Metastasis-associated protein MTA1

Overview
NameMetastasis-associated protein MTA1
Smed IDSMED30026760
Length (bp)2147
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Metastasis-associated protein MTA1 (SMED30026760) t-SNE clustered cells

Violin plots show distribution of expression levels for Metastasis-associated protein MTA1 (SMED30026760) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Metastasis-associated protein MTA1 (SMED30026760) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Metastasis-associated protein MTA1 (SMED30026760) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026760

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026760SMESG000081507.1 SmedASXL_005211SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026760SMESG000081507.1 SmedASXL_005211SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30026760SMESG000081507.1 dd_Smed_v4_5860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026760SMESG000081507.1 dd_Smed_v4_5860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026760SMESG000081507.1 dd_Smed_v4_5860_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026760SMESG000081507.1 Contig48142newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026760SMESG000081507.1 Contig48142uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Human
Match: MTA3 (metastasis associated 1 family member 3 [Source:HGNC Symbol;Acc:HGNC:23784])

HSP 1 Score: 442.195 bits (1136), Expect = 7.895e-148
Identity = 215/424 (50.71%), Postives = 293/424 (69.10%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK-----ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAA--------NPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQ 1250
            + NMYRVGD+VYFE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+SN+L+ +ADK     E  S+  + + LT++Q H LKHRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD   KT+ + KG IR+G +YQ ++P    E ++   ++   E  +W+PN+ +++ +I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + + +Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y+KPNP  + T     G ++ A        NP     CESC +  S QW++WGPPN+ C+LC  CW YWK+YGGLK PT+ + +
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKEIEEESETTVEADLTDKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSLKTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHSYDLSSAISVLVPLGGPVLCRDEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQISTSNGKPGAVNGAVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCAICWLYWKKYGGLKMPTQSEEE 425          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Human
Match: MTA3 (metastasis associated 1 family member 3 [Source:HGNC Symbol;Acc:HGNC:23784])

HSP 1 Score: 442.58 bits (1137), Expect = 7.254e-147
Identity = 215/424 (50.71%), Postives = 293/424 (69.10%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK-----ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAA--------NPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQ 1250
            + NMYRVGD+VYFE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+SN+L+ +ADK     E  S+  + + LT++Q H LKHRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD   KT+ + KG IR+G +YQ ++P    E ++   ++   E  +W+PN+ +++ +I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + + +Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y+KPNP  + T     G ++ A        NP     CESC +  S QW++WGPPN+ C+LC  CW YWK+YGGLK PT+ + +
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKEIEEESETTVEADLTDKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSLKTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHSYDLSSAISVLVPLGGPVLCRDEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQISTSNGKPGAVNGAVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCAICWLYWKKYGGLKMPTQSEEE 425          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Human
Match: MTA3 (metastasis associated 1 family member 3 [Source:HGNC Symbol;Acc:HGNC:23784])

HSP 1 Score: 436.802 bits (1122), Expect = 9.306e-146
Identity = 215/424 (50.71%), Postives = 292/424 (68.87%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK-----ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAA--------NPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQ 1250
            + NMYRVGD+VYFE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+SN+L+ +ADK     E  S+  + + LT++Q H LKHRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD   KT+ + KG IR+G +YQ ++P    E ++   ++   E  +W+PN+ +++ +I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + + +Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y KPNP  + T     G ++ A        NP     CESC +  S QW++WGPPN+ C+LC  CW YWK+YGGLK PT+ + +
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKEIEEESETTVEADLTDKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSLKTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHSYDLSSAISVLVPLGGPVLCRDEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTY-KPNPNQISTSNGKPGAVNGAVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCAICWLYWKKYGGLKMPTQSEEE 424          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Human
Match: MTA3 (metastasis associated 1 family member 3 [Source:HGNC Symbol;Acc:HGNC:23784])

HSP 1 Score: 437.573 bits (1124), Expect = 6.288e-145
Identity = 215/424 (50.71%), Postives = 292/424 (68.87%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK-----ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAA--------NPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQ 1250
            + NMYRVGD+VYFE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+SN+L+ +ADK     E  S+  + + LT++Q H LKHRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD   KT+ + KG IR+G +YQ ++P    E ++   ++   E  +W+PN+ +++ +I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + + +Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y KPNP  + T     G ++ A        NP     CESC +  S QW++WGPPN+ C+LC  CW YWK+YGGLK PT+ + +
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKEIEEESETTVEADLTDKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSLKTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHSYDLSSAISVLVPLGGPVLCRDEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTY-KPNPNQISTSNGKPGAVNGAVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCAICWLYWKKYGGLKMPTQSEEE 424          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Human
Match: MTA2 (metastasis associated 1 family member 2 [Source:HGNC Symbol;Acc:HGNC:7411])

HSP 1 Score: 435.261 bits (1118), Expect = 5.599e-143
Identity = 208/408 (50.98%), Postives = 286/408 (70.10%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNS--QENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNP-AVLFTGL---LSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTR 1238
            + NMYRVGD+VYFE S+  PY +R+IEELNKT  G VEAKVVC +RRRD+S+SL  +AD       +E+    ++E+Q H LKHRELF++RQ E+LPATHIRGK  VT  N+ +++  Y   E+ FFY+LV+D VQKT+ + +G IR+G +YQ  +P +  E ++ N  ++  E  +W+P+N +++ +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  ++  G    ++ A  Q    CESC +  S QW+AWGPPN+ C+LC +CW YWK+YGGLK PT+
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQ 409          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Celegans
Match: lin-40 (pep chromosome:WBcel235:V:3704995:3710124:1 gene:WBGene00003025.1 transcript:T27C4.4d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-40)

