+VFLHLH+LD+ FHLSR+TGAL+K IDRG+RGI+FVL+ALVFN+ PTVFE+ LV++ILY++ G  ++ +A+G + +YT +T  VT WR + R EMN AD +AGN A+DSLLNYETVKYFNNEK+EA++Y+  LK YE +SLK   +LA LNFGQ+ IFS+GL ++M L        +  GI++G +TVGDLV+VNGLLFQLS+PLNFLGT+YRE +QALIDMN +F+L++V ++    +  P L + P  ++I F++V F Y            G ++LNG+SF V  G+KVAIVGGSGSGKSTI+RLL+RF++  +G I I GQ+I+ V+LESLR+++ V+PQD VLFH++IFYNLQYGN++A+P++VY+ AR+A LHD+I+RMP  Y+T VGERGLKLSGGEKQRVAIARA+LK  PILLYDEATSSLDSITE+N++++++    + TS+ IAHRLST++DA  ILVL  G++ E+G+HQ L+  P S Y+ LW+ QN
Sbjct:   86 RTCWHGNAGGRLNADPKNVLKEVHSAKILSAMLSYVWPKDRPDLRARVAVSLGLLAGAKLTNVMVPFMFKYAVDELNQMSGHMLNLNDAPSTVATMT-TAVLIGYGVSRAGSALFNELRNTVFGKVAQSSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLGPTVFEMFLVSAILYYKCGGEFAAVALGTLSAYTIFTILVTQWRTRFRIEMNKADNEAGNAAIDSLLNYETVKYFNNEKYEAERYDGYLKLYESSSLKTTSTLAMLNFGQSAIFSVGLTAIMLL--------ASKGIAAGNMTVGDLVMVNGLLFQLSLPLNFLGTVYRETRQALIDMNTLFTLLNVDTKIKEKDLAPPLAVTPQDATIRFEDVYFEY----------MEGQKVLNGVSFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQQGNIYISGQNIRDVSLESLRKALGVVPQDAVLFHNNIFYNLQYGNINATPEEVYQVARLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKNPPILLYDEATSSLDSITEENIMTSMKEMVKDRTSVFIAHRLSTIVDADEILVLSQGKVAERGTHQALLDTPGSLYAELWNAQN 702          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Medaka
Match: abcb6a (ATP binding cassette subfamily B member 6 (Langereis blood group) [Source:NCBI gene;Acc:101164038])

HSP 1 Score: 419.468 bits (1077), Expect = 4.700e-135
Identity = 249/605 (41.16%), Postives = 362/605 (59.83%), Query Frame = 1
Query:  199 KIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYLNN--SQVLLDNNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYW--RYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQ 2001
            K ++ L  Y+WP     ++  V+L +GLL   +  N+ +P  +K  ++ L +  S   +   + +   L ++ G G    S+  ++ +R  ++ +V Q + R V   +F HLHSL + +HL R+TG + + IDRG+  IN +L+ +VF++ PT+ ++  V SI+Y+   +   + LI   C+  Y T T  +T WR K R EMN  D     RA+DSLLN+ETVKY+N E +E  ++E  + KY+ +  K Q SLA LN  QNVI   GL +   L  + +             VGD VL    + QL  PLN+ GT YR I+ + IDM +MF L +       D  + D ++  ++ F   K  +    G+    +NG +IL  +SFTV  GQ VA+VG SGSGKSTIIRL++RF+D   G I I GQDI  V   SLR  V V+PQDTVLF+D+I  N++YG +SAS  +V EAA  AD+HD I+  P  Y+T VGERGLKLSGGEKQRVAIAR +LK   I+L DEATS+LD+ TE+N+ ++L    +  T+IV+AHRLST++ A  ILV+ +G+I E+G H++L+      Y+ +W +Q Q
Sbjct:  237 KKVRLLVPYMWPRGNVFLQMLVLLCLGLLGVERAINVFVPIYYKNIVNALTDGSSWRSVATIVCIYVLLKLLQGGGAG--SSGFVSNIRTFLWIRVQQFTNRVVEVQLFAHLHSLSLRWHLGRKTGDVLRSIDRGTSSINSLLSYIVFSIFPTIADI--VISIIYFITYFNAWFGLIVFCCMALYLTLTIIITEWRTKYRREMNQMDNLTKTRAVDSLLNFETVKYYNAENYEVSRFEDAILKYQVSEWKTQASLAMLNQTQNVIIGSGLLAGSLLCAYFV-------TEGKFQVGDFVLFGTYIIQLYTPLNWFGTYYRMIQTSFIDMESMFKLFE------EDQEVNDEVNAGNLLFKLGKVEFD---GVYFSYTNGKEILRDVSFTVLPGQTVALVGPSGSGKSTIIRLVFRFYDVQGGCIRIDGQDIAKVKQTSLRAHVGVVPQDTVLFNDTIRENIRYGRISASDQEVEEAAMAADIHDKIMTFPDGYDTQVGERGLKLSGGEKQRVAIARTILKAPQIILLDEATSALDTQTERNIQASLTKVCATRTTIVVAHRLSTIIGADQILVISEGRIAERGRHEELLLK-GGLYADMWLKQQQ 820          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Medaka
Match: abcb8 (ATP binding cassette subfamily B member 8 [Source:NCBI gene;Acc:101174865])

HSP 1 Score: 202.601 bits (514), Expect = 2.319e-55
