cAMP dependent protein kinase catalytic subunit

Overview
NamecAMP dependent protein kinase catalytic subunit
Smed IDSMED30026769
Length (bp)1393
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cAMP dependent protein kinase catalytic subunit (SMED30026769) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cAMP dependent protein kinase catalytic subunit (SMED30026769) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026769

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30026769SMESG000077092.1 SmedASXL_011530SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30026769SMESG000077092.1 dd_Smed_v4_15088_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Human
Match: PRKACA (protein kinase cAMP-activated catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9380])

HSP 1 Score: 397.127 bits (1019), Expect = 3.151e-136
Identity = 191/323 (59.13%), Postives = 251/323 (77.71%), Query Frame = 3
Query:  126 TDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            +D    L K  E+FL KW++P + TA ++ FERIKTLG G+FGRV+LVKHK  GN+YA+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L +SFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV DIK HK+F   DW+ +Y +K +AP+ PK KGP DTS FD +EEE
Sbjct:    6 SDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEE 326          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Human
Match: PRKACA (protein kinase cAMP-activated catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9380])

HSP 1 Score: 397.127 bits (1019), Expect = 3.151e-136
Identity = 191/323 (59.13%), Postives = 251/323 (77.71%), Query Frame = 3
Query:  126 TDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            +D    L K  E+FL KW++P + TA ++ FERIKTLG G+FGRV+LVKHK  GN+YA+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L +SFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV DIK HK+F   DW+ +Y +K +AP+ PK KGP DTS FD +EEE
Sbjct:    6 SDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEE 326          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Human
Match: PRKACB (protein kinase cAMP-activated catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9381])

HSP 1 Score: 396.741 bits (1018), Expect = 5.735e-136
Identity = 191/326 (58.59%), Postives = 252/326 (77.30%), Query Frame = 3
Query:  117 VSMTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            +S+ +F   L K  E+FL KW+NP +  A +EDFER KTLG G+FGRV+LVKHKA   YYA+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L Y+FKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV+DIK HK+F   DW+ +Y +K +AP+ PK +G  DTS FD +EEE
Sbjct:   18 ISVKEF---LAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEE 338          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Human
Match: PRKACB (protein kinase cAMP-activated catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9381])

HSP 1 Score: 396.356 bits (1017), Expect = 8.901e-136
Identity = 189/317 (59.62%), Postives = 247/317 (77.92%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+NP +  A +EDFER KTLG G+FGRV+LVKHKA   YYA+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L Y+FKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV+DIK HK+F   DW+ +Y +K +AP+ PK +G  DTS FD +EEE
Sbjct:   20 LAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Human
Match: PRKACB (protein kinase cAMP-activated catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9381])

HSP 1 Score: 397.897 bits (1021), Expect = 9.831e-136
Identity = 192/325 (59.08%), Postives = 251/325 (77.23%), Query Frame = 3
Query:  120 SMTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            SM +F   L K  E+FL KW+NP +  A +EDFER KTLG G+FGRV+LVKHKA   YYA+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L Y+FKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV+DIK HK+F   DW+ +Y +K +AP+ PK +G  DTS FD +EEE
Sbjct:   62 SMKEF---LAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEE 381          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Celegans
Match: kin-1 (cAMP-dependent protein kinase catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:P21137])

HSP 1 Score: 400.593 bits (1028), Expect = 2.495e-137
Identity = 194/324 (59.88%), Postives = 256/324 (79.01%), Query Frame = 3
Query:  123 MTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            + DF   L K  E+F  +W+NP + TA ++DF+RIKTLG G+FGRV+LVKHK +GNYYA+K+L K +++K KQ+E+ LNEK+IL  I+FPFL+ + +SFKDNS LYMVLEF+ GGEMF+ LR + RF +   +FY AQ+++AFEYLH L + YRDLKPEN+L++S GYLK+ D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKVKF S FS +LKDL++NL+QVDL++R+GNLKNGVADIK HK+F   DW+ +Y KK +AP+ PKC+GP D S FD +EEE
Sbjct:   50 VEDFKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGPGDASNFDDYEEE 371          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Celegans
Match: kin-1 (cAMP-dependent protein kinase catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:P21137])

HSP 1 Score: 399.053 bits (1024), Expect = 3.070e-137
Identity = 200/349 (57.31%), Postives = 266/349 (76.22%), Query Frame = 3
Query:   48 LKFKNPLLNSVPSIRQIRNVFM*VSMTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            LKF  P  +   S +  +N     S+ +F   L K  E+F  +W+NP + TA ++DF+RIKTLG G+FGRV+LVKHK +GNYYA+K+L K +++K KQ+E+ LNEK+IL  I+FPFL+ + +SFKDNS LYMVLEF+ GGEMF+ LR + RF +   +FY AQ+++AFEYLH L + YRDLKPEN+L++S GYLK+ D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKVKF S FS +LKDL++NL+QVDL++R+GNLKNGVADIK HK+F   DW+ +Y KK +AP+ PKC+GP D S FD +EEE
Sbjct:    2 LKFLKPKSSDEGSSKDNKNS---ASLKEF---LDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGPGDASNFDDYEEE 342          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Celegans
Match: kin-1 (cAMP-dependent protein kinase catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:P21137])

HSP 1 Score: 398.667 bits (1023), Expect = 3.400e-137
Identity = 194/326 (59.51%), Postives = 256/326 (78.53%), Query Frame = 3
Query:  117 VSMTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            V +  F   L K  E+F  +W+NP + TA ++DF+RIKTLG G+FGRV+LVKHK +GNYYA+K+L K +++K KQ+E+ LNEK+IL  I+FPFL+ + +SFKDNS LYMVLEF+ GGEMF+ LR + RF +   +FY AQ+++AFEYLH L + YRDLKPEN+L++S GYLK+ D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKVKF S FS +LKDL++NL+QVDL++R+GNLKNGVADIK HK+F   DW+ +Y KK +AP+ PKC+GP D S FD +EEE
Sbjct:    9 VQVKFFKEFLDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGPGDASNFDDYEEE 332          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Celegans
Match: kin-1 (cAMP-dependent protein kinase catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:P21137])

HSP 1 Score: 397.127 bits (1019), Expect = 2.527e-136
Identity = 192/317 (60.57%), Postives = 253/317 (79.81%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+F  +W+NP + TA ++DF+RIKTLG G+FGRV+LVKHK +GNYYA+K+L K +++K KQ+E+ LNEK+IL  I+FPFL+ + +SFKDNS LYMVLEF+ GGEMF+ LR + RF +   +FY AQ+++AFEYLH L + YRDLKPEN+L++S GYLK+ D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKVKF S FS +LKDL++NL+QVDL++R+GNLKNGVADIK HK+F   DW+ +Y KK +AP+ PKC+GP D S FD +EEE
Sbjct:   39 LDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGPGDASNFDDYEEE 353          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Celegans
Match: kin-1 (cAMP-dependent protein kinase catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:P21137])

HSP 1 Score: 395.971 bits (1016), Expect = 3.103e-136
Identity = 192/317 (60.57%), Postives = 253/317 (79.81%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+F  +W+NP + TA ++DF+RIKTLG G+FGRV+LVKHK +GNYYA+K+L K +++K KQ+E+ LNEK+IL  I+FPFL+ + +SFKDNS LYMVLEF+ GGEMF+ LR + RF +   +FY AQ+++AFEYLH L + YRDLKPEN+L++S GYLK+ D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKVKF S FS +LKDL++NL+QVDL++R+GNLKNGVADIK HK+F   DW+ +Y KK +AP+ PKC+GP D S FD +EEE
Sbjct:   12 LDKAREDFKQRWENPAQNTACLDDFDRIKTLGTGSFGRVMLVKHKQSGNYYAMKILDKQKVVKLKQVEHTLNEKRILQAIDFPFLVNMTFSFKDNSNLYMVLEFISGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDSTGYLKITDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVKFPSHFSNELKDLLKNLLQVDLTKRYGNLKNGVADIKNHKWFGSTDWIAIYQKKIEAPFLPKCRGPGDASNFDDYEEE 326          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Fly
Match: Pka-C1 (gene:FBgn0000273 transcript:FBtr0335495)

HSP 1 Score: 385.956 bits (990), Expect = 5.620e-132
Identity = 189/318 (59.43%), Postives = 246/318 (77.36%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEET 1097
            L +  EEF  KW   P  TA ++DFERIKTLG G+FGRV++V+HK   +YYA+K+L K +++K KQ+E+ LNEK+IL  I+FPFL+ L Y FKDNS LYMVLE+V GGEMF+ LR + RF +   +FY AQ+++AFEYLHYL + YRDLKPEN+L++S GYLKV D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S F +DLKDL+RNL+QVDL++R+GNLK GV DIK  K+F   DW+ ++ KK +AP+ P+CKGP DTS FD +EEE 
Sbjct:   22 LEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEA 337          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Fly
Match: Pka-C1 (gene:FBgn0000273 transcript:FBtr0079852)

HSP 1 Score: 385.956 bits (990), Expect = 5.620e-132
Identity = 189/318 (59.43%), Postives = 246/318 (77.36%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEET 1097
            L +  EEF  KW   P  TA ++DFERIKTLG G+FGRV++V+HK   +YYA+K+L K +++K KQ+E+ LNEK+IL  I+FPFL+ L Y FKDNS LYMVLE+V GGEMF+ LR + RF +   +FY AQ+++AFEYLHYL + YRDLKPEN+L++S GYLKV D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S F +DLKDL+RNL+QVDL++R+GNLK GV DIK  K+F   DW+ ++ KK +AP+ P+CKGP DTS FD +EEE 
Sbjct:   22 LEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEA 337          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Fly
Match: Pka-C1 (gene:FBgn0000273 transcript:FBtr0079851)