HSP 1 Score: 149.828 bits (377), Expect = 3.256e-37
Identity = 88/261 (33.72%), Postives = 135/261 (51.72%), Query Frame = 3
Query:  546 ETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTP----------------------GGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCEN-------EHKLKQVYIPNYTKPNPAVLF------TGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGL 1223
            E L+W P++ +++ +I+ ++ + RS+G +AR++D  S+ + P L  A A A+RD+T+  A+  + QANY    AV +L P                      GG + L RD++E+WS  E  LFE+ L K GK F+ I  ++LPWKS + +VE+YY+ K S  Y   K+ K           + K   +YIP + KP  A +       T L++  NP  N     CG+L +  W+ WG       LC TCW  WK++ GL
Sbjct:  370 EVLVWHPHHALTDRDIDQYMIVARSVGLFARAIDGASAPKLPTLQLAAAFASRDVTIFHAHAILHQANYDVGQAVKYLVPVASRDTYPCQVDDSSGLQTKTLGGPI-LCRDQLEEWSTPEMNLFEDALDKVGKDFNEIRAEYLPWKSIRDIVEYYYLMKASNRYTDRKKNKPSAGGGSSTTTDEKFTNIYIPPFNKPIAASILPYNTSQTTLMNNDNPCEN-----CGTLDALNWYQWGGVGDKKVLCSTCWIQWKKFAGL 624          

HSP 2 Score: 78.5666 bits (192), Expect = 8.509e-15
Identity = 38/86 (44.19%), Postives = 54/86 (62.79%), Query Frame = 3
Query:  237 MSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNV 494
            +  LT +Q   L+  E+F+TRQ E LPA  IRGK RV    D E   NY   ++TF+++LVYD   +T+ + KG+IR+G +YQ  V
Sbjct:  206 VDKLTPDQRLKLRQHEIFMTRQSEILPAAAIRGKCRVVLLGDGEEAQNYLPLDDTFYHSLVYDPNAQTLLADKGAIRVGEKYQAVV 291          

HSP 3 Score: 71.2478 bits (173), Expect = 1.703e-12
Identity = 34/65 (52.31%), Postives = 45/65 (69.23%), Query Frame = 3
Query:   45 YRVGDFVYFETSAG--APYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNSQEN 233
            Y VGDFVYF+ ++   APYQIRKIEEL KT  G V+A+ V + RRRD+   LL++AD+     +N
Sbjct:   15 YAVGDFVYFDDTSATDAPYQIRKIEELVKTEKGGVDARCVVYLRRRDIPQHLLKIADQAQRRFDN 79          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Celegans
Match: lin-40 (pep chromosome:WBcel235:V:3704988:3712796:1 gene:WBGene00003025.1 transcript:T27C4.4b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-40)

HSP 1 Score: 149.828 bits (377), Expect = 3.285e-37
Identity = 88/261 (33.72%), Postives = 135/261 (51.72%), Query Frame = 3
Query:  546 ETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTP----------------------GGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCEN-------EHKLKQVYIPNYTKPNPAVLF------TGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGL 1223
            E L+W P++ +++ +I+ ++ + RS+G +AR++D  S+ + P L  A A A+RD+T+  A+  + QANY    AV +L P                      GG + L RD++E+WS  E  LFE+ L K GK F+ I  ++LPWKS + +VE+YY+ K S  Y   K+ K           + K   +YIP + KP  A +       T L++  NP  N     CG+L +  W+ WG       LC TCW  WK++ GL
Sbjct:  370 EVLVWHPHHALTDRDIDQYMIVARSVGLFARAIDGASAPKLPTLQLAAAFASRDVTIFHAHAILHQANYDVGQAVKYLVPVASRDTYPCQVDDSSGLQTKTLGGPI-LCRDQLEEWSTPEMNLFEDALDKVGKDFNEIRAEYLPWKSIRDIVEYYYLMKASNRYTDRKKNKPSAGGGSSTTTDEKFTNIYIPPFNKPIAASILPYNTSQTTLMNNDNPCEN-----CGTLDALNWYQWGGVGDKKVLCSTCWIQWKKFAGL 624          

HSP 2 Score: 78.5666 bits (192), Expect = 8.959e-15
Identity = 38/86 (44.19%), Postives = 54/86 (62.79%), Query Frame = 3
Query:  237 MSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNV 494
            +  LT +Q   L+  E+F+TRQ E LPA  IRGK RV    D E   NY   ++TF+++LVYD   +T+ + KG+IR+G +YQ  V
Sbjct:  206 VDKLTPDQRLKLRQHEIFMTRQSEILPAAAIRGKCRVVLLGDGEEAQNYLPLDDTFYHSLVYDPNAQTLLADKGAIRVGEKYQAVV 291          

HSP 3 Score: 71.2478 bits (173), Expect = 1.793e-12
Identity = 34/65 (52.31%), Postives = 45/65 (69.23%), Query Frame = 3
Query:   45 YRVGDFVYFETSAG--APYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNSQEN 233
            Y VGDFVYF+ ++   APYQIRKIEEL KT  G V+A+ V + RRRD+   LL++AD+     +N
Sbjct:   15 YAVGDFVYFDDTSATDAPYQIRKIEELVKTEKGGVDARCVVYLRRRDIPQHLLKIADQAQRRFDN 79          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Celegans
Match: lin-40 (pep chromosome:WBcel235:V:3704995:3712771:1 gene:WBGene00003025.1 transcript:T27C4.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-40)

HSP 1 Score: 149.828 bits (377), Expect = 3.285e-37
Identity = 88/261 (33.72%), Postives = 135/261 (51.72%), Query Frame = 3
Query:  546 ETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTP----------------------GGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCEN-------EHKLKQVYIPNYTKPNPAVLF------TGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGL 1223
            E L+W P++ +++ +I+ ++ + RS+G +AR++D  S+ + P L  A A A+RD+T+  A+  + QANY    AV +L P                      GG + L RD++E+WS  E  LFE+ L K GK F+ I  ++LPWKS + +VE+YY+ K S  Y   K+ K           + K   +YIP + KP  A +       T L++  NP  N     CG+L +  W+ WG       LC TCW  WK++ GL
Sbjct:  370 EVLVWHPHHALTDRDIDQYMIVARSVGLFARAIDGASAPKLPTLQLAAAFASRDVTIFHAHAILHQANYDVGQAVKYLVPVASRDTYPCQVDDSSGLQTKTLGGPI-LCRDQLEEWSTPEMNLFEDALDKVGKDFNEIRAEYLPWKSIRDIVEYYYLMKASNRYTDRKKNKPSAGGGSSTTTDEKFTNIYIPPFNKPIAASILPYNTSQTTLMNNDNPCEN-----CGTLDALNWYQWGGVGDKKVLCSTCWIQWKKFAGL 624          