Identity = 190/654 (29.05%), Postives = 311/654 (47.55%), Query Frame = 1
Query:  133 YCHHEHLSHADGKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRV---VLSMGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLDNN---LALMTG--LAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGAL-NK--------------VIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYE-EASLKIQRSLAGLNFGQNVIFSLGLASVM--GLMTFDIFTASQMGISSGLTVGDLV--LVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRT--WTDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLR-RSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQ 2001
            +CH   ++H     NN    +      L  + W      +K ++     ++ L  G+ + NIQIP +  + ++ +  ++ L DN    +  M G  L ++G YGI  +  SG   L + V  +VA D    + K++F  L   D++F  + +TG L N+              VI +G R +   +   V   + +    GL   +L      P  + A   IGS+            K+         +A   A ++L N  TVK F  E     + EL L  YE + S ++       N G  +    GL++V    ++   IF    +  ++ L+ GDL+  LV     Q S  L  +  ++ ++ + +     +F  + ++          +P       + F N+ F YP           G ++L   +  +   + +AIVG SG GKST+  LL RF+D   G I++ G DI++++L  LR + +  I Q+ VLF  SI  N+++G   A+  +V EA++ A+ +  I   P  + T VGERG  LSGG+KQR+AIARAL+K   IL+ DEATS+LD+ +E+ V  AL  AT   T ++IAHRLST+  A LI V+ +G+I+E G+H +L+S    Y   +  Q+ +
Sbjct:   94 FCH---VAHCQEDVNNNTPIEVVTKDSLPEFKWHILWEFVKPQLFALTCAVVLAFGAAILNIQIPLMLGHLVNVV--ARHLRDNTGNYIGEMRGPALKLLGMYGIQGLLTSGYIILLSRVGERVAAD----MRKTLFASLLRQDVAFFDANKTGQLVNRLTADIQEFKSSFKLVISQGLRSVTQTVGCFVSLYVISPKLTGLTVVVL------PCLVGAGALIGSFL----------RKLSRLAQEQVAKATGVADEALGNVRTVKAFAME-----ERELQLYAYEVDKSCEMNE-----NLGNGIAIFQGLSNVALNCIVLGTIFAGGTLISNNELSPGDLMSFLVASQTVQRS--LASISILFGQMVRGISSGARVFEYLSLQPSIPLCGGGRIPHHSLMGRVDFMNISFSYP--------TRPGHEVLKKFNLMLPPSKTIAIVGESGGGKSTVAALLERFYDPSSGVIMLDGLDIRTLDLSWLRGQVIGFINQEPVLFGSSIMENIRFGKPEATDAEVIEASKQANAYGFITSFPEGFNTLVGERGATLSGGQKQRIAIARALIKNPSILVLDEATSALDAESERVVQEALDRATRGRTVLIIAHRLSTIQRADLICVMSNGRIVEAGTHLELLSKGGIYSDLIRRQRAE 702          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Medaka
Match: abcb4 (ATP binding cassette subfamily B member 1 [Source:NCBI gene;Acc:101171435])

HSP 1 Score: 201.06 bits (510), Expect = 2.336e-55
Identity = 138/406 (33.99%), Postives = 223/406 (54.93%), Query Frame = 1
Query:  796 NTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLK--IQRSLA-GLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQY 2004
             +A  +AG  A + L +  TV  F+ +  E ++Y   L++ ++  +K  I  ++A G  F   + FS  LA   G     +  + +  I S LTV  +V++       + P        R     + ++     ++D  S    D   PD I    I F N+ F YP        +   V+IL  +S +V  GQ +A+VG SG GKST I+LL RF+D  EG + I G DI+S+N+  LR  + V+ Q+ +LF  +I  N++YG    +  ++ +AA+ A+ +D I+ +P ++ET VG+RG ++SGG+KQR+AIARAL++   ILL DEATS+LD+ +E  V SAL       T++++AHRLST+ +A +I   ++G+++E G+H +L+ +    Y  L   Q  Y
Sbjct:  224 QSAYAKAGAVAEEVLSSIRTVFAFSGQNKEIERYHKNLQQAKKMGMKKAISANIAMGFTF-LMIYFSYALAFWYGS---TLILSGEYTIGSVLTVFFVVIIGVFTMGQTSPNIQTFASARGAAHKVYNIIDKEPIIDSYSE---DGFKPDFIK-GDIEFSNIHFTYP--------SRPDVKILENMSLSVKSGQTMALVGSSGCGKSTTIQLLQRFYDPVEGNVSIDGHDIRSLNVRYLREMIGVVSQEPILFATTISENIRYGRPDVTQPEIEQAAKEANAYDFIMNLPNKFETLVGDRGTQMSGGQKQRIAIARALVRNPKILLLDEATSALDAESETIVQSALDKVRLGRTTLIVAHRLSTIRNADVIAGFQNGKVVEVGTHSELM-EKQGVYRMLVTMQVTY 612          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Planmine SMEST