HSP 1 Score: 385.956 bits (990), Expect = 5.620e-132
Identity = 189/318 (59.43%), Postives = 246/318 (77.36%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEET 1097
            L +  EEF  KW   P  TA ++DFERIKTLG G+FGRV++V+HK   +YYA+K+L K +++K KQ+E+ LNEK+IL  I+FPFL+ L Y FKDNS LYMVLE+V GGEMF+ LR + RF +   +FY AQ+++AFEYLHYL + YRDLKPEN+L++S GYLKV D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S F +DLKDL+RNL+QVDL++R+GNLK GV DIK  K+F   DW+ ++ KK +AP+ P+CKGP DTS FD +EEE 
Sbjct:   22 LEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEA 337          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Fly
Match: Pka-C3 (gene:FBgn0000489 transcript:FBtr0075529)

HSP 1 Score: 297.745 bits (761), Expect = 1.468e-95
Identity = 144/296 (48.65%), Postives = 201/296 (67.91%), Query Frame = 3
Query:  207 MEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            ++D++ IKT+G G FGRV L + + +  Y A+K+L+  E+I+ KQIE+  NE+ IL  I  PF+I L +S KD+S LYM+ ++V GGE+FT LRN  +F      FY A+++ A EYLH L I YRDLKPEN+L+N DG+LK+ D GFAK +    RTWTLCGTP+Y+APEII +KG++ AVDWWA GVL+YEM  G+PPF  +     +E I+SGK+++        KDLI+ L+  D ++R GN+KNG  D+K+H++F  ++W DVY KK K P  P      DT  FD + E+
Sbjct:  188 LDDYQIIKTVGTGTFGRVCLCRDRISEKYCAMKILAMTEVIRLKQIEHVKNERNILREIRHPFVISLEWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHSLQIVYRDLKPENLLINRDGHLKITDFGFAKKL--RDRTWTLCGTPEYIAPEIIQSKGHNKAVDWWALGVLIYEMLVGYPPFYDEQPFGIYEKILSGKIEWERHMDPIAKDLIKKLLVNDRTKRLGNMKNGADDVKRHRWFKHLNWNDVYSKKLKPPILPDVHHDGDTKNFDDYPEK 481          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Fly
Match: Pka-C3 (gene:FBgn0000489 transcript:FBtr0075528)

HSP 1 Score: 298.13 bits (762), Expect = 1.111e-94
Identity = 144/296 (48.65%), Postives = 201/296 (67.91%), Query Frame = 3
Query:  207 MEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            ++D++ IKT+G G FGRV L + + +  Y A+K+L+  E+I+ KQIE+  NE+ IL  I  PF+I L +S KD+S LYM+ ++V GGE+FT LRN  +F      FY A+++ A EYLH L I YRDLKPEN+L+N DG+LK+ D GFAK +    RTWTLCGTP+Y+APEII +KG++ AVDWWA GVL+YEM  G+PPF  +     +E I+SGK+++        KDLI+ L+  D ++R GN+KNG  D+K+H++F  ++W DVY KK K P  P      DT  FD + E+
Sbjct:  271 LDDYQIIKTVGTGTFGRVCLCRDRISEKYCAMKILAMTEVIRLKQIEHVKNERNILREIRHPFVISLEWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHSLQIVYRDLKPENLLINRDGHLKITDFGFAKKL--RDRTWTLCGTPEYIAPEIIQSKGHNKAVDWWALGVLIYEMLVGYPPFYDEQPFGIYEKILSGKIEWERHMDPIAKDLIKKLLVNDRTKRLGNMKNGADDVKRHRWFKHLNWNDVYSKKLKPPILPDVHHDGDTKNFDDYPEK 564          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Zebrafish
Match: prkacbb (protein kinase, cAMP-dependent, catalytic, beta b [Source:ZFIN;Acc:ZDB-GENE-050904-4])

HSP 1 Score: 392.119 bits (1006), Expect = 2.451e-134
Identity = 187/317 (58.99%), Postives = 251/317 (79.18%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW++P ++T  ++DF+R KTLG G+FGRV+LVKHKA+  YYA+KVL K +++K KQ+E+ LNEK+IL  + FPFL+ L Y+FKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNL+NGV DIK HK+F   DW+ +Y++K +AP+ PKC+GP DTS FD +EEE
Sbjct:   20 LAKAKEDFLRKWESPQQSTTCLDDFDRQKTLGTGSFGRVLLVKHKASDQYYAMKVLDKQKVVKLKQVEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLRNGVNDIKNHKWFATTDWIAIYERKVEAPFIPKCRGPGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Zebrafish
Match: prkacaa (protein kinase, cAMP-dependent, catalytic, alpha, genome duplicate a [Source:ZFIN;Acc:ZDB-GENE-050114-6])

HSP 1 Score: 391.349 bits (1004), Expect = 5.319e-134
Identity = 189/324 (58.33%), Postives = 252/324 (77.78%), Query Frame = 3
Query:  123 MTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            M      L K  E+FL KW+NP + TA+++ FER+KTLG G+FGRV+LVKHK +G ++A+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L +SFKDN+ LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV DIK HK+F   DW+ +Y KK +AP+ PKCKGP DTS FD ++EE
Sbjct:   14 MESVKEFLAKAKEDFLKKWENPAQNTASLDHFERLKTLGTGSFGRVMLVKHKESGQHFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEHSFKDNTNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKGHKWFATTDWIAIYQKKVEAPFIPKCKGPGDTSNFDDYDEE 335          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Zebrafish
Match: prkacab (protein kinase, cAMP-dependent, catalytic, alpha, genome duplicate b [Source:ZFIN;Acc:ZDB-GENE-040801-208])

HSP 1 Score: 389.808 bits (1000), Expect = 2.004e-133
Identity = 182/312 (58.33%), Postives = 249/312 (79.81%), Query Frame = 3
Query:  159 EEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            E+FL KW+NP + TA +EDF+R+KTLG G+FGRV+LV+H+  G +YA+K+L+K +++K KQIE+ LNEK+IL  + FPFL+ L YSFKDN+ LYMV+++V GGEMF+ LR + RF +   +FY +Q+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++R+GNLKNGV DIK HK+F   DW+ +Y ++ +AP+ PKC+GP DTS FD +EEE
Sbjct:   25 EDFLRKWENPAQNTACLEDFDRLKTLGTGSFGRVMLVRHRETGQHYAMKILNKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYSFKDNTNLYMVMQYVQGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLMYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFSTTDWIAIYQRRVEAPFVPKCRGPGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Zebrafish
Match: prkacba (protein kinase, cAMP-dependent, catalytic, beta a [Source:ZFIN;Acc:ZDB-GENE-040426-1351])

HSP 1 Score: 384.415 bits (986), Expect = 1.285e-130
Identity = 184/323 (56.97%), Postives = 250/323 (77.40%), Query Frame = 3
Query:  126 TDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            T     L K  E+FL KW+   K+TA ++DF+++KTLG G+FGRV+LVKHK +  Y+A+K+L KL+++K KQIE+ LNEKKIL  + FPFL+ L  +FKDNS LYMV+ ++ GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV++ S FS+DLKDL+RNL+QVDL++RFGNLKNGV+DIK H++F   DW+ +Y+KK  AP  PKC+GP DTS FD+++EE
Sbjct:   58 TAMKETLAKAKEDFLNKWECQQKSTACLDDFDKLKTLGTGSFGRVMLVKHKQSEQYFAMKILDKLKVVKLKQIEHTLNEKKILQAVSFPFLVKLECAFKDNSNLYMVMRYIQGGEMFSHLRRIGRFSEQNARFYAAQIVLTFEYLHMLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRYPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKNHRWFASTDWIAIYEKKVDAPIIPKCRGPGDTSNFDEYDEE 378          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Zebrafish
Match: prkacba (protein kinase, cAMP-dependent, catalytic, beta a [Source:ZFIN;Acc:ZDB-GENE-040426-1351])

HSP 1 Score: 384.415 bits (986), Expect = 1.285e-130
Identity = 184/323 (56.97%), Postives = 250/323 (77.40%), Query Frame = 3
Query:  126 TDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            T     L K  E+FL KW+   K+TA ++DF+++KTLG G+FGRV+LVKHK +  Y+A+K+L KL+++K KQIE+ LNEKKIL  + FPFL+ L  +FKDNS LYMV+ ++ GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV++ S FS+DLKDL+RNL+QVDL++RFGNLKNGV+DIK H++F   DW+ +Y+KK  AP  PKC+GP DTS FD+++EE
Sbjct:   58 TAMKETLAKAKEDFLNKWECQQKSTACLDDFDKLKTLGTGSFGRVMLVKHKQSEQYFAMKILDKLKVVKLKQIEHTLNEKKILQAVSFPFLVKLECAFKDNSNLYMVMRYIQGGEMFSHLRRIGRFSEQNARFYAAQIVLTFEYLHMLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRYPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKNHRWFASTDWIAIYEKKVDAPIIPKCRGPGDTSNFDEYDEE 378          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Xenopus
Match: ints8 (integrator complex subunit 8 [Source:Xenbase;Acc:XB-GENE-980129])

HSP 1 Score: 398.282 bits (1022), Expect = 8.043e-137
Identity = 196/325 (60.31%), Postives = 255/325 (78.46%), Query Frame = 3
Query:  120 SMTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            SM +F   L K  E+FL KW+NP + TA +E FERIKTLG G+FGRV+LV+HK NG+++A+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L YSFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY +Q+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV DIK HK+F   DW+ VY KK +AP+ PKCKGP DTS FD +EEE
Sbjct:    5 SMKEF---LAKAKEDFLKKWENPAQNTAHLEQFERIKTLGTGSFGRVMLVRHKENGSHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVTDIKGHKWFSTTDWIAVYQKKVEAPFIPKCKGPGDTSNFDDYEEE 324          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Xenopus
Match: prkacb (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:100038053])

HSP 1 Score: 398.667 bits (1023), Expect = 1.019e-136
Identity = 191/317 (60.25%), Postives = 250/317 (78.86%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+ PP+ TA+++DFERIKTLG G+FGRV+LVKHK    YYA+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L YSFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++R+GNLKNGV DIK HK+F   DW+ +Y +K +AP+ PKC+GP DTS FD +EEE
Sbjct:   20 LAKAKEDFLRKWETPPQNTASLDDFERIKTLGTGSFGRVMLVKHKGAEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKCRGPGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Xenopus
Match: ints8 (integrator complex subunit 8 [Source:Xenbase;Acc:XB-GENE-980129])