HSP 2 Score: 78.5666 bits (192), Expect = 8.959e-15
Identity = 38/86 (44.19%), Postives = 54/86 (62.79%), Query Frame = 3
Query:  237 MSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNV 494
            +  LT +Q   L+  E+F+TRQ E LPA  IRGK RV    D E   NY   ++TF+++LVYD   +T+ + KG+IR+G +YQ  V
Sbjct:  206 VDKLTPDQRLKLRQHEIFMTRQSEILPAAAIRGKCRVVLLGDGEEAQNYLPLDDTFYHSLVYDPNAQTLLADKGAIRVGEKYQAVV 291          

HSP 3 Score: 71.2478 bits (173), Expect = 1.793e-12
Identity = 34/65 (52.31%), Postives = 45/65 (69.23%), Query Frame = 3
Query:   45 YRVGDFVYFETSAG--APYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNSQEN 233
            Y VGDFVYF+ ++   APYQIRKIEEL KT  G V+A+ V + RRRD+   LL++AD+     +N
Sbjct:   15 YAVGDFVYFDDTSATDAPYQIRKIEELVKTEKGGVDARCVVYLRRRDIPQHLLKIADQAQRRFDN 79          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Celegans
Match: lin-40 (pep chromosome:WBcel235:V:3705545:3712771:1 gene:WBGene00003025.1 transcript:T27C4.4e.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-40)

HSP 1 Score: 149.058 bits (375), Expect = 3.411e-37
Identity = 88/261 (33.72%), Postives = 135/261 (51.72%), Query Frame = 3
Query:  546 ETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTP----------------------GGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCEN-------EHKLKQVYIPNYTKPNPAVLF------TGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGL 1223
            E L+W P++ +++ +I+ ++ + RS+G +AR++D  S+ + P L  A A A+RD+T+  A+  + QANY    AV +L P                      GG + L RD++E+WS  E  LFE+ L K GK F+ I  ++LPWKS + +VE+YY+ K S  Y   K+ K           + K   +YIP + KP  A +       T L++  NP  N     CG+L +  W+ WG       LC TCW  WK++ GL
Sbjct:  235 EVLVWHPHHALTDRDIDQYMIVARSVGLFARAIDGASAPKLPTLQLAAAFASRDVTIFHAHAILHQANYDVGQAVKYLVPVASRDTYPCQVDDSSGLQTKTLGGPI-LCRDQLEEWSTPEMNLFEDALDKVGKDFNEIRAEYLPWKSIRDIVEYYYLMKASNRYTDRKKNKPSAGGGSSTTTDEKFTNIYIPPFNKPIAASILPYNTSQTTLMNNDNPCEN-----CGTLDALNWYQWGGVGDKKVLCSTCWIQWKKFAGL 489          

HSP 2 Score: 78.9518 bits (193), Expect = 6.235e-15
Identity = 38/83 (45.78%), Postives = 53/83 (63.86%), Query Frame = 3
Query:  246 LTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNV 494
            LT +Q   L+  E+F+TRQ E LPA  IRGK RV    D E   NY   ++TF+++LVYD   +T+ + KG+IR+G +YQ  V
Sbjct:   74 LTPDQRLKLRQHEIFMTRQSEILPAAAIRGKCRVVLLGDGEEAQNYLPLDDTFYHSLVYDPNAQTLLADKGAIRVGEKYQAVV 156          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Celegans
Match: lin-40 (pep chromosome:WBcel235:V:3705545:3712796:1 gene:WBGene00003025.1 transcript:T27C4.4e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-40)

HSP 1 Score: 149.058 bits (375), Expect = 3.411e-37
Identity = 88/261 (33.72%), Postives = 135/261 (51.72%), Query Frame = 3
Query:  546 ETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTP----------------------GGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCEN-------EHKLKQVYIPNYTKPNPAVLF------TGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGL 1223
            E L+W P++ +++ +I+ ++ + RS+G +AR++D  S+ + P L  A A A+RD+T+  A+  + QANY    AV +L P                      GG + L RD++E+WS  E  LFE+ L K GK F+ I  ++LPWKS + +VE+YY+ K S  Y   K+ K           + K   +YIP + KP  A +       T L++  NP  N     CG+L +  W+ WG       LC TCW  WK++ GL
Sbjct:  235 EVLVWHPHHALTDRDIDQYMIVARSVGLFARAIDGASAPKLPTLQLAAAFASRDVTIFHAHAILHQANYDVGQAVKYLVPVASRDTYPCQVDDSSGLQTKTLGGPI-LCRDQLEEWSTPEMNLFEDALDKVGKDFNEIRAEYLPWKSIRDIVEYYYLMKASNRYTDRKKNKPSAGGGSSTTTDEKFTNIYIPPFNKPIAASILPYNTSQTTLMNNDNPCEN-----CGTLDALNWYQWGGVGDKKVLCSTCWIQWKKFAGL 489          

HSP 2 Score: 78.9518 bits (193), Expect = 6.235e-15
Identity = 38/83 (45.78%), Postives = 53/83 (63.86%), Query Frame = 3
Query:  246 LTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNV 494
            LT +Q   L+  E+F+TRQ E LPA  IRGK RV    D E   NY   ++TF+++LVYD   +T+ + KG+IR+G +YQ  V
Sbjct:   74 LTPDQRLKLRQHEIFMTRQSEILPAAAIRGKCRVVLLGDGEEAQNYLPLDDTFYHSLVYDPNAQTLLADKGAIRVGEKYQAVV 156          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Fly
Match: MTA1-like (gene:FBgn0027951 transcript:FBtr0078734)