Match: SMESG000029984.1 (SMESG000029984.1)

HSP 1 Score: 1128.24 bits (2917), Expect = 0.000e+0
Identity = 558/577 (96.71%), Postives = 562/577 (97.40%), Query Frame = 1
Query:  274 MGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLDNNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQY 2004
            MGLLLGSKVANIQIPFIFKYGIDYLNNSQVLL+NNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYT YTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTA              +LVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKK+PILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTV+DAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQY
Sbjct:    1 MGLLLGSKVANIQIPFIFKYGIDYLNNSQVLLENNLALMTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTAYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTA--------------MLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKAPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVIDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQY 563          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Planmine SMEST
Match: SMESG000029984.1 (SMESG000029984.1)

HSP 1 Score: 1092.41 bits (2824), Expect = 0.000e+0
Identity = 536/539 (99.44%), Postives = 538/539 (99.81%), Query Frame = 1
Query:  388 MTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQY 2004
            MTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYT YTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKK+PILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTV+DAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQY
Sbjct:    1 MTGLAIMGGYGIARISASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTAYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKAPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVIDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQY 539          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Planmine SMEST
Match: SMESG000070797.1 (SMESG000070797.1)

HSP 1 Score: 417.927 bits (1073), Expect = 1.349e-134
Identity = 256/661 (38.73%), Postives = 373/661 (56.43%), Query Frame = 1
Query:  148 HLSHADGKGN-NTKTSDYKII----KKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQIPFIFKYGIDYL------NNSQ-------VLLD--------------NNLALMTGLAIMGGYGIARI-------SASGMNELRNAVFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINFVLAALVFNVLPTVFEVGLVTSILYWRYGLP--YSLIAIGCIGSYTTYTFGVTSWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTWTDNSLPD----LIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQ 1995
             LSH D + N +T  S +  I    K +F   WP +   ++ ++VL +  L+  +V N+ +P  +KY +D L      N+SQ       +LL+              NNL     L ++  +G  R+       S+  +N +R  ++  V Q S R++   VF H+H L + +H+S++TG + +++DRG+  +  +L   +FN+ PT+  V ++  I+Y+       ++LI +  +  Y   T  +T WR K R  MN  D      A+DSLLN+ETVKY+  E  E   Y   +  Y++A    Q +L  LNF Q  I ++G   + G M      AS +      TVGD VL    + QL+ PLNF GT YR I+Q  IDM  MF L++++        +PD     I    I F NV F Y               IL  +SFT+  G+  A+VG SG GKSTI+RLL+RF+D D G ILI GQ+IK V   SLR+ + V+PQDTVLF+ +I  N++YG + AS  ++ EAA+ AD+HD I+  P +Y T VGERGLKLSGGEKQRVAIAR LLK   I+L DEATS+LD+ TE+N+ ++L   + N T +V+AHRLST++DA  ILV+++G+I E+G HQ LI+  +  Y+ LW+QQ