HSP 1 Score: 397.897 bits (1021), Expect = 1.756e-136
Identity = 193/317 (60.88%), Postives = 251/317 (79.18%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+NP + TA +E FERIKTLG G+FGRV+LV+HK NG+++A+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L YSFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY +Q+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV DIK HK+F   DW+ VY KK +AP+ PKCKGP DTS FD +EEE
Sbjct:   20 LAKAKEDFLKKWENPAQNTAHLEQFERIKTLGTGSFGRVMLVRHKENGSHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVTDIKGHKWFSTTDWIAVYQKKVEAPFIPKCKGPGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Xenopus
Match: ints8 (integrator complex subunit 8 [Source:Xenbase;Acc:XB-GENE-980129])

HSP 1 Score: 397.127 bits (1019), Expect = 2.271e-136
Identity = 193/317 (60.88%), Postives = 251/317 (79.18%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+NP + TA +E FERIKTLG G+FGRV+LV+HK NG+++A+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L YSFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY +Q+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV DIK HK+F   DW+ VY KK +AP+ PKCKGP DTS FD +EEE
Sbjct:    6 LAKAKEDFLKKWENPAQNTAHLEQFERIKTLGTGSFGRVMLVRHKENGSHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVTDIKGHKWFSTTDWIAVYQKKVEAPFIPKCKGPGDTSNFDDYEEE 320          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Xenopus
Match: ints8 (integrator complex subunit 8 [Source:Xenbase;Acc:XB-GENE-980129])

HSP 1 Score: 397.127 bits (1019), Expect = 2.478e-136
Identity = 193/317 (60.88%), Postives = 251/317 (79.18%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+NP + TA +E FERIKTLG G+FGRV+LV+HK NG+++A+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L YSFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY +Q+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV DIK HK+F   DW+ VY KK +AP+ PKCKGP DTS FD +EEE
Sbjct:    6 LAKAKEDFLKKWENPAQNTAHLEQFERIKTLGTGSFGRVMLVRHKENGSHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVTDIKGHKWFSTTDWIAVYQKKVEAPFIPKCKGPGDTSNFDDYEEE 320          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Mouse
Match: Prkacb (protein kinase, cAMP dependent, catalytic, beta [Source:MGI Symbol;Acc:MGI:97594])

HSP 1 Score: 405.986 bits (1042), Expect = 4.805e-139
Identity = 195/325 (60.00%), Postives = 253/325 (77.85%), Query Frame = 3
Query:  120 SMTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            SM +F   L K  E+FL KW+NPP + A +EDFER KTLG G+FGRV+LVKHKA   YYA+K+L K +++K KQIE+ LNEK+IL  +EFPFL+ L YSFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV+DIK HK+F   DW+ +Y +K +AP+ PK +G  DTS FD +EEE
Sbjct:   62 SMKEF---LAKAKEDFLRKWENPPPSNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEE 381          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Mouse
Match: Prkacb (protein kinase, cAMP dependent, catalytic, beta [Source:MGI Symbol;Acc:MGI:97594])

HSP 1 Score: 402.905 bits (1034), Expect = 1.464e-138
Identity = 192/317 (60.57%), Postives = 249/317 (78.55%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+NPP + A +EDFER KTLG G+FGRV+LVKHKA   YYA+K+L K +++K KQIE+ LNEK+IL  +EFPFL+ L YSFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV+DIK HK+F   DW+ +Y +K +AP+ PK +G  DTS FD +EEE
Sbjct:   20 LAKAKEDFLRKWENPPPSNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Mouse
Match: Prkacb (protein kinase, cAMP dependent, catalytic, beta [Source:MGI Symbol;Acc:MGI:97594])

HSP 1 Score: 402.519 bits (1033), Expect = 1.491e-138
Identity = 192/317 (60.57%), Postives = 249/317 (78.55%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+NPP + A +EDFER KTLG G+FGRV+LVKHKA   YYA+K+L K +++K KQIE+ LNEK+IL  +EFPFL+ L YSFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV+DIK HK+F   DW+ +Y +K +AP+ PK +G  DTS FD +EEE
Sbjct:    7 LAKAKEDFLRKWENPPPSNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEE 321          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Mouse
Match: Prkacb (protein kinase, cAMP dependent, catalytic, beta [Source:MGI Symbol;Acc:MGI:97594])

HSP 1 Score: 402.519 bits (1033), Expect = 1.494e-138
Identity = 192/317 (60.57%), Postives = 249/317 (78.55%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+NPP + A +EDFER KTLG G+FGRV+LVKHKA   YYA+K+L K +++K KQIE+ LNEK+IL  +EFPFL+ L YSFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV+DIK HK+F   DW+ +Y +K +AP+ PK +G  DTS FD +EEE
Sbjct:    8 LAKAKEDFLRKWENPPPSNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEE 322          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Mouse
Match: Prkaca (protein kinase, cAMP dependent, catalytic, alpha [Source:MGI Symbol;Acc:MGI:97592])

HSP 1 Score: 397.127 bits (1019), Expect = 1.878e-136
Identity = 191/325 (58.77%), Postives = 251/325 (77.23%), Query Frame = 3
Query:  120 SMTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            S  D    L K  E+FL KW+ P + TA ++ F+RIKTLG G+FGRV+LVKHK +GN+YA+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L +SFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV DIK HK+F   DW+ +Y +K +AP+ PK KGP DTS FD +EEE
Sbjct:    4 SSNDVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEE 326          
BLAST of cAMP dependent protein kinase catalytic subunit vs. UniProt/SwissProt
Match: sp|P68182|KAPCB_RAT (cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus OX=10116 GN=Prkacb PE=1 SV=2)

HSP 1 Score: 402.905 bits (1034), Expect = 1.024e-137
Identity = 192/317 (60.57%), Postives = 249/317 (78.55%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+NPP + A +EDFER KTLG G+FGRV+LVKHKA   YYA+K+L K +++K KQIE+ LNEK+IL  +EFPFL+ L YSFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV+DIK HK+F   DW+ +Y +K +AP+ PK +G  DTS FD +EEE
Sbjct:   20 LAKAKEDFLRKWENPPPSNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. UniProt/SwissProt
Match: sp|P68181|KAPCB_MOUSE (cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus OX=10090 GN=Prkacb PE=1 SV=2)

HSP 1 Score: 402.905 bits (1034), Expect = 1.024e-137
Identity = 192/317 (60.57%), Postives = 249/317 (78.55%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+NPP + A +EDFER KTLG G+FGRV+LVKHKA   YYA+K+L K +++K KQIE+ LNEK+IL  +EFPFL+ L YSFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV+DIK HK+F   DW+ +Y +K +AP+ PK +G  DTS FD +EEE
Sbjct:   20 LAKAKEDFLRKWENPPPSNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. UniProt/SwissProt
Match: sp|P68180|KAPCB_CRIGR (cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus OX=10029 GN=PRKACB PE=2 SV=2)

HSP 1 Score: 402.905 bits (1034), Expect = 1.024e-137
Identity = 192/317 (60.57%), Postives = 249/317 (78.55%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+NPP + A +EDFER KTLG G+FGRV+LVKHKA   YYA+K+L K +++K KQIE+ LNEK+IL  +EFPFL+ L YSFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV+DIK HK+F   DW+ +Y +K +AP+ PK +G  DTS FD +EEE
Sbjct:   20 LAKAKEDFLRKWENPPPSNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVEFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. UniProt/SwissProt
Match: sp|P36887|KAPCA_PIG (cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa OX=9823 GN=PRKACA PE=1 SV=4)

HSP 1 Score: 397.127 bits (1019), Expect = 1.657e-135
Identity = 191/317 (60.25%), Postives = 249/317 (78.55%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+NP + TA ++ FERIKTLG G+FGRV+LVKHK  GN++A+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L YSFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV DIK HK+F   DW+ +Y +K +AP+ PK KGP DTS FD +EEE
Sbjct:   20 LAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. UniProt/SwissProt
Match: sp|P22694|KAPCB_HUMAN (cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens OX=9606 GN=PRKACB PE=1 SV=2)

HSP 1 Score: 396.356 bits (1017), Expect = 4.275e-135
Identity = 189/317 (59.62%), Postives = 247/317 (77.92%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+NP +  A +EDFER KTLG G+FGRV+LVKHKA   YYA+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L Y+FKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV+DIK HK+F   DW+ +Y +K +AP+ PK +G  DTS FD +EEE
Sbjct:   20 LAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. TrEMBL
Match: A0A4S2L5E2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010367 PE=3 SV=1)

HSP 1 Score: 516.153 bits (1328), Expect = 6.848e-180
Identity = 244/329 (74.16%), Postives = 289/329 (87.84%), Query Frame = 3
Query:  111 M*VSMTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEET 1097
            M     +F+ +L +K +EF  ++ NPPK   +MEDFERI+TLG+GAFGRV+LV+H     YYALK+LSK+EI+KS+QIENA+NEK+ILA   FPF+I L +SFKDNSYLYMV+EFVIGGEMFTLLRNMRRFPDN+VKFY AQV+MAFEYLH L+IAYRDLKPEN+L+  +G+LKV D+GFAKMIPKDKRTWTLCGTPDYMAPEIIM+KGYHCAVDWWAFGVLLYEMT GFPPFMHQDQMKTFEHIISGK+KFT++F  +LKDLIRNL+QVDLSRRFGNLKNG+ADIK+H YF ++DW+ +Y+ + + PYKPK KGP DTSCF+KWEEET
Sbjct:    1 MPTRQAEFDEILSEKTKEFRERYFNPPKEVVSMEDFERIRTLGRGAFGRVLLVRHWDKDQYYALKILSKIEIVKSRQIENAINEKRILAACNFPFIIKLFFSFKDNSYLYMVMEFVIGGEMFTLLRNMRRFPDNMVKFYAAQVVMAFEYLHMLTIAYRDLKPENLLITGEGFLKVADLGFAKMIPKDKRTWTLCGTPDYMAPEIIMSKGYHCAVDWWAFGVLLYEMTTGFPPFMHQDQMKTFEHIISGKIKFTNNFGPELKDLIRNLIQVDLSRRFGNLKNGIADIKEHAYFSDLDWIQLYNMQMRPPYKPKYKGPSDTSCFEKWEEET 329          
BLAST of cAMP dependent protein kinase catalytic subunit vs. TrEMBL
Match: H2KU48 (Protein kinase A OS=Clonorchis sinensis OX=79923 GN=PRKACA PE=3 SV=1)