HSP 1 Score: 365.54 bits (937), Expect = 1.282e-114
Identity = 208/546 (38.10%), Postives = 297/546 (54.40%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMA-------DKENNSQENLMS--------------------------------------------TLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNY----------TKPNPAVLFTGLLSAANPQTNXXX-XXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVTA-------------------HLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDS 1427
            + NMYRVGD+VY ET+  +PY IR+IEELNK  TG VEAKV+CFYRRRDL N L+Q+A       D+E  S                                                   LT +Q + +KHRELF++RQ+E++PAT IRGK  VT  N+ E + +Y N ++TFFY LV+D  QKT+ + KG IR+GS+YQ ++P +  +    + K    E+L+W P + +++ +I+ F+ + RS+GT+AR+LD +SSV+QP+L  + AAA+RDITL  A N + +  Y  E+++S L P     L RDE+EDWSA+E  LFEE L KYGK F+ I  DFLPWK+ K+++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y          TK    +       + +  +N    ESCG+  S QW +    +   +LC +CW YW+RYG +K+ T+ D    + +  S  +  + T  +    T                     L++C  + C K F+    L  H    H   + S
Sbjct:    2 ATNMYRVGDYVYVETTPNSPYLIRRIEELNKNQTGNVEAKVMCFYRRRDLPNPLVQLADKHQPALDEERTSPTQTSGGGGSATGNSGSNSSGTSNNNSSSTAIGGGAGGSGGAGGDAEKGEALTSKQRYQIKHRELFLSRQVESIPATQIRGKCSVTLLNETESLQSYLNKDDTFFYCLVFDPNQKTLLADKGEIRVGSRYQCDIPAKLKDTATDDRKLEELESLVWTPEHSLTDRKIDQFLVVSRSIGTFARALDCSSSVKQPSLHMSAAAASRDITLFHAMNILHKHEYSIEESMSSLVPSTGPVLCRDEIEDWSASEANLFEEALEKYGKDFNDIRQDFLPWKTLKQIIEYYYMWKTTDRYVQQKRVKAVEAELKLKQVYIPQYNNNGKGNGTSTKAGGGIYNGTTNGSTDLSSNGKPCESCGTTKSSQWNSVSSGHSTSRLCLSCWEYWRRYGSMKSATKGDAGEGDAKKKSSSAASTPTATLAGLATTPTAVVDLNDDEKISDLTNRQLHRCSIVNCGKEFKLKTHLARHYAQAHGIAISS 547          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Fly
Match: MTA1-like (gene:FBgn0027951 transcript:FBtr0290206)

HSP 1 Score: 352.058 bits (902), Expect = 2.047e-109
Identity = 203/539 (37.66%), Postives = 294/539 (54.55%), Query Frame = 3
Query:   57 DFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMA-------DKENNSQENLMS--------------------------------------------TLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNY----------TKPNPAVLFTGLLSAANPQTNXXX--XXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVTA-------------------HLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDS 1427
            D+VY ET+  +PY IR+IEELNK  TG VEAKV+CFYRRRDL N L+Q+A       D+E  S                                                   LT +Q + +KHRELF++RQ+E++PAT IRGK  VT  N+ E + +Y N ++TFFY LV+D  QKT+ + KG IR+GS+YQ ++P +  +    + K    E+L+W P + +++ +I+ F+ + RS+GT+AR+LD +SSV+QP+L  + AAA+RDITL  A N + +  Y  E+++S L P     L RDE+EDWSA+E  LFEE L KYGK F+ I  DFLPWK+ K+++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y          TK    + + G  + +   +++G   ESCG+  S QW +    +   +LC +CW YW+RYG +K+ T+ D    + +  S  +  + T  +    T                     L++C  + C K F+    L  H    H   + S
Sbjct:   19 DYVYVETTPNSPYLIRRIEELNKNQTGNVEAKVMCFYRRRDLPNPLVQLADKHQPALDEERTSPTQTSGGGGSATGNSGSNSSGTSNNNSSSTAIGGGAGGSGGAGGDAEKGEALTSKQRYQIKHRELFLSRQVESIPATQIRGKCSVTLLNETESLQSYLNKDDTFFYCLVFDPNQKTLLADKGEIRVGSRYQCDIPAKLKDTATDDRKLEELESLVWTPEHSLTDRKIDQFLVVSRSIGTFARALDCSSSVKQPSLHMSAAAASRDITLFHAMNILHKHEYSIEESMSSLVPSTGPVLCRDEIEDWSASEANLFEEALEKYGKDFNDIRQDFLPWKTLKQIIEYYYMWKTTDRYVQQKRVKAVEAELKLKQVYIPQYNNNGKGNGTSTKAGGGI-YNGTTNGSTDLSSNGKPCESCGTTKSSQWNSVSSGHSTSRLCLSCWEYWRRYGSMKSATKGDAGEGDAKKKSSSAASTPTATLAGLATTPTAVVDLNDDEKISDLTNRQLHRCSIVNCGKEFKLKTHLARHYAQAHGIAISS 556          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Fly
Match: MTA1-like (gene:FBgn0027951 transcript:FBtr0078733)