Sbjct:  200 QLSHQDIEENISTARSTWGNIVFKAKLIFEATWPKNSYILQLKIVLCVLTLILGRVLNLFLPITYKYVVDSLTPSLNKNSSQYSKYKSNLLLEFVLNPKNIFAPDIFNNLTFRWDLILV--FGTLRVLQGAGTGSSGVLNSIRTQLWITVQQFSSRKIAVRVFSHIHGLSLRWHMSKKTGEVLRIMDRGTDSLQNLLNYFLFNIAPTI--VDIIVGIIYFASAFNGYFALIVLVTMVLYLGSTIIITEWRTKYRRNMNKLDNDKNAMAVDSLLNFETVKYYGAEMHEVKNYREAVLLYQKADWISQTTLNVLNFVQGFIINIGF--IAGAM----LCASYIVKGEYFTVGDFVLYCTYIVQLNAPLNFFGTYYRMIQQNFIDMENMFELLNIKQEI---VDIPDAQCIFIRAGEIEFKNVYFSYKDKL-----------ILKNVSFTIPPGKTFALVGNSGGGKSTIVRLLFRFYDVDSGEILIDGQNIKEVTQASLRQKIGVVPQDTVLFNQNIRENIRYGRIDASDSEIEEAAKAADIHDRILSFPDKYNTMVGERGLKLSGGEKQRVAIARTLLKAPKIVLLDEATSALDTQTERNIQASLNIISINRTCLVVAHRLSTIVDADRILVIQEGEIKEQGPHQDLINIENGIYAALWNQQ 836          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Planmine SMEST
Match: SMESG000070801.1 (SMESG000070801.1)

HSP 1 Score: 241.891 bits (616), Expect = 4.740e-75
Identity = 116/205 (56.59%), Postives = 155/205 (75.61%), Query Frame = 1
Query: 1381 VGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQ 1995
            VG SG GKSTI+RLL+RF+D D G ILI GQ+IK V   SLR+ + V+PQDTVLF+ +I  N++YG + AS  ++ EAA+ AD+HD I+  P +Y T VGERGLKLSGGEKQRVAIAR LLK   I+L DEATS+LD+ TE+N+ ++L   + N T +V+AHRLST++DA  ILV+++G+I E+G HQ LI+  +  Y+ LW+QQ
Sbjct:   10 VGNSGGGKSTIVRLLFRFYDVDSGEILIDGQNIKEVTQASLRQKIGVVPQDTVLFNQNIRENIRYGRIDASDSEIEEAAKAADIHDRILSFPDKYNTMVGERGLKLSGGEKQRVAIARTLLKAPKIVLLDEATSALDTQTERNIQASLNIISINRTCLVVAHRLSTIVDADRILVIQEGEIKEQGPHQDLINIENGIYAALWNQQ 214          
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Planmine SMEST
Match: SMESG000004996.1 (SMESG000004996.1)

HSP 1 Score: 213.386 bits (542), Expect = 7.438e-58
Identity = 144/404 (35.64%), Postives = 219/404 (54.21%), Query Frame = 1
Query:  811 QAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMD----VRSRTWTDNSLPDLIDPS-SITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSA--SPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPHSYYSFLWHQQNQ 2001
            ++G  A++ + N  TV     E          ++ Y+EA  K+   ++     Q  ++ L  A++          A  + + +   + ++ +  G L   ++ L     M     +  I    MF L+D    + S + TD  + D+ + S  I  +NVKF YP+   I         ILN +SF +   Q +A+VG SG GKSTII LL RF+D   G ILI    IK +N+++LR+  S++ Q+  LF  SI  N+ YG+ +   + DQ+  AA+ +++HD I+ +P QYET VGE+G   SGG+KQR+AIARALL+   ILL DEATS+LD+ +E+ V  AL  A    T +VIAHRLST+ +A  ILV KDG+I E G+H +L+S    Y   +  Q ++
Sbjct:  931 ESGKIAVECIENIRTVSNLTRE-------HTFIQHYKEAIKKLDGEVSKKAHAQGFLYGLTQAAIFCAYAATFMLAGYLLLYNMSKMTNVFISFGALIFGAMNLGKSMAMAPNFGKGKIAAAHMFELLDRVPPINSFS-TDGVVLDVENMSGDIKIENVKFSYPLRPNII--------ILNDVSFNINSNQTIALVGPSGCGKSTIIGLLQRFYDTLNGNILIDNNKIKDINIQNLRQLFSIVSQEPTLFSYSIRENIAYGDSAKIFTDDQIIAAAKASNIHDFIVNLPDQYETKVGEKGSNFSGGQKQRIAIARALLRNPRILLLDEATSALDTESEKIVQDALDKAQEGRTCVVIAHRLSTIQNADKILVFKDGKIAESGTHFELLSKNGIYSQMISLQSHK 1318          

HSP 2 Score: 212.616 bits (540), Expect = 1.615e-57
Identity = 145/406 (35.71%), Postives = 228/406 (56.16%), Query Frame = 1