HSP 1 Score: 514.227 bits (1323), Expect = 3.029e-179
Identity = 243/329 (73.86%), Postives = 289/329 (87.84%), Query Frame = 3
Query:  111 M*VSMTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEET 1097
            M     +F+ +L +K +EF  ++ NPPK   +MEDFERI+TLG+GAFGRV+LV+H     YYALK+LSK+EI+KS+QIENA+NEK+ILA   FPF+I L +SFKDNSYLYMV+EFVIGGEMFTLLRNMRRFPDN+VKFY AQV+MAFEYLH L+IAYRDLKPEN+L+  +G+LKV D+GFAKMIPKDKRTWTLCGTPDYMAPEIIM+KGYHCAVDWWAFGVLLYEMT GFPPFMHQDQMKTFEHIISGK+KFT++F  +LKDLIRNL+QVDLSRR+GNLKNG+ADIK+H YF ++DW+ +Y+ + + PYKPK KGP DTSCF+KWEEET
Sbjct:    1 MPTRQAEFDEILSEKTKEFRERYFNPPKEVVSMEDFERIRTLGRGAFGRVLLVRHWDKDQYYALKILSKIEIVKSRQIENAINEKRILAACNFPFIIKLFFSFKDNSYLYMVMEFVIGGEMFTLLRNMRRFPDNMVKFYAAQVVMAFEYLHMLTIAYRDLKPENLLITGEGFLKVADLGFAKMIPKDKRTWTLCGTPDYMAPEIIMSKGYHCAVDWWAFGVLLYEMTTGFPPFMHQDQMKTFEHIISGKIKFTNNFGPELKDLIRNLIQVDLSRRYGNLKNGIADIKEHAYFSDLDWIQLYNMQVRPPYKPKYKGPSDTSCFEKWEEET 329          
BLAST of cAMP dependent protein kinase catalytic subunit vs. TrEMBL
Match: A0A074ZWV6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_13709 PE=3 SV=1)

HSP 1 Score: 513.457 bits (1321), Expect = 5.902e-179
Identity = 242/329 (73.56%), Postives = 289/329 (87.84%), Query Frame = 3
Query:  111 M*VSMTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEET 1097
            M     +F+ +L++K +EF  ++ NPPK   +MEDFERI+TLG+GAFGRV+LV+H     YYALK+LSK+EI+KS+QIENA+NEK+ILA   FPF+I L +SFKDNSYLYMV+EFVIGGEMFTLLRNMRRFPDN+VKFY AQV+MAFEYLH L+IAYRDLKPEN+L+  +G+LKV D+GFAKMIPKDKRTWTLCGTPDYMAPEIIM+KGYHCAVDWWAFGVLLYEMT GFPPFMHQDQMKTFEHIISGK+KFT++F  +LKDLIRNL+QVDLSRR+GNLKNG+ADIK+H YF ++DW+ +Y+ + + PYKPK KGP DTSCF+KWEEE 
Sbjct:    1 MPTRQAEFDDILLEKTKEFRERYFNPPKEVVSMEDFERIRTLGRGAFGRVLLVRHWDKDQYYALKILSKIEIVKSRQIENAINEKRILAACNFPFIIKLFFSFKDNSYLYMVMEFVIGGEMFTLLRNMRRFPDNMVKFYAAQVVMAFEYLHMLTIAYRDLKPENLLITGEGFLKVADLGFAKMIPKDKRTWTLCGTPDYMAPEIIMSKGYHCAVDWWAFGVLLYEMTTGFPPFMHQDQMKTFEHIISGKIKFTNNFGPELKDLIRNLIQVDLSRRYGNLKNGIADIKEHAYFSDLDWLQLYNMQVRPPYKPKYKGPSDTSCFEKWEEEN 329          
BLAST of cAMP dependent protein kinase catalytic subunit vs. TrEMBL
Match: A0A1S8X7H3 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_01445 PE=3 SV=1)

HSP 1 Score: 513.072 bits (1320), Expect = 1.144e-178
Identity = 242/329 (73.56%), Postives = 289/329 (87.84%), Query Frame = 3
Query:  111 M*VSMTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEET 1097
            M     +F+ +L++K +EF  ++ NPPK   +MEDFERI+TLG+GAFGRV+LV+H     YYALK+LSK+EI+KS+QIENA+NEK+ILA   FPF+I L +SFKDNSYLYMV+EFVIGGEMFTLLRNMRRFPDN+VKFY AQV+MAFEYLH L+IAYRDLKPEN+L+  +G+LKV D+GFAKMIPKDKRTWTLCGTPDYMAPEIIM+KGYHCAVDWWAFGVLLYEMT GFPPFMHQDQMKTFEHIISGK+KFT++F  +LKDLIRNL+QVDLSRR+GNLKNG+ADIK+H YF ++DW+ +Y+ + + PYKPK KGP DTSCF+KWEEE 
Sbjct:    1 MPTRQAEFDDILLEKTKEFRERYFNPPKEVVSMEDFERIRTLGRGAFGRVLLVRHWDKDQYYALKILSKIEIVKSRQIENAINEKRILAACNFPFIIKLFFSFKDNSYLYMVMEFVIGGEMFTLLRNMRRFPDNMVKFYAAQVVMAFEYLHMLTIAYRDLKPENLLITGEGFLKVADLGFAKMIPKDKRTWTLCGTPDYMAPEIIMSKGYHCAVDWWAFGVLLYEMTTGFPPFMHQDQMKTFEHIISGKIKFTNNFGPELKDLIRNLIQVDLSRRYGNLKNGIADIKEHAYFSDLDWLQLYNMQVRPPYKPKYKGPSDTSCFEKWEEEN 329          
BLAST of cAMP dependent protein kinase catalytic subunit vs. TrEMBL
Match: A0A504YU12 (cAMP-dependent protein kinase catalytic subunit alpha OS=Fasciola gigantica OX=46835 GN=FGIG_01338 PE=3 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 6.468e-178
Identity = 243/329 (73.86%), Postives = 288/329 (87.54%), Query Frame = 3
Query:  111 M*VSMTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEET 1097
            M     +F+ +L +K +EF   + NP K   +MEDFERI+TLG+GAFGRV+LV+H     YYA+KVLSK+EI+KS+QI+NA+NEK+ILA   FPF+I LAYSFKDNSYLYMV+EFVIGGEMFTLLRNMRRFPDN+VKFY AQV+MAFEYLH L+IAYRDLKPEN+L+  +G+LKV D+GFAKMIPKDKRTWTLCGTPDYMAPEIIM+KGYHCAVDWWAFGVLLYEMT GFPPFMHQDQMKTFEHIISGK+KFT++F  +LKDLIRNL+QVDLSRR+GNLKNG++DIK+H YF ++DWM +Y+ + + PYKPK KGP DTSCF+KWEEET
Sbjct:    1 MPTKQAEFDEILNEKAKEFRELYFNPTKDPVSMEDFERIRTLGRGAFGRVLLVRHWDKDAYYAMKVLSKVEIVKSRQIDNAINEKRILAACNFPFIIRLAYSFKDNSYLYMVMEFVIGGEMFTLLRNMRRFPDNMVKFYAAQVVMAFEYLHLLTIAYRDLKPENLLITGEGFLKVADLGFAKMIPKDKRTWTLCGTPDYMAPEIIMSKGYHCAVDWWAFGVLLYEMTTGFPPFMHQDQMKTFEHIISGKIKFTNNFGPELKDLIRNLIQVDLSRRYGNLKNGISDIKEHAYFADLDWMQLYNLQMRPPYKPKYKGPSDTSCFEKWEEET 329          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Cavefish
Match: ENSAMXT00000050353.1 (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:103029308])

HSP 1 Score: 397.897 bits (1021), Expect = 9.471e-137
Identity = 190/317 (59.94%), Postives = 251/317 (79.18%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+ PP++T  ++DFER+KTLG G+FGRV+LVKHKA   YYA+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L Y+FKDNS LYMV+E+V GGEMF+ LR + RF ++  +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV DIK HK+F   DW+ +Y++K +AP  PKC+GP DTS FD +EEE
Sbjct:   20 LAKAKEDFLRKWECPPQSTTCLDDFERLKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEHHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYERKVEAPIIPKCRGPGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Cavefish
Match: ENSAMXT00000050990.1 (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:103029308])

HSP 1 Score: 398.282 bits (1022), Expect = 1.027e-136
Identity = 190/317 (59.94%), Postives = 251/317 (79.18%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+ PP++T  ++DFER+KTLG G+FGRV+LVKHKA   YYA+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L Y+FKDNS LYMV+E+V GGEMF+ LR + RF ++  +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV DIK HK+F   DW+ +Y++K +AP  PKC+GP DTS FD +EEE
Sbjct:   20 LAKAKEDFLRKWECPPQSTTCLDDFERLKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEHHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYERKVEAPIIPKCRGPGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Cavefish
Match: ENSAMXT00000056663.1 (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:103029308])

HSP 1 Score: 398.282 bits (1022), Expect = 3.812e-136
Identity = 190/317 (59.94%), Postives = 251/317 (79.18%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+ PP++T  ++DFER+KTLG G+FGRV+LVKHKA   YYA+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L Y+FKDNS LYMV+E+V GGEMF+ LR + RF ++  +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV DIK HK+F   DW+ +Y++K +AP  PKC+GP DTS FD +EEE
Sbjct:   64 LAKAKEDFLRKWECPPQSTTCLDDFERLKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEHHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYERKVEAPIIPKCRGPGDTSNFDDYEEE 378          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Cavefish
Match: prkacbb (cAMP-dependent protein kinase catalytic subunit beta [Source:NCBI gene;Acc:103034112])