HSP 1 Score: 304.294 bits (778), Expect = 3.757e-91
Identity = 166/426 (38.97%), Postives = 249/426 (58.45%), Query Frame = 3
Query:  243 TLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNY----------TKPNPAVLFTGLLSAANPQTNXXX--XXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVTA-------------------HLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDS 1427
             LT +Q + +KHRELF++RQ+E++PAT IRGK  VT  N+ E + +Y N ++TFFY LV+D  QKT+ + KG IR+GS+YQ ++P +  +    + K    E+L+W P + +++ +I+ F+ + RS+GT+AR+LD +SSV+QP+L  + AAA+RDITL  A N + +  Y  E+++S L P     L RDE+EDWSA+E  LFEE L KYGK F+ I  DFLPWK+ K+++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y          TK    + + G  + +   +++G   ESCG+  S QW +    +   +LC +CW YW+RYG +K+ T+ D    + +  S  +  + T  +    T                     L++C  + C K F+    L  H    H   + S
Sbjct:  159 ALTSKQRYQIKHRELFLSRQVESIPATQIRGKCSVTLLNETESLQSYLNKDDTFFYCLVFDPNQKTLLADKGEIRVGSRYQCDIPAKLKDTATDDRKLEELESLVWTPEHSLTDRKIDQFLVVSRSIGTFARALDCSSSVKQPSLHMSAAAASRDITLFHAMNILHKHEYSIEESMSSLVPSTGPVLCRDEIEDWSASEANLFEEALEKYGKDFNDIRQDFLPWKTLKQIIEYYYMWKTTDRYVQQKRVKAVEAELKLKQVYIPQYNNNGKGNGTSTKAGGGI-YNGTTNGSTDLSSNGKPCESCGTTKSSQWNSVSSGHSTSRLCLSCWEYWRRYGSMKSATKGDAGEGDAKKKSSSAASTPTATLAGLATTPTAVVDLNDDEKISDLTNRQLHRCSIVNCGKEFKLKTHLARHYAQAHGIAISS 583          

HSP 2 Score: 95.5153 bits (236), Expect = 6.639e-20
Identity = 42/60 (70.00%), Postives = 50/60 (83.33%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK 212
            + NMYRVGD+VY ET+  +PY IR+IEELNK  TG VEAKV+CFYRRRDL N L+Q+ADK
Sbjct:    2 ATNMYRVGDYVYVETTPNSPYLIRRIEELNKNQTGNVEAKVMCFYRRRDLPNPLVQLADK 61          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Fly
Match: MTA1-like (gene:FBgn0027951 transcript:FBtr0330315)

HSP 1 Score: 304.294 bits (778), Expect = 7.394e-91
Identity = 166/426 (38.97%), Postives = 249/426 (58.45%), Query Frame = 3
Query:  243 TLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNY----------TKPNPAVLFTGLLSAANPQTNXXX--XXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVTA-------------------HLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDS 1427
             LT +Q + +KHRELF++RQ+E++PAT IRGK  VT  N+ E + +Y N ++TFFY LV+D  QKT+ + KG IR+GS+YQ ++P +  +    + K    E+L+W P + +++ +I+ F+ + RS+GT+AR+LD +SSV+QP+L  + AAA+RDITL  A N + +  Y  E+++S L P     L RDE+EDWSA+E  LFEE L KYGK F+ I  DFLPWK+ K+++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y          TK    + + G  + +   +++G   ESCG+  S QW +    +   +LC +CW YW+RYG +K+ T+ D    + +  S  +  + T  +    T                     L++C  + C K F+    L  H    H   + S
Sbjct:  159 ALTSKQRYQIKHRELFLSRQVESIPATQIRGKCSVTLLNETESLQSYLNKDDTFFYCLVFDPNQKTLLADKGEIRVGSRYQCDIPAKLKDTATDDRKLEELESLVWTPEHSLTDRKIDQFLVVSRSIGTFARALDCSSSVKQPSLHMSAAAASRDITLFHAMNILHKHEYSIEESMSSLVPSTGPVLCRDEIEDWSASEANLFEEALEKYGKDFNDIRQDFLPWKTLKQIIEYYYMWKTTDRYVQQKRVKAVEAELKLKQVYIPQYNNNGKGNGTSTKAGGGI-YNGTTNGSTDLSSNGKPCESCGTTKSSQWNSVSSGHSTSRLCLSCWEYWRRYGSMKSATKGDAGEGDAKKKSSSAASTPTATLAGLATTPTAVVDLNDDEKISDLTNRQLHRCSIVNCGKEFKLKTHLARHYAQAHGIAISS 583          

HSP 2 Score: 95.5153 bits (236), Expect = 6.044e-20
Identity = 42/60 (70.00%), Postives = 50/60 (83.33%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK 212
            + NMYRVGD+VY ET+  +PY IR+IEELNK  TG VEAKV+CFYRRRDL N L+Q+ADK
Sbjct:    2 ATNMYRVGDYVYVETTPNSPYLIRRIEELNKNQTGNVEAKVMCFYRRRDLPNPLVQLADK 61          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Fly
Match: Gug (gene:FBgn0010825 transcript:FBtr0333048)

HSP 1 Score: 60.8474 bits (146), Expect = 4.303e-9
Identity = 51/181 (28.18%), Postives = 83/181 (45.86%), Query Frame = 3
Query:  447 SGKGSIRIGSQYQVNVPRQ---ASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSL-TLVRDEM-----EDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTS 962
            S +G IR+G  +Q  +P     +S   +     R  E   W P   +++ ++  F+   RS+  +    D         L     AA+RD T   A + +  + Y          PG +L  LV+  +     + W+ +E K F +GL ++GK+F  I+ D LP K   +LVEFYY+WK +
Sbjct:    4 STQGEIRVGPGHQAKLPDYNPISSFPIDKETDERELEESRWSPG-VVADGDLLMFLRAARSMAAFQGMCD-------GGLEDGCLAASRDDTTINALDVLHDSGY---------DPGKALQALVKCPVSKGIDKKWTEDETKKFIKGLRQFGKNFFRIHKDLLPHKDTPELVEFYYLWKKT 167          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Zebrafish
Match: mta2 (metastasis associated 1 family, member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-4803])