Query:  778 KIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKKYEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLM--TFDI---FTASQMGISSGLTVGDLVLVNGLLFQLSVPLNFLGTM------YREIKQALIDMNAMFSLMDVRSRTWTDNSLPDLID--PSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKGQKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSVSVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQYETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVLSALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLIS 1956
            K+  + + A  +AG  A + L +  T+  F  EK+E  +Y   L   E   + I++S+            LGL  VMGLM  ++ +   + AS +   +G  VGD+++V    F   +    +G        + E + A  ++   F ++D        N   D ++     ITF  VKF YP  T           IL GLS ++  GQ VA+VG SG GKS++I+L+ RF+D++EG +LI   +IK +N+  LR  + V+ Q+ VLF  SI  N++YG +  + +++ +A  MA+    I  +P + +T VG+RG +LSGG+KQR+AIARAL++   ILL DEATS+LDS +E+ V  AL       T+I++AHRLSTV +AH+I  +KDG++ E+G+H +L++
Sbjct:  292 KLTQKASEAYGKAGGIAEEVLGSIRTIVSFRGEKYEVARYTENLD--EACKIGIRKSILTGTL-------LGL--VMGLMFGSYALGFWYGASLIREGNGFLVGDMLIV---FFSCLMATTGIGQATPHMGSFNEARSAAAEI---FEIIDRVPEIDKMNEEGDKLNDFQGKITFKYVKFTYPTRTD--------CPILTGLSLSIQPGQTVALVGASGCGKSSLIQLMQRFYDSNEGEVLIDDTNIKDLNVMWLREQIGVVSQEPVLFGCSIKENIRYGRMDVTDEEIDQALVMANAKTFINALPNKLDTLVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDSESEKIVQDALDKVVEGRTTIIVAHRLSTVRNAHVIFGIKDGKVQEQGTHAELMA 672          
The following BLAST results are available for this feature:
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCB70.000e+055.82ATP binding cassette subfamily B member 7 [Source:... [more]
ABCB70.000e+055.82ATP binding cassette subfamily B member 7 [Source:... [more]
ABCB70.000e+055.82ATP binding cassette subfamily B member 7 [Source:... [more]
ABCB70.000e+055.82ATP binding cassette subfamily B member 7 [Source:... [more]
ABCB70.000e+057.39ATP binding cassette subfamily B member 7 [Source:... [more]
back to top
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abtm-10.000e+051.34ABC Transporter, Mitochondrial [Source:UniProtKB/... [more]
hmt-19.683e-13838.77Heavy Metal Tolerance factor; Heavy metal toleranc... [more]
pgp-27.524e-6345.63ABC transporter PGP-2; p-GlycoProtein related [So... [more]
pgp-27.550e-6345.63ABC transporter PGP-2; p-GlycoProtein related [So... [more]
pgp-27.752e-6345.63ABC transporter PGP-2; p-GlycoProtein related [So... [more]
back to top
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCB70.000e+056.05gene:FBgn0035244 transcript:FBtr0072755[more]
ABCB70.000e+056.05gene:FBgn0035244 transcript:FBtr0072754[more]
Hmt-17.524e-14240.03gene:FBgn0038376 transcript:FBtr0083188[more]
Mdr494.470e-6030.04gene:FBgn0004512 transcript:FBtr0087801[more]
Mdr492.813e-5931.82gene:FBgn0004512 transcript:FBtr0302198[more]
back to top
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcb70.000e+054.09ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb6b1.102e-13740.68ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb6a3.320e-13741.68ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb6a1.488e-13242.05ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
tap11.553e-6032.84transporter 1, ATP-binding cassette, sub-family B ... [more]
back to top
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCB70.000e+054.95ATP binding cassette subfamily B member 7 [Source:... [more]