HSP 1 Score: 395.586 bits (1015), Expect = 8.007e-136
Identity = 189/317 (59.62%), Postives = 251/317 (79.18%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+ PP++T T++DFER+KTLG G+FGRV+LVKHK    ++A+KVL K +++K KQIE+ LNEK+IL  + FPFL+ L YSFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++R+GNLKNGV DIK HK+F   DW+ +Y++K +AP+ PKC+GP DTS FD +EEE
Sbjct:   20 LAKAKEDFLRKWECPPQSTTTLDDFERLKTLGTGSFGRVMLVKHKGTEQFFAMKVLDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYERKVEAPFIPKCRGPGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Cavefish
Match: prkacaa (cAMP-dependent protein kinase catalytic subunit alpha [Source:NCBI gene;Acc:103024963])

HSP 1 Score: 395.586 bits (1015), Expect = 9.652e-136
Identity = 190/324 (58.64%), Postives = 252/324 (77.78%), Query Frame = 3
Query:  123 MTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            M      L K  E+FL KW+NP + TA+++ FER+KTLG G+FGRV+LVKHK  G ++A+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L +SFKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV+DIK HK+F   DW+ +Y +K +AP+ PKCKGP DTS FD +EEE
Sbjct:   14 MESVKEFLAKAKEDFLKKWENPAQNTASLDQFERLKTLGTGSFGRVMLVKHKETGQHFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEHSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKGHKWFATTDWIAIYQRKVEAPFIPKCKGPGDTSNFDDYEEE 335          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001814.1 (pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gene:ENSPMAG00000001637.1 transcript:ENSPMAT00000001814.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 328.946 bits (842), Expect = 2.731e-111
Identity = 161/270 (59.63%), Postives = 210/270 (77.78%), Query Frame = 3
Query:  285 GNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            G + +LK   + +++K KQ+E+ LNEK+IL  I FPFL+ L YSFKDNS LYMVLE+V GGEMF+ LR + RF +   +FY AQ+++AFEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV DIK HK+F   DW+ +Y +K +AP+ PKCKGP D S FD +EEE
Sbjct:    4 GQHVSLKATKRTKVVKLKQVEHTLNEKRILQAISFPFLVRLEYSFKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYQRKVEAPFIPKCKGPGDASNFDDYEEE 271          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.817 bits (621), Expect = 1.381e-75
Identity = 125/300 (41.67%), Postives = 185/300 (61.67%), Query Frame = 3
Query:  189 PKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHY-LSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTW-TLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDK 1082
            PK+  TM +F+ +K LGKG FG+VILV+ KA G YYA+K+L K  I+   ++ + L E ++L   + PFL  L YSF+ +  L  V+E+V GGE+F  L   R F ++  +FYGA+++ A +YLH   ++ YRDLK EN++L+ DG++K+ D G  K    D  T  T CGTP+Y+APE++ +  Y  AVDWW  GV++YEM  G  PF +QD  K FE I+   ++F  + S D + L+  L++ D  +R G   +   +I +H +F  I W DVYD+K   P+KP+     DT  FD+
Sbjct:  141 PKSKVTMNNFDYLKLLGKGTFGKVILVREKATGQYYAMKILKKEVIVAKDEVAHTLTENRVLQTTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFAGIIWQDVYDRKMTPPFKPQVASETDTRYFDE 440          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002200.1 (pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 gene:ENSPMAG00000001993.1 transcript:ENSPMAT00000002200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 237.654 bits (605), Expect = 5.382e-75
Identity = 112/261 (42.91%), Postives = 169/261 (64.75%), Query Frame = 3
Query:  225 IKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISG--KVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDW 1001
            I TLG G FGRV LVK K +   +ALK L K  +++S+Q E+  +EK+IL     PF++    +F+D  ++++++E  +GGE++++LR+   F +   +F  A V+ A  YLH   I YRDLKPEN+LL++ GY+K+ D GFAK +   ++ WT CGTP+Y+ PE+I+N+G+    D WA GVL+YE+ AG PPF   D MKT+  I+ G  +V F +      +D+IR L + + S R GN K+GV D+++HK+F   DW
Sbjct:   37 IATLGVGGFGRVQLVKLKDSDVTFALKCLKKKFVVESRQQEHVYSEKRILQECSCPFIVRFYRTFRDQKFVFLLMEACLGGELWSVLRDSGGFQEVSARFCVACVVEALAYLHARGILYRDLKPENLLLDARGYIKMADFGFAKKLACGRKAWTFCGTPEYVCPEMIVNRGHDRGADCWALGVLVYELLAGVPPFSGTDPMKTYNAILWGMERVHFPNEVGKRAEDIIRRLCRQNPSERLGNQKHGVGDVRKHKWFQGFDW 297          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004852.1 (pep scaffold:Pmarinus_7.0:GL488704:3417:7135:1 gene:ENSPMAG00000004407.1 transcript:ENSPMAT00000004852.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.92 bits (533), Expect = 2.612e-66
Identity = 95/164 (57.93%), Postives = 129/164 (78.66%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKV 635
            L K  E+FL KW+NP + T+ ++DFER+KTLG G+FGRV+LVKHKA   Y+A+K+L K +++K KQ+E+ LNEK+IL  I FPFL+ L YS+KDNS LYMVLE+V GGEMF+ LR + RF +   +FY AQ+++AFEYLH L + YRDLKPEN+L++  GY++V
Sbjct:   20 LAKAKEDFLKKWENPQQNTSCLDDFERMKTLGTGSFGRVMLVKHKATDRYFAMKILDKQKVVKLKQVEHTLNEKRILQAISFPFLVSLEYSYKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDQQGYIQV 183          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 208.764 bits (530), Expect = 7.172e-63
Identity = 104/272 (38.24%), Postives = 163/272 (59.93%), Query Frame = 3
Query:  201 ATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILA-CIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKM-IPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDV 1010
            A   DF+ +  LGKG+FG+V+L KHK++G +YA+KV+ K  I++ K+ ++ + E+ +L   +  PFL+ L YSF+    LY V+++V GGE+F  L+    FP++  +FY A++  A  YLH L+I YRDLKPENILL+  G++ + D G  K  I     T T CGTP+Y+APE++    Y   VDWW  G +LYEM  G PPF  ++  + +E I+   ++     +     ++  L+  D  +R G   + + +IK H +F  I+W D+
Sbjct:   87 AKPSDFDFLTVLGKGSFGKVLLAKHKSDGIFYAVKVMKKSIILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQMYESILHQPLQLRPCTTNAAISVLEGLLHKDPHQRLGATSD-ILEIKNHVFFSTINWNDL 357          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 302.368 bits (773), Expect = 9.814e-100
Identity = 145/302 (48.01%), Postives = 206/302 (68.21%), Query Frame = 3
Query:  192 KATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVY-DXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            K   T+ DF+ ++TLG G+FGRV LV+   NG YYA+KVL K +++K KQ+E+  +E+++L  +E PFLI +  +F+D   ++MV++++ GGE+F+LLR  +RFP+ + KFY A+VI+A EYLH  +I YRDLKPENILL+ +G++K+ D GFAK +     TWTLCGTPDY+APE+I  K Y+ +VDWW+ GVL+YEM AG+ PF     MKT+E I+ GKV +   F  D+ DL+  L+  DL+RR GNL++G  DIK H +F E+ W  +           P   G  DTS FD++ EE
Sbjct:   62 KGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEV--QTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYPEE 361          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 296.975 bits (759), Expect = 1.946e-97
Identity = 138/298 (46.31%), Postives = 210/298 (70.47%), Query Frame = 3
Query:  204 TMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDX-XXXXXXXXXXXXXDDTSCFDKWEEE 1094
            ++ DF+ ++TLG G+FGRV L++   NG +YALK L K  I+K KQ+E+  +E+++L+ +  PF+I +  +F+D+  ++MV++++ GGE+F+LLR  +RFP+ + KFY A+V +A EYLH   I YRDLKPENILL+ +G++K+ D GFAK +P    T+TLCGTPDY+APE++  K Y+ +VDWW+FGVL+YEM AG+ PF + + MKT+E+I++ ++KF   F  D +DL++ L+  DLS R GNL+NG  D+K H +F E+ W  +  +        P  +G  DTS FD++ EE
Sbjct:   84 SLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVP--DVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEE 379          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 296.59 bits (758), Expect = 2.341e-97
Identity = 136/298 (45.64%), Postives = 213/298 (71.48%), Query Frame = 3
Query:  204 TMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXX-XXXXXXXXDDTSCFDKWEEE 1094
            +++DF+ ++TLG G+FGRV L++ + NG YYA+KVL K  +++ KQ+E+  +E+ +L+ +  PF+I +  +F+D   ++M+++++ GGE+F+LLR  +RFP+ + KFY A+V +A EYLH   I YRDLKPENILL+ +G++K+ D GFAK +P    T+TLCGTPDY+APE++  K Y+ ++DWW+FG+L+YEM AG+ PF   + MKT+E I++ +++F   F+ D+KDL+  L+  DLS+R GNL+NG  D+K H +F E+ W  +  +  + P   P  +G  DTS FDK+ EE
Sbjct:   83 SLQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVP--DVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDKYPEE 378          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 228.794 bits (582), Expect = 2.654e-68
Identity = 108/267 (40.45%), Postives = 167/267 (62.55%), Query Frame = 3
Query:  204 TMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKM-IPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDW 1001
            +++DF+ +K +GKG+FG+V+ V+ K     YALK + K  I+   ++ + L E+ +LA ++ PF++ L +SF+    LY VL F+ GGE+F  L+   RF  +  +FY A+++ A + LH L + YRDLKPENILL+  G++ + D G  K+ +  D +T T CGTP+Y+APE+++  GY  AVDWW  GVLLYEM  G PP+  +D  K ++ I+   + F   F  D KDL+  L+  D +RR G   NG  +I+ H +F ++ W
Sbjct:  343 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLVFPDGFDRDAKDLLIGLLSRDPTRRLG--YNGADEIRNHPFFSQLSW 607          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 222.631 bits (566), Expect = 5.389e-66
Identity = 108/267 (40.45%), Postives = 166/267 (62.17%), Query Frame = 3
Query:  204 TMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDK-RTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDW 1001
            +++DF+ +K +GKG+FG+V+ V+ K     YALK L K  I+   ++ + L E+ +LA ++ PF++ L +SF+    LY+VL F+ GGE+F  L++  RF     +FY A+++ A + LH L + YRDLKPENILL+  G++ + D G  K+  KD  +T T CGTP+Y+APEI++ +GY   VDWW  G+LLYEM  G PP+  ++    ++ I+   + F   F    KDL+  L+  D SRR G   NG  +I+ H +F +I W
Sbjct:  340 SIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLG--VNGTDEIRNHPFFKDISW 604          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Nematostella
Match: EDO35228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM62])