HSP 1 Score: 444.121 bits (1141), Expect = 4.263e-147
Identity = 212/424 (50.00%), Postives = 293/424 (69.10%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK--ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQS 1283
            + NMYRVGD+VYFE S+  PY IR+IEELNKT  G VEAKVVC +RRRD+S SL  +AD    +  +E+   + +E+Q H LKHRELF++RQ E+LPATHIRGK  VT  N+ +++  Y   E+ FFY+LV+D VQKT+ + +G IR+GS+YQ  +P + +E++  +  +   ET +W+PNN++ + +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  +       G+  A   Q    CESC +  S QW+AWGPPN+ C+LC +CW YWK+YGGLK PT+ +  ++    ++P+ 
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCLFRRRDISASLNTLADSNARDFEEESKQPSTSEQQKHQLKHRELFLSRQFESLPATHIRGKCNVTLLNETDVLTGYLEREDCFFYSLVFDPVQKTLLADQGEIRVGSKYQAEIPDKLAEVEADSRVQEKLETKVWDPNNQLKDPQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQKNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASVVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQITAPGNKPGMNGATGYQKGLSCESCHTAQSQQWYAWGPPNMQCRLCSSCWIYWKKYGGLKTPTQLEGATRASSEAAPRG 425          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Zebrafish
Match: mta2 (metastasis associated 1 family, member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-4803])

HSP 1 Score: 444.506 bits (1142), Expect = 6.738e-147
Identity = 212/425 (49.88%), Postives = 294/425 (69.18%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK--ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSN 1286
            + NMYRVGD+VYFE S+  PY IR+IEELNKT  G VEAKVVC +RRRD+S SL  +AD    +  +E+   + +E+Q H LKHRELF++RQ E+LPATHIRGK  VT  N+ +++  Y   E+ FFY+LV+D VQKT+ + +G IR+GS+YQ  +P + +E++  +  +   ET +W+PNN++ + +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  +       G+  A   Q    CESC +  S QW+AWGPPN+ C+LC +CW YWK+YGGLK PT+ +  ++    ++P+ +
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCLFRRRDISASLNTLADSNARDFEEESKQPSTSEQQKHQLKHRELFLSRQFESLPATHIRGKCNVTLLNETDVLTGYLEREDCFFYSLVFDPVQKTLLADQGEIRVGSKYQAEIPDKLAEVEADSRVQEKLETKVWDPNNQLKDPQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQKNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASVVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQITAPGNKPGMNGATGYQKGLSCESCHTAQSQQWYAWGPPNMQCRLCSSCWIYWKKYGGLKTPTQLEGATRASSEAAPRGH 426          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Zebrafish
Match: mta3 (metastasis associated 1 family, member 3 [Source:ZFIN;Acc:ZDB-GENE-030131-6485])

HSP 1 Score: 435.647 bits (1119), Expect = 2.209e-145
Identity = 219/440 (49.77%), Postives = 291/440 (66.14%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNS-----QENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNP---------------AVLFTGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHS 1292
            + NMYRVGD+V+FE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+S SL+Q+ADK         +    S LTE+Q H L+HRELF++RQ E+LPATHIRGK  V   N+ E++L+Y   E+TFFY+LVYD  QKT+ + KG IR+G ++Q +VP    E +  +  +   E  MW+P   ++N++I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + +  Y    A+S L P G   L RDEME+WS++E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y KPNP               A   TG    A       CESC ++ S QW++WGPPN+ C+LC +CW YWK+YGGLK P+R +  ++E    SP  N S
Sbjct:    2 AANMYRVGDYVFFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISQSLIQLADKHAKDLEEEKESPPESDLTEKQKHQLRHRELFLSRQYESLPATHIRGKCSVALLNETEVVLSYLEKEDTFFYSLVYDPTQKTLLADKGEIRVGPRFQADVPEMLQEGEADDRDQSKLEMKMWDPECPLTNKQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHRHGYDLSSALSVLVPQGGPVLCRDEMEEWSSSEANLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYNKPNPNQISVSNGKMATVNGAAAGTGSFHTAG--GGRACESCFAVQSAQWYSWGPPNMQCRLCVSCWMYWKKYGGLKMPSRAE-GAEEKTPPSPAPNES 438          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Zebrafish
Match: mta3 (metastasis associated 1 family, member 3 [Source:ZFIN;Acc:ZDB-GENE-030131-6485])

HSP 1 Score: 435.647 bits (1119), Expect = 2.209e-145
Identity = 219/440 (49.77%), Postives = 291/440 (66.14%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNS-----QENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNP---------------AVLFTGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHS 1292
            + NMYRVGD+V+FE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+S SL+Q+ADK         +    S LTE+Q H L+HRELF++RQ E+LPATHIRGK  V   N+ E++L+Y   E+TFFY+LVYD  QKT+ + KG IR+G ++Q +VP    E +  +  +   E  MW+P   ++N++I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + +  Y    A+S L P G   L RDEME+WS++E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y KPNP               A   TG    A       CESC ++ S QW++WGPPN+ C+LC +CW YWK+YGGLK P+R +  ++E    SP  N S
Sbjct:    2 AANMYRVGDYVFFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISQSLIQLADKHAKDLEEEKESPPESDLTEKQKHQLRHRELFLSRQYESLPATHIRGKCSVALLNETEVVLSYLEKEDTFFYSLVYDPTQKTLLADKGEIRVGPRFQADVPEMLQEGEADDRDQSKLEMKMWDPECPLTNKQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHRHGYDLSSALSVLVPQGGPVLCRDEMEEWSSSEANLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYNKPNPNQISVSNGKMATVNGAAAGTGSFHTAG--GGRACESCFAVQSAQWYSWGPPNMQCRLCVSCWMYWKKYGGLKMPSRAE-GAEEKTPPSPAPNES 438          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Zebrafish
Match: mta3 (metastasis associated 1 family, member 3 [Source:ZFIN;Acc:ZDB-GENE-030131-6485])