ABCB70.000e+054.95ATP binding cassette subfamily B member 7 [Source:... [more]
ABCB70.000e+055.86ATP binding cassette subfamily B member 7 [Source:... [more]
ABCB70.000e+056.41ATP binding cassette subfamily B member 7 [Source:... [more]
ABCB70.000e+056.41ATP binding cassette subfamily B member 7 [Source:... [more]
back to top
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abcb70.000e+056.22ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
Abcb61.903e-13038.84ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
Abcb81.736e-6330.14ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
Abcb81.736e-6330.14ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
Abcb54.945e-6032.11ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
back to top
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q61102|ABCB7_MOUSE0.000e+056.22ATP-binding cassette sub-family B member 7, mitoch... [more]
sp|Q704E8|ABCB7_RAT0.000e+055.97ATP-binding cassette sub-family B member 7, mitoch... [more]
sp|O75027|ABCB7_HUMAN0.000e+055.82ATP-binding cassette sub-family B member 7, mitoch... [more]
sp|Q9LVM1|AB25B_ARATH0.000e+051.37ABC transporter B family member 25, mitochondrial ... [more]
sp|Q9FUT3|AB23B_ARATH0.000e+050.32ABC transporter B family member 23, mitochondrial ... [more]
back to top
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7VA420.000e+059.51Uncharacterized protein OS=Capitella teleta OX=283... [more]
T1JCD10.000e+058.00Uncharacterized protein OS=Strigamia maritima OX=1... [more]
T1L1Y90.000e+057.58Uncharacterized protein OS=Tetranychus urticae OX=... [more]
A0A504Y7F40.000e+057.67ATP-binding cassette sub-family B member 7 mitocho... [more]
A0A4E0RMH90.000e+057.67ATP-binding cassette sub-family B member 7 mitocho... [more]
back to top
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcb70.000e+054.65ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb6a8.101e-12940.59ATP binding cassette subfamily B member 6 (Langere... [more]
abcb6b2.815e-11940.10ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb54.374e-5835.85ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
abcb48.428e-5733.58multidrug resistance protein 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcb6b5.516e-12044.69ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
ENSPMAT00000001786.13.618e-6637.07pep scaffold:Pmarinus_7.0:GL477870:201625:214977:-... [more]
abcb11b4.231e-6037.34ATP-binding cassette, sub-family B (MDR/TAP), memb... [more]
ABCB12.830e-5743.65ATP binding cassette subfamily B member 1 [Source:... [more]
ENSPMAT00000007737.11.165e-5546.15pep scaffold:Pmarinus_7.0:GL484343:2108:11575:-1 g... [more]
back to top
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ATM17.321e-17644.59Mitochondrial inner membrane ATP-binding cassette ... [more]
MDL23.268e-4632.55Mitochondrial inner membrane half-type ABC transpo... [more]
MDL13.716e-4432.68Mitochondrial inner membrane half-type ABC transpo... [more]
STE61.717e-4235.11Plasma membrane ATP-binding cassette (ABC) transpo... [more]
YKR104W1.131e-3434.14Putative transporter of the MRP subfamily; contain... [more]
back to top