HSP 1 Score: 290.812 bits (743), Expect = 1.486e-95
Identity = 146/299 (48.83%), Postives = 204/299 (68.23%), Query Frame = 3
Query:  201 ATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSF-SADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
             T++DFE  KTLG G FGRV+L + +  G +YALK+++  E+I+ KQ+E+  NEK IL  IE PF++ L ++  D ++LYM+LE+  GGE+FT LR   RF +    F+G++++ A +YLH  SI YRDLKPENILL+ DG++K+ D GFAK +    +TWTLCGTP+Y+APEII +KG++ AVDWWA G+L+YEM  G+PPF   +    +E I+SGKV++     +   KDLI+ L+  D +RR G++KNG  D+K HK+F  IDW  V  +K K P  PK   P DT  FD + EE
Sbjct:   13 TTLQDFELSKTLGTGTFGRVLLARDRRGGEFYALKIMNISEVIRLKQVEHVQNEKNILMSIEHPFIVNLLWTQHDQTFLYMLLEYACGGELFTYLRTAGRFNNGTGLFFGSEIVSAMDYLHGHSIVYRDLKPENILLDRDGHVKLTDFGFAKEV--HDKTWTLCGTPEYLAPEIIQSKGHNKAVDWWALGILIYEMLVGYPPFFDDNPFGIYEKILSGKVEWPKHMDNTSAKDLIKKLLVHDRTRRLGSMKNGSEDVKNHKWFKVIDWNLVLQRKLKPPINPKISHPGDTRNFDDYPEE 309          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Nematostella
Match: EDO38407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ7])

HSP 1 Score: 250.751 bits (639), Expect = 3.599e-76
Identity = 121/271 (44.65%), Postives = 174/271 (64.21%), Query Frame = 3
Query:  195 ATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISG--KVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDW 1001
            A   +ED   +KTLG G FGRV LV+   +   +ALK L K  I++++Q ++ ++EKKI+     PF++ L  +FKD  YLYM+LE  +GGE++T+LR+   F D+  +FY   VI AF+YLH   I YRDLKPEN+LL+  GY K+VD GFAK I   ++TWT CGTP+Y+APEII+NKG+  + D+W+ G+L+YE+  G PPF   D MKT+  I+ G   + F    + +   LI+ L + +   R G  K G+ DI +HK+F   +W
Sbjct:  345 ANVRLEDLTVVKTLGIGGFGRVELVQVAGDKRTFALKTLKKHHIVETRQQDHIMSEKKIMMESNSPFIVRLHKTFKDKKYLYMLLEVCLGGELWTILRDRGSFDDSTTRFYVGCVIEAFQYLHSKGIVYRDLKPENLLLDGHGYCKLVDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDLSADYWSLGILMYELLTGSPPFSGTDPMKTYNIILKGIDMIDFPRKITRNAHALIKKLCRDNPVERLGYQKGGLKDIMKHKWFDGFNW 615          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Nematostella
Match: EDO38399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCY8])

HSP 1 Score: 246.514 bits (628), Expect = 9.402e-75
Identity = 121/267 (45.32%), Postives = 173/267 (64.79%), Query Frame = 3
Query:  195 ATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISG--KVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFI 989
            A  T+ED E + TLG G FGRV LV        YALK L K  I+ ++Q E+  +EK+IL     PF+  +  +FKD  Y+YM+LE  +GGE++T+LR+   F D   +F  A V+  FEYLH   I YRDLKPEN+LL++ GY+K+VD GFAK I   ++TWT CGTP+Y+APEII+NKG+  + D+W+ G+L++E+  G PPF   D MKT+  I+ G   V+F      + ++LI+ L + +   R G  K+G++DIK+HKY +
Sbjct:  324 ADLTLEDLEVVATLGTGGFGRVELVT-------YALKCLKKKHILDTRQQEHVYSEKRILMETNSPFICKIYRTFKDRKYVYMLLEACLGGELWTILRDRGTFEDATARFCIACVVEGFEYLHSKGIVYRDLKPENLLLDAKGYVKLVDFGFAKKIGSGRKTWTFCGTPEYVAPEIILNKGHDLSSDYWSLGILIFELLTGSPPFSSSDPMKTYNIILRGLDMVEFPKRIGRNPQNLIKRLCKDNPVERLGYQKDGLSDIKKHKYVV 583          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 224.172 bits (570), Expect = 1.131e-68
Identity = 110/278 (39.57%), Postives = 171/278 (61.51%), Query Frame = 3
Query:  183 NPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILA-CIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKM-IPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDV 1010
            N PKA  +  DF  +K +GKG+FG+V L K+K    +YA+KVL+K  I K  + ++ + E+ +L   +  PFL+ L YSF+    LY VL++V GGE+F  L+  R FP++  +FY A++  A  YLH L I YRDLKPENILL+S G++ + D G  K  I +   T T CGTP+Y+APE++  + Y  +VDWW  G +LYEM  G PPF  +D  + +++I+   ++  ++ S   + ++  L+Q D ++R G+ +    DI+ H +F  I+W  +
Sbjct:   65 NNPKAKPS--DFLFLKVIGKGSFGKVFLSKNKQEDKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKEGIDRSGTTSTFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYSRDTAEMYDNILHKPLRLRTNISQSARHILEGLLQKDKTKRLGSGEGDFEDIRTHSFFRSINWQQL 340          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 219.55 bits (558), Expect = 8.674e-67
Identity = 123/305 (40.33%), Postives = 180/305 (59.02%), Query Frame = 3
Query:  183 NPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNY----YALKVLSKLEIIKS-KQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAK-MIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFD 1079
            NP       E FE +K LGKG +G+V LVK K +G+     +A+KVL K  II+S K   +   E+ IL C++ PF++ L Y+F+    LY++LE++ GGE+F  L     F ++   FY +++ MA E+LH   I YRDLKPENILL+++G++K+ D G  K  I ++  T T CGT +YMAPEI+   G+  AVDWW+ G L+Y+M  G PPF   ++ KT + I+ GK+      + + KD IR L++     R G +      IK H +F  I W D+  KK + P++P   G +D S FD
Sbjct:   54 NPKDEKVGPESFELLKVLGKGGYGKVFLVK-KNHGHSKEKIFAMKVLKKAAIIRSQKDTAHTKAERNILECVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFLEDTACFYLSEISMALEHLHKQGIVYRDLKPENILLDANGHVKLTDFGLCKESIFENSLTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMYDMLTGTPPFCADNRKKTIDKILKGKLIIPPYLTPEAKDFIRKLLKRHPQARLGGMAGDANPIKAHSFFRHICWEDLLAKKVEPPFRPSISGEEDVSQFD 357          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Medaka
Match: ENSORLT00000007944.2 (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:101160305])

HSP 1 Score: 395.586 bits (1015), Expect = 7.454e-136
Identity = 189/317 (59.62%), Postives = 250/317 (78.86%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+ PP+ T +++DFER KTLG G+FGRV+LVKHKA   +YA+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L Y+FKDNS LYMV+E+V GGEMF+ LR   RF ++  +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV DIK HK+F   DW+ +Y++K +AP+ PKC+GP DTS FD +EEE
Sbjct:   20 LAKAKEDFLRKWECPPQCTTSLDDFERFKTLGTGSFGRVMLVKHKATNQFYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLVYAFKDNSNLYMVMEYVPGGEMFSHLRRTGRFSEHHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKKV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYERKIEAPFLPKCRGPGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Medaka
Match: ENSORLT00000028912.1 (protein kinase cAMP-activated catalytic subunit beta [Source:NCBI gene;Acc:101160305])

HSP 1 Score: 395.586 bits (1015), Expect = 2.695e-135
Identity = 189/317 (59.62%), Postives = 250/317 (78.86%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+ PP+ T +++DFER KTLG G+FGRV+LVKHKA   +YA+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L Y+FKDNS LYMV+E+V GGEMF+ LR   RF ++  +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNLKNGV DIK HK+F   DW+ +Y++K +AP+ PKC+GP DTS FD +EEE
Sbjct:   49 LAKAKEDFLRKWECPPQCTTSLDDFERFKTLGTGSFGRVMLVKHKATNQFYAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLVYAFKDNSNLYMVMEYVPGGEMFSHLRRTGRFSEHHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQHGYIQVTDFGFAKKV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYERKIEAPFLPKCRGPGDTSNFDDYEEE 363          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Medaka
Match: ENSORLT00000033457.1 (cAMP-dependent protein kinase catalytic subunit beta [Source:NCBI gene;Acc:101170876])

HSP 1 Score: 393.66 bits (1010), Expect = 4.350e-135
Identity = 188/317 (59.31%), Postives = 252/317 (79.50%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+ PP++T  +EDF+RIKTLG G+FGRV+LVKHK++  Y+A+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L Y+FKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++R+GNLKNGV DIK HK+F   DW+ +Y++K +AP+ PKC+GP DTS FD +EEE
Sbjct:   20 LAKAKEDFLRKWECPPQSTTCLEDFDRIKTLGTGSFGRVMLVKHKSSEQYFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHHGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFATTDWIAIYERKVEAPFIPKCRGPGDTSNFDDYEEE 334          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Medaka
Match: ENSORLT00000035979.1 (cAMP-dependent protein kinase catalytic subunit beta [Source:NCBI gene;Acc:101170876])