HSP 1 Score: 436.417 bits (1121), Expect = 4.156e-143
Identity = 219/440 (49.77%), Postives = 291/440 (66.14%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNS-----QENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNP---------------AVLFTGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHS 1292
            + NMYRVGD+V+FE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+S SL+Q+ADK         +    S LTE+Q H L+HRELF++RQ E+LPATHIRGK  V   N+ E++L+Y   E+TFFY+LVYD  QKT+ + KG IR+G ++Q +VP    E +  +  +   E  MW+P   ++N++I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + +  Y    A+S L P G   L RDEME+WS++E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y KPNP               A   TG    A       CESC ++ S QW++WGPPN+ C+LC +CW YWK+YGGLK P+R +  ++E    SP  N S
Sbjct:    2 AANMYRVGDYVFFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISQSLIQLADKHAKDLEEEKESPPESDLTEKQKHQLRHRELFLSRQYESLPATHIRGKCSVALLNETEVVLSYLEKEDTFFYSLVYDPTQKTLLADKGEIRVGPRFQADVPEMLQEGEADDRDQSKLEMKMWDPECPLTNKQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHRHGYDLSSALSVLVPQGGPVLCRDEMEEWSSSEANLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYNKPNPNQISVSNGKMATVNGAAAGTGSFHTAG--GGRACESCFAVQSAQWYSWGPPNMQCRLCVSCWMYWKKYGGLKMPSRAE-GAEEKTPPSPAPNES 438          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Xenopus
Match: gemin6 (gem nuclear organelle associated protein 6 [Source:Xenbase;Acc:XB-GENE-951468])

HSP 1 Score: 436.802 bits (1122), Expect = 1.942e-142
Identity = 214/411 (52.07%), Postives = 286/411 (69.59%), Query Frame = 3
Query:   24 QMASNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNS--QENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNP-AVLFTGL---LSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTR 1238
            +MA+N MYRVGD+VYFE S+  PY IR+IEELNKT  G VEAKVVC +RRRD+S+SL  +AD        E+   T+ E   H LKHRELF++RQ E+LPATHIRGK  VT  N+ +++  Y   E+ FFY+LV+D VQKT+ + +G IR+GS+YQ  +P Q +E +  N  ++  E  +W+P N +++ +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  ++  G    L+ A  Q    CESC +  S QW+AWGPPN+ C+LC +CW YWK+YGGLK PT+
Sbjct:   91 KMAAN-MYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEDESKQPTVGETHRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGSKYQAEIPDQLAEGEPDNRNQQKMEIKVWDPENPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLARAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGLNGAGFQKGLTCESCHTTVSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQ 500          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Xenopus
Match: gemin6 (gem nuclear organelle associated protein 6 [Source:Xenbase;Acc:XB-GENE-951468])

HSP 1 Score: 422.165 bits (1084), Expect = 5.280e-140
Identity = 208/418 (49.76%), Postives = 284/418 (67.94%), Query Frame = 3
Query:   57 DFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNS--QENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNP-AVLFTGL---LSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHS 1292
            D+VYFE S+  PY IR+IEELNKT  G VEAKVVC +RRRD+S+SL  +AD        E+   T+ E   H LKHRELF++RQ E+LPATHIRGK  VT  N+ +++  Y   E+ FFY+LV+D VQKT+ + +G IR+GS+YQ  +P Q +E +  N  ++  E  +W+P N +++ +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  ++  G    L+ A  Q    CESC +  S QW+AWGPPN+ C+LC +CW YWK+YGGLK PT+ +  ++   + SP +  +
Sbjct:   18 DYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEDESKQPTVGETHRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGSKYQAEIPDQLAEGEPDNRNQQKMEIKVWDPENPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLARAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGLNGAGFQKGLTCESCHTTVSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARNIGSLSPYTTSA 435          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Xenopus
Match: gemin6 (gem nuclear organelle associated protein 6 [Source:Xenbase;Acc:XB-GENE-951468])

HSP 1 Score: 423.705 bits (1088), Expect = 1.323e-139
Identity = 208/418 (49.76%), Postives = 284/418 (67.94%), Query Frame = 3
Query:   57 DFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNS--QENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNP-AVLFTGL---LSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHS 1292
            D+VYFE S+  PY IR+IEELNKT  G VEAKVVC +RRRD+S+SL  +AD        E+   T+ E   H LKHRELF++RQ E+LPATHIRGK  VT  N+ +++  Y   E+ FFY+LV+D VQKT+ + +G IR+GS+YQ  +P Q +E +  N  ++  E  +W+P N +++ +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  ++  G    L+ A  Q    CESC +  S QW+AWGPPN+ C+LC +CW YWK+YGGLK PT+ +  ++   + SP +  +
Sbjct:   18 DYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEDESKQPTVGETHRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGSKYQAEIPDQLAEGEPDNRNQQKMEIKVWDPENPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLARAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGLNGAGFQKGLTCESCHTTVSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARNIGSLSPYTTSA 435          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Xenopus
Match: gemin6 (gem nuclear organelle associated protein 6 [Source:Xenbase;Acc:XB-GENE-951468])

HSP 1 Score: 422.165 bits (1084), Expect = 3.126e-139
Identity = 208/418 (49.76%), Postives = 284/418 (67.94%), Query Frame = 3
Query:   57 DFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNS--QENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNP-AVLFTGL---LSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHS 1292
            D+VYFE S+  PY IR+IEELNKT  G VEAKVVC +RRRD+S+SL  +AD        E+   T+ E   H LKHRELF++RQ E+LPATHIRGK  VT  N+ +++  Y   E+ FFY+LV+D VQKT+ + +G IR+GS+YQ  +P Q +E +  N  ++  E  +W+P N +++ +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  ++  G    L+ A  Q    CESC +  S QW+AWGPPN+ C+LC +CW YWK+YGGLK PT+ +  ++   + SP +  +
Sbjct:   18 DYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEDESKQPTVGETHRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGSKYQAEIPDQLAEGEPDNRNQQKMEIKVWDPENPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLARAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGLNGAGFQKGLTCESCHTTVSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARNIGSLSPYTTSA 435          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Xenopus
Match: gemin6 (gem nuclear organelle associated protein 6 [Source:Xenbase;Acc:XB-GENE-951468])