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO335260.000e+057.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429451.179e-12439.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO276841.005e-6542.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419303.755e-6533.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497376.027e-6331.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcb70.000e+055.03ATP binding cassette subfamily B member 7 [Source:... [more]
abcb70.000e+055.03ATP binding cassette subfamily B member 7 [Source:... [more]
abcb6a4.700e-13541.16ATP binding cassette subfamily B member 6 (Langere... [more]
abcb82.319e-5529.05ATP binding cassette subfamily B member 8 [Source:... [more]
abcb42.336e-5533.99ATP binding cassette subfamily B member 1 [Source:... [more]
back to top
BLAST of Iron-sulfur clusters transporter ATM1, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029984.10.000e+096.71SMESG000029984.1[more]
SMESG000029984.10.000e+099.44SMESG000029984.1[more]
SMESG000070797.11.349e-13438.73SMESG000070797.1[more]
SMESG000070801.14.740e-7556.59SMESG000070801.1[more]
SMESG000004996.17.438e-5835.64SMESG000004996.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026771 ID=SMED30026771|Name=Iron-sulfur clusters transporter ATM1, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=2133bp
AAACGTTTCATATAAATGGCTCTATATTTAATTCTTCAAAATTCAAAATT
AAGATGCATGGGAAATTTTTATCAACTAAACGAATTATACAAGCTAGATT
ATTTGAATAATCTTTTAAAGAGTCAAGTTCGATATTGCCATCATGAACAT
TTATCTCATGCCGATGGTAAAGGAAATAACACCAAAACAAGTGATTATAA
AATCATTAAGAAATTATTTGGGTATGTTTGGCCTGCTGACAGACCTCATA
TCAAACGTCGTGTTGTCCTTTCAATGGGGCTGCTATTAGGTAGCAAAGTT
GCCAATATACAAATTCCATTCATTTTCAAATATGGCATAGATTACCTGAA
TAACTCTCAGGTTCTTCTCGACAATAATTTAGCGTTAATGACTGGATTAG
CAATAATGGGAGGATATGGAATTGCGAGAATCTCTGCGTCTGGAATGAAC
GAATTACGCAATGCCGTGTTTGCCAAGGTTGCCCAGGATTCGATCCGCCG
GGTGGGGAAAAGCGTGTTTCTCCACCTACATTCCCTCGATATGTCATTCC
ATCTGTCGAGGCGCACTGGCGCTCTAAATAAAGTCATTGACAGAGGCAGT
CGAGGGATTAATTTCGTGTTAGCAGCACTTGTATTCAATGTTCTGCCTAC
CGTATTTGAGGTGGGCCTGGTGACGAGCATATTGTATTGGCGGTATGGAC
TGCCATACAGTCTCATTGCTATAGGCTGCATCGGCAGTTACACTACTTAC
ACGTTTGGTGTGACCTCGTGGCGCAATAAGATTCGTGCGGAAATGAATAC
AGCTGATACCCAGGCCGGAAACAGAGCTCTGGATTCACTGCTGAACTACG
AAACTGTTAAGTATTTCAACAACGAGAAATTTGAAGCGGATCAATACGAG
CTCCTTTTGAAGAAATATGAAGAGGCCAGCCTAAAAATCCAGCGAAGCTT
AGCGGGACTAAATTTTGGTCAAAATGTGATATTTTCTCTCGGCCTTGCGT
CAGTGATGGGCCTGATGACATTTGACATATTTACAGCCAGTCAGATGGGC
ATTTCCAGTGGTTTAACTGTAGGTGATTTAGTGCTGGTAAATGGGCTCCT
GTTCCAGCTGTCTGTTCCGCTGAACTTCCTCGGTACCATGTATCGAGAAA
TCAAGCAAGCGCTTATTGATATGAACGCAATGTTCTCCCTGATGGACGTG
CGATCCCGAACATGGACAGACAATTCTCTACCAGATCTGATCGATCCCTC
ATCGATCACATTCGATAATGTCAAGTTCCGATATCCCATAGCAACCGGCA
TTCGTAACGGCAATAGCAACGGTGTCCAGATACTGAACGGATTGTCATTT
ACTGTGGCAAAGGGACAGAAGGTTGCCATTGTCGGGGGCAGCGGTAGTGG
TAAATCCACCATTATCCGTCTATTGTATCGATTCTTCGATGCTGATGAGG
GACGGATTCTGATTGGCGGACAAGACATCAAATCGGTGAATCTGGAAAGT
CTTCGACGTTCCGTGTCGGTCATCCCCCAGGATACAGTGCTCTTTCACGA
TTCGATTTTCTACAATCTGCAATACGGCAATCTCTCTGCCAGTCCCGATC
AAGTCTACGAGGCAGCTCGCATGGCAGATCTCCATGACAGCATCATACGG
ATGCCCCTCCAATATGAGACTCCCGTCGGTGAAAGGGGCCTCAAGCTCAG
TGGAGGAGAGAAGCAACGCGTGGCAATTGCTCGAGCACTCCTCAAGAAGT
CGCCAATCCTGCTGTATGACGAGGCGACCTCCTCATTGGACTCCATCACA
GAGCAAAACGTCCTATCAGCTTTGCGGACCGCCACCAGCAATGTCACCTC