HSP 1 Score: 393.275 bits (1009), Expect = 6.471e-135
Identity = 188/317 (59.31%), Postives = 252/317 (79.50%), Query Frame = 3
Query:  144 LIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            L K  E+FL KW+ PP++T  +EDF+RIKTLG G+FGRV+LVKHK++  Y+A+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L Y+FKDNS LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++R+GNLKNGV DIK HK+F   DW+ +Y++K +AP+ PKC+GP DTS FD +EEE
Sbjct:   23 LAKAKEDFLRKWECPPQSTTCLEDFDRIKTLGTGSFGRVMLVKHKSSEQYFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHHGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFATTDWIAIYERKVEAPFIPKCRGPGDTSNFDDYEEE 337          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Medaka
Match: prkacaa (cAMP-dependent protein kinase catalytic subunit alpha [Source:NCBI gene;Acc:101163742])

HSP 1 Score: 393.66 bits (1010), Expect = 1.330e-134
Identity = 189/328 (57.62%), Postives = 252/328 (76.83%), Query Frame = 3
Query:  111 M*VSMTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            M + + D    L K  E+FL KW+NP + TA ++ FER+KTLG G+FGRV+LVKHK  G ++A+K+L K +++K KQIE+ LNEK+IL  + FPFL+ L +SFKD S LYMV+E+V GGEMF+ LR + RF +   +FY AQ+++ FEYLH L + YRDLKPEN+L++  GY++V D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FS+DLKDL+RNL+QVDL++RFGNL+NGV DIK HK+F   DW+ +Y +K +AP+ PKCKGP DTS FD +EEE
Sbjct:   35 MPIVLPDVKEFLAKAKEDFLKKWENPAQQTAALDHFERLKTLGTGSFGRVMLVKHKETGQHFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVQLEHSFKDTSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLRNGVNDIKGHKWFATTDWIAIYQRKVEAPFIPKCKGPGDTSNFDDYEEE 360          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Planmine SMEST
Match: SMESG000077092.1 (SMESG000077092.1)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 325/325 (100.00%), Postives = 325/325 (100.00%), Query Frame = 3
Query:  123 MTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEET 1097
            MTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDKKPKAPYKPKCKGPDDTSCFDKWEEET
Sbjct:    1 MTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDKKPKAPYKPKCKGPDDTSCFDKWEEET 325          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Planmine SMEST
Match: SMESG000037955.1 (SMESG000037955.1)

HSP 1 Score: 398.282 bits (1022), Expect = 4.731e-137
Identity = 180/289 (62.28%), Postives = 231/289 (79.93%), Query Frame = 3
Query:  138 AVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWM 1004
            A+L KK ++F  KW +PP   + +  +  IK LGKGAFG+VILVKH  +G  YA K LSK ++IK++Q+ENA+NEK I+AC  FPF+I +  +F+DN+ LY++LEF  GGE+F LLR ++RFP+  VKFY  QV+M  EYLH L+IAYRDLKPEN+L+  DGYLKV D+GFAK+IP++KRT+TLCGTPDYMAPEII NKGY   VDWWAFGVL+YE+ +G PPFM +DQMKTFE IISGK KFT +F  ++KDL+ NL+QVDLS+RFGNL+NGV DI+ H++F EIDW+
Sbjct:   10 AMLEKKKKDFDAKWKSPPTFNSEISHYLPIKALGKGAFGKVILVKHIDSGRLYACKQLSKAQVIKTRQVENAMNEKNIIACCNFPFVIGIGSTFQDNTNLYLLLEFASGGELFGLLRKLKRFPEGWVKFYTCQVLMGLEYLHCLTIAYRDLKPENVLICEDGYLKVADLGFAKLIPREKRTYTLCGTPDYMAPEIIQNKGYSFPVDWWAFGVLIYELISGVPPFMQRDQMKTFERIISGKFKFTENFRPEVKDLVTNLLQVDLSKRFGNLQNGVCDIRNHEFFHEIDWV 298          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Planmine SMEST
Match: SMESG000038292.1 (SMESG000038292.1)

HSP 1 Score: 385.185 bits (988), Expect = 1.494e-129
Identity = 192/350 (54.86%), Postives = 257/350 (73.43%), Query Frame = 3
Query:   45 SLKFKNPLLNSVPSIRQIRNVFM*VSMTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            ++   NP+   V S   I+N+ + +      A L +    F+ KWD P + TA + DFER++TLG G+FGRV+LV+HK    Y A+K+L K +++K KQ+E+ LNEK+IL  I F FL+ L Y FKDNS LYMVLEFV GGEMF+ LR + RF +   +FY AQ+++AFEYLHYL + YRDLKPEN+L++S GY+KV D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FSADLKDL+RNL+QVDL++R+GNLKN V DIK HK+F+  DW+ ++ K+ +AP+ P  KGP D+S FD +EEE
Sbjct:  144 NINIDNPMYLPV-STSCIKNIEINIRDDSVKAFLEEAKRLFVEKWDKPSQNTAQLSDFERLRTLGTGSFGRVMLVQHKVTKEYGAIKILDKQKVVKLKQVEHTLNEKRILQAITFMFLVRLDYHFKDNSNLYMVLEFVNGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYIKVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSADLKDLLRNLLQVDLTKRYGNLKNNVGDIKTHKWFLNCDWITIFKKELEAPFIPNIKGPGDSSNFDDYEEE 490          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Planmine SMEST
Match: SMESG000038292.1 (SMESG000038292.1)

HSP 1 Score: 381.719 bits (979), Expect = 2.836e-127
Identity = 184/310 (59.35%), Postives = 241/310 (77.74%), Query Frame = 3
Query:  165 FLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            F+ KWD P + TA + DFER++TLG G+FGRV+LV+HK    Y A+K+L K +++K KQ+E+ LNEK+IL  I F FL+ L Y FKDNS LYMVLEFV GGEMF+ LR + RF +   +FY AQ+++AFEYLHYL + YRDLKPEN+L++S GY+KV D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FSADLKDL+RNL+QVDL++R+GNLKN V DIK HK+F+  DW+ ++ K+ +AP+ P  KGP D+S FD +EEE
Sbjct:  258 FVEKWDKPSQNTAQLSDFERLRTLGTGSFGRVMLVQHKVTKEYGAIKILDKQKVVKLKQVEHTLNEKRILQAITFMFLVRLDYHFKDNSNLYMVLEFVNGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYIKVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSADLKDLLRNLLQVDLTKRYGNLKNNVGDIKTHKWFLNCDWITIFKKELEAPFIPNIKGPGDSSNFDDYEEE 565          
BLAST of cAMP dependent protein kinase catalytic subunit vs. Planmine SMEST
Match: SMESG000038292.1 (SMESG000038292.1)