AATTGTGATTGCACACAGACTCAGCACGGTGCTTGATGCCCATCTCATCC
TTGTGCTCAAGGACGGCCAAATACTCGAGAAGGGATCTCATCAACAGCTG
ATCAGTGATCCGCATTCATATTATTCCTTCCTTTGGCATCAGCAGAATCA
ATACTGATCACTTGCCTGCCGACCGACGGCAGCTCGCTCGGTAGCCGCCA
CCGCCGCTACCGCCGCCTCCGCCGTATTATCATGCAACCTAGATTCAAGA
GAGAAATTAAATACAATTTGACTTAAAAAAAGA
back to top

protein sequence of SMED30026771-orf-1

>SMED30026771-orf-1 ID=SMED30026771-orf-1|Name=SMED30026771-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=664bp
MALYLILQNSKLRCMGNFYQLNELYKLDYLNNLLKSQVRYCHHEHLSHAD
GKGNNTKTSDYKIIKKLFGYVWPADRPHIKRRVVLSMGLLLGSKVANIQI
PFIFKYGIDYLNNSQVLLDNNLALMTGLAIMGGYGIARISASGMNELRNA
VFAKVAQDSIRRVGKSVFLHLHSLDMSFHLSRRTGALNKVIDRGSRGINF
VLAALVFNVLPTVFEVGLVTSILYWRYGLPYSLIAIGCIGSYTTYTFGVT
SWRNKIRAEMNTADTQAGNRALDSLLNYETVKYFNNEKFEADQYELLLKK
YEEASLKIQRSLAGLNFGQNVIFSLGLASVMGLMTFDIFTASQMGISSGL
TVGDLVLVNGLLFQLSVPLNFLGTMYREIKQALIDMNAMFSLMDVRSRTW
TDNSLPDLIDPSSITFDNVKFRYPIATGIRNGNSNGVQILNGLSFTVAKG
QKVAIVGGSGSGKSTIIRLLYRFFDADEGRILIGGQDIKSVNLESLRRSV
SVIPQDTVLFHDSIFYNLQYGNLSASPDQVYEAARMADLHDSIIRMPLQY
ETPVGERGLKLSGGEKQRVAIARALLKKSPILLYDEATSSLDSITEQNVL
SALRTATSNVTSIVIAHRLSTVLDAHLILVLKDGQILEKGSHQQLISDPH
SYYSFLWHQQNQY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036640ABC1_TM_sf
IPR039421Type_I_exporter
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR003439ABC_transporter-like
IPR011527ABC1_TM_dom
IPR017871ABC_transporter_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0016887ATPase activity
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
GO:0006811ion transport
GO:0006879cellular iron ion homeostasis
GO:0055072iron ion homeostasis
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 449..642
e-value: 2.4E-16
score: 70.3
IPR036640ABC transporter type 1, transmembrane domain superfamilyGENE3DG3DSA:1.20.1560.10coord: 70..399
e-value: 1.1E-117
score: 394.8
IPR036640ABC transporter type 1, transmembrane domain superfamilySUPERFAMILYSSF90123ABC transporter transmembrane regioncoord: 65..394
IPR011527ABC transporter type 1, transmembrane domainPFAMPF00664ABC_membranecoord: 84..368
e-value: 2.8E-23
score: 83.0
IPR011527ABC transporter type 1, transmembrane domainPROSITEPS50929ABC_TM1Fcoord: 84..381
score: 34.267
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 410..663
e-value: 9.3E-83
score: 279.6
NoneNo IPR availablePANTHERPTHR24221:SF187ATP-BINDING CASSETTE SUB-FAMILY B MEMBER 7, MITOCHONDRIALcoord: 47..661
NoneNo IPR availableCDDcd18582ABC_6TM_ATM1_ABCB7coord: 86..389
e-value: 1.21799E-148
score: 430.767
NoneNo IPR availableTMHMMTMhelixcoord: 84..103
NoneNo IPR availableTMHMMTMhelixcoord: 351..373
NoneNo IPR availableTMHMMTMhelixcoord: 314..336
NoneNo IPR availableTMHMMTMhelixcoord: 123..142
NoneNo IPR availableTMHMMTMhelixcoord: 229..251
NoneNo IPR availableTMHMMTMhelixcoord: 197..219
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 440..589
e-value: 1.6E-34
score: 119.3
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 414..658
score: 22.856
IPR039421Type I protein exporterPANTHERPTHR24221FAMILY NOT NAMEDcoord: 47..661
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 561..575
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 409..659