HSP 1 Score: 380.948 bits (977), Expect = 2.646e-126
Identity = 184/310 (59.35%), Postives = 241/310 (77.74%), Query Frame = 3
Query:  165 FLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVKHKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFKDNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLSIAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEIIMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTSSFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDXXXXXXXXXXXXXXDDTSCFDKWEEE 1094
            F+ KWD P + TA + DFER++TLG G+FGRV+LV+HK    Y A+K+L K +++K KQ+E+ LNEK+IL  I F FL+ L Y FKDNS LYMVLEFV GGEMF+ LR + RF +   +FY AQ+++AFEYLHYL + YRDLKPEN+L++S GY+KV D GFAK +    RTWTLCGTP+Y+APEII++KGY+ AVDWWA GVL+YEM AG+PPF     ++ +E I+SGKV+F S FSADLKDL+RNL+QVDL++R+GNLKN V DIK HK+F+  DW+ ++ K+ +AP+ P  KGP D+S FD +EEE
Sbjct:  306 FVEKWDKPSQNTAQLSDFERLRTLGTGSFGRVMLVQHKVTKEYGAIKILDKQKVVKLKQVEHTLNEKRILQAITFMFLVRLDYHFKDNSNLYMVLEFVNGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYIKVTDFGFAKRV--KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSADLKDLLRNLLQVDLTKRYGNLKNNVGDIKTHKWFLNCDWITIFKKELEAPFIPNIKGPGDSSNFDDYEEE 613          
The following BLAST results are available for this feature:
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKACA3.151e-13659.13protein kinase cAMP-activated catalytic subunit al... [more]
PRKACA3.151e-13659.13protein kinase cAMP-activated catalytic subunit al... [more]
PRKACB5.735e-13658.59protein kinase cAMP-activated catalytic subunit be... [more]
PRKACB8.901e-13659.62protein kinase cAMP-activated catalytic subunit be... [more]
PRKACB9.831e-13659.08protein kinase cAMP-activated catalytic subunit be... [more]
back to top
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kin-12.495e-13759.88cAMP-dependent protein kinase catalytic subunit [... [more]
kin-13.070e-13757.31cAMP-dependent protein kinase catalytic subunit [... [more]
kin-13.400e-13759.51cAMP-dependent protein kinase catalytic subunit [... [more]
kin-12.527e-13660.57cAMP-dependent protein kinase catalytic subunit [... [more]
kin-13.103e-13660.57cAMP-dependent protein kinase catalytic subunit [... [more]
back to top
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pka-C15.620e-13259.43gene:FBgn0000273 transcript:FBtr0335495[more]
Pka-C15.620e-13259.43gene:FBgn0000273 transcript:FBtr0079852[more]
Pka-C15.620e-13259.43gene:FBgn0000273 transcript:FBtr0079851[more]
Pka-C31.468e-9548.65gene:FBgn0000489 transcript:FBtr0075529[more]
Pka-C31.111e-9448.65gene:FBgn0000489 transcript:FBtr0075528[more]
back to top
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkacbb2.451e-13458.99protein kinase, cAMP-dependent, catalytic, beta b ... [more]
prkacaa5.319e-13458.33protein kinase, cAMP-dependent, catalytic, alpha, ... [more]
prkacab2.004e-13358.33protein kinase, cAMP-dependent, catalytic, alpha, ... [more]
prkacba1.285e-13056.97protein kinase, cAMP-dependent, catalytic, beta a ... [more]
prkacba1.285e-13056.97protein kinase, cAMP-dependent, catalytic, beta a ... [more]
back to top
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ints88.043e-13760.31integrator complex subunit 8 [Source:Xenbase;Acc:X... [more]
prkacb1.019e-13660.25protein kinase cAMP-activated catalytic subunit be... [more]
ints81.756e-13660.88integrator complex subunit 8 [Source:Xenbase;Acc:X... [more]
ints82.271e-13660.88integrator complex subunit 8 [Source:Xenbase;Acc:X... [more]
ints82.478e-13660.88integrator complex subunit 8 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkacb4.805e-13960.00protein kinase, cAMP dependent, catalytic, beta [S... [more]
Prkacb1.464e-13860.57protein kinase, cAMP dependent, catalytic, beta [S... [more]
Prkacb1.491e-13860.57protein kinase, cAMP dependent, catalytic, beta [S... [more]
Prkacb1.494e-13860.57protein kinase, cAMP dependent, catalytic, beta [S... [more]
Prkaca1.878e-13658.77protein kinase, cAMP dependent, catalytic, alpha [... [more]
back to top
BLAST of cAMP dependent protein kinase catalytic subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P68182|KAPCB_RAT1.024e-13760.57cAMP-dependent protein kinase catalytic subunit be... [more]
sp|P68181|KAPCB_MOUSE1.024e-13760.57cAMP-dependent protein kinase catalytic subunit be... [more]
sp|P68180|KAPCB_CRIGR1.024e-13760.57cAMP-dependent protein kinase catalytic subunit be... [more]
sp|P36887|KAPCA_PIG1.657e-13560.25cAMP-dependent protein kinase catalytic subunit al... [more]
sp|P22694|KAPCB_HUMAN4.275e-13559.62cAMP-dependent protein kinase catalytic subunit be... [more]
back to top
BLAST of cAMP dependent protein kinase catalytic subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2L5E26.848e-18074.16Uncharacterized protein OS=Opisthorchis felineus O... [more]
H2KU483.029e-17973.86Protein kinase A OS=Clonorchis sinensis OX=79923 G... [more]
A0A074ZWV65.902e-17973.56Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A1S8X7H31.144e-17873.56Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A504YU126.468e-17873.86cAMP-dependent protein kinase catalytic subunit al... [more]
back to top
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050353.19.471e-13759.94protein kinase cAMP-activated catalytic subunit be... [more]
ENSAMXT00000050990.11.027e-13659.94protein kinase cAMP-activated catalytic subunit be... [more]
ENSAMXT00000056663.13.812e-13659.94protein kinase cAMP-activated catalytic subunit be... [more]
prkacbb8.007e-13659.62cAMP-dependent protein kinase catalytic subunit be... [more]
prkacaa9.652e-13658.64cAMP-dependent protein kinase catalytic subunit al... [more]
back to top
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001814.12.731e-11159.63pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gen... [more]
ENSPMAT00000008480.11.381e-7541.67pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
ENSPMAT00000002200.15.382e-7542.91pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 ... [more]
ENSPMAT00000004852.12.612e-6657.93pep scaffold:Pmarinus_7.0:GL488704:3417:7135:1 gen... [more]
ENSPMAT00000006766.17.172e-6338.24pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
back to top
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK29.814e-10048.01cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK31.946e-9746.31cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK12.341e-9745.64cAMP-dependent protein kinase catalytic subunit; p... [more]
YPK12.654e-6840.45S/T protein kinase; phosphorylates, downregulates ... [more]
YPK25.389e-6640.45Protein kinase similar to S/T protein kinase Ypk1p... [more]
back to top
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352281.486e-9548.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384073.599e-7644.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383999.402e-7545.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378001.131e-6839.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411668.674e-6740.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cAMP dependent protein kinase catalytic subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000007944.27.454e-13659.62protein kinase cAMP-activated catalytic subunit be... [more]
ENSORLT00000028912.12.695e-13559.62protein kinase cAMP-activated catalytic subunit be... [more]
ENSORLT00000033457.14.350e-13559.31cAMP-dependent protein kinase catalytic subunit be... [more]
ENSORLT00000035979.16.471e-13559.31cAMP-dependent protein kinase catalytic subunit be... [more]
prkacaa1.330e-13457.62cAMP-dependent protein kinase catalytic subunit al... [more]
back to top
BLAST of cAMP dependent protein kinase catalytic subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077092.10.000e+0100.00SMESG000077092.1[more]
SMESG000037955.14.731e-13762.28SMESG000037955.1[more]
SMESG000038292.11.494e-12954.86SMESG000038292.1[more]
SMESG000038292.12.836e-12759.35SMESG000038292.1[more]
SMESG000038292.12.646e-12659.35SMESG000038292.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026769 ID=SMED30026769|Name=cAMP dependent protein kinase catalytic subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1393bp
AAACATTTGTAAATTTTCTTTTTGTCAATATATTTTTAAATTAATCTTTA
AAATTTAAAAATCCATTACTAAATAGTGTCCCCTCTATTAGGCAAATTAG
GAATGTATTTATGTAGGTAAGTATGACTGATTTCAATGCAGTATTAATTA
AGAAGCATGAAGAATTTCTGGTGAAATGGGACAATCCGCCAAAGGCAACG
GCAACGATGGAAGATTTTGAGAGGATAAAGACATTGGGAAAAGGAGCTTT
TGGTCGGGTCATTTTGGTCAAACACAAAGCCAATGGAAATTATTATGCTT
TAAAAGTACTGAGTAAATTGGAAATAATAAAAAGCAAACAAATAGAAAAT
GCGTTAAATGAAAAGAAAATCCTTGCTTGCATTGAATTTCCTTTTTTGAT
ATATTTGGCTTACAGTTTCAAAGACAATAGTTATTTATATATGGTTCTTG
AGTTTGTAATTGGAGGTGAGATGTTCACTCTTCTTCGAAACATGAGGCGA
TTTCCAGATAATTTAGTAAAATTTTACGGAGCCCAAGTCATAATGGCATT
TGAATATCTGCACTACTTATCTATTGCCTATCGGGATTTGAAACCAGAAA
ATATCCTTCTGAATTCTGACGGTTACTTGAAAGTTGTTGATATGGGATTC
GCAAAAATGATTCCGAAAGACAAACGAACTTGGACTTTATGCGGTACTCC
AGACTACATGGCTCCGGAAATAATTATGAATAAAGGATATCACTGTGCAG
TTGATTGGTGGGCTTTTGGTGTTTTACTCTATGAAATGACAGCGGGATTT
CCGCCGTTTATGCATCAAGACCAAATGAAAACCTTCGAACACATAATTTC
CGGAAAAGTCAAATTCACTTCGAGTTTCTCGGCGGACTTAAAAGATCTGA
TTAGAAATCTAGTTCAAGTTGATTTAAGTCGACGATTTGGAAACCTGAAA
AATGGTGTTGCTGATATTAAACAACATAAATATTTCATTGAAATTGACTG
GATGGATGTATACGATAAGAAACCGAAAGCTCCATACAAACCCAAGTGCA
AAGGGCCAGATGATACGAGCTGTTTTGACAAATGGGAGGAAGAAACTTTC
AAAATCGCCGACAAAGAAAAGTTTAAAGCAGAATTCGAAGAATTTTAAAT
GTCTAGTATTCAACATTATCAAAAAGTATCTGTTTCTTCTTTTATTAACG
AATATTTCGTTTCAGCGAACACACTTTTCCGTAGCATTTGCTTGGTGAAC
TCAGTACTTAATTATTTAGTATAATTTCTTTTTTCATTTCTTTAAATAAA
TTTTTGATTATTTCATTAAAAGAATTTAGTTCCAAAGTATAAAAACTTTG
AGAGTTCTTAATAAGTTTATAAATTATATATTCCAGCTATCCA
back to top

protein sequence of SMED30026769-orf-1

>SMED30026769-orf-1 ID=SMED30026769-orf-1|Name=SMED30026769-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=342bp
MTDFNAVLIKKHEEFLVKWDNPPKATATMEDFERIKTLGKGAFGRVILVK
HKANGNYYALKVLSKLEIIKSKQIENALNEKKILACIEFPFLIYLAYSFK
DNSYLYMVLEFVIGGEMFTLLRNMRRFPDNLVKFYGAQVIMAFEYLHYLS
IAYRDLKPENILLNSDGYLKVVDMGFAKMIPKDKRTWTLCGTPDYMAPEI
IMNKGYHCAVDWWAFGVLLYEMTAGFPPFMHQDQMKTFEHIISGKVKFTS
SFSADLKDLIRNLVQVDLSRRFGNLKNGVADIKQHKYFIEIDWMDVYDKK
PKAPYKPKCKGPDDTSCFDKWEEETFKIADKEKFKAEFEEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000961AGC-kinase_C
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004674protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000961AGC-kinase, C-terminalSMARTSM00133pkinase_C_6coord: 289..341
e-value: 0.0014
score: 27.9
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 289..341
score: 11.309
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 32..288
e-value: 9.6E-91
score: 317.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 32..288
e-value: 2.5E-67
score: 227.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 32..288
score: 45.714
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 116..313
e-value: 6.2E-117
score: 391.7
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 29..319
e-value: 6.2E-117
score: 391.7
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 17..274
e-value: 3.4E-29
score: 99.4
NoneNo IPR availablePANTHERPTHR24353CYCLIC NUCLEOTIDE-DEPENDENT PROTEIN KINASEcoord: 24..334
NoneNo IPR availablePANTHERPTHR24353:SF117PROTEIN KINASE CAMP-ACTIVATED CATALYTIC SUBUNIT BETAcoord: 24..334
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 38..61
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 151..163
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 21..323