HSP 1 Score: 420.239 bits (1079), Expect = 5.502e-139
Identity = 208/418 (49.76%), Postives = 283/418 (67.70%), Query Frame = 3
Query:   57 DFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNSQ--------ENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNP-AVLFTGL---LSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSS 1274
            D+VYFE S+  PY IR+IEELNKT  G VEAKVVC +RRRD+S+SL  +AD  +  +        E+   T+ E   H LKHRELF++RQ E+LPATHIRGK  VT  N+ +++  Y   E+ FFY+LV+D VQKT+ + +G IR+GS+YQ  +P Q +E +  N  ++  E  +W+P N +++ +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  ++  G    L+ A  Q    CESC +  S QW+AWGPPN+ C+LC +CW YWK+YGGLK PT+ +  ++    SS
Sbjct:   18 DYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNHTGKVNGEYFEDESKQPTVGETHRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGSKYQAEIPDQLAEGEPDNRNQQKMEIKVWDPENPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLARAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGLNGAGFQKGLTCESCHTTVSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARNIGVSS 435          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Mouse
Match: Mta3 (metastasis associated 3 [Source:MGI Symbol;Acc:MGI:2151172])

HSP 1 Score: 441.81 bits (1135), Expect = 8.999e-148
Identity = 217/424 (51.18%), Postives = 293/424 (69.10%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK-----ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAA-----NPQT---NXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQ 1250
            + NMYRVGD+VYFE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+SN+L+ +ADK     E  S+  + + LTE+Q H LKHRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD   KT+ + KG IR+G +YQ ++P    E  +   ++   E  +W+PN+ +++ +I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + +  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y+KPNP  + +     G ++ A      PQ+      CESC +  S QW++WGPPN+ C+LC TCW YWK+YGGLK PT+ D +
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKETEEESETPVEADLTEKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSVKTLLADKGEIRVGPKYQADIPDMLPEGDSDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHGYDLSSAISVLVPLGGPVLCRDEMEEWSASEACLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQISSSNGKAGTVNGAVGTQFQPQSALLGRACESCYATQSHQWYSWGPPNMQCRLCATCWLYWKKYGGLKMPTQSDEE 425          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Mouse
Match: Mta3 (metastasis associated 3 [Source:MGI Symbol;Acc:MGI:2151172])

HSP 1 Score: 436.417 bits (1121), Expect = 9.941e-146
Identity = 217/424 (51.18%), Postives = 292/424 (68.87%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK-----ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAA-----NPQT---NXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQ 1250
            + NMYRVGD+VYFE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+SN+L+ +ADK     E  S+  + + LTE+Q H LKHRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD   KT+ + KG IR+G +YQ ++P    E  +   ++   E  +W+PN+ +++ +I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + +  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y KPNP  + +     G ++ A      PQ+      CESC +  S QW++WGPPN+ C+LC TCW YWK+YGGLK PT+ D +
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKETEEESETPVEADLTEKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSVKTLLADKGEIRVGPKYQADIPDMLPEGDSDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHGYDLSSAISVLVPLGGPVLCRDEMEEWSASEACLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTY-KPNPNQISSSNGKAGTVNGAVGTQFQPQSALLGRACESCYATQSHQWYSWGPPNMQCRLCATCWLYWKKYGGLKMPTQSDEE 424          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Mouse
Match: Mta3 (metastasis associated 3 [Source:MGI Symbol;Acc:MGI:2151172])

HSP 1 Score: 436.802 bits (1122), Expect = 6.740e-145
Identity = 217/424 (51.18%), Postives = 292/424 (68.87%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK-----ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAA-----NPQT---NXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQ 1250
            + NMYRVGD+VYFE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+SN+L+ +ADK     E  S+  + + LTE+Q H LKHRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD   KT+ + KG IR+G +YQ ++P    E  +   ++   E  +W+PN+ +++ +I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + +  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y KPNP  + +     G ++ A      PQ+      CESC +  S QW++WGPPN+ C+LC TCW YWK+YGGLK PT+ D +
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKETEEESETPVEADLTEKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSVKTLLADKGEIRVGPKYQADIPDMLPEGDSDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHGYDLSSAISVLVPLGGPVLCRDEMEEWSASEACLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTY-KPNPNQISSSNGKAGTVNGAVGTQFQPQSALLGRACESCYATQSHQWYSWGPPNMQCRLCATCWLYWKKYGGLKMPTQSDEE 424          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Mouse
Match: Mta3 (metastasis associated 3 [Source:MGI Symbol;Acc:MGI:2151172])

HSP 1 Score: 432.95 bits (1112), Expect = 2.193e-143
Identity = 217/424 (51.18%), Postives = 292/424 (68.87%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK-----ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAA-----NPQT---NXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQ 1250
            + NMYRVGD+VYFE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+SN+L+ +ADK     E  S+  + + LTE+Q H LKHRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD   KT+ + KG IR+G +YQ ++P    E  +   ++   E  +W+PN+ +++ +I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + +  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y KPNP  + +     G ++ A      PQ+      CESC +  S QW++WGPPN+ C+LC TCW YWK+YGGLK PT+ D +
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKETEEESETPVEADLTEKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSVKTLLADKGEIRVGPKYQADIPDMLPEDSDER-EQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHGYDLSSAISVLVPLGGPVLCRDEMEEWSASEACLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTY-KPNPNQISSSNGKAGTVNGAVGTQFQPQSALLGRACESCYATQSHQWYSWGPPNMQCRLCATCWLYWKKYGGLKMPTQSDEE 423          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Mouse
Match: Mta2 (metastasis-associated gene family, member 2 [Source:MGI Symbol;Acc:MGI:1346340])

HSP 1 Score: 435.261 bits (1118), Expect = 3.762e-143
Identity = 207/408 (50.74%), Postives = 288/408 (70.59%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNS--QENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNP-AVLFTGL---LSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTR 1238
            + NMYRVGD+VYFE S+  PY +R+IEELNKT  G VEAKVVC +RRRD+S+SL  +AD       +E+    ++E+Q H LKHRELF++RQ E+LPATHIRGK  VT  N+ +++  Y + E+ FFY+LV+D VQKT+ + +G IR+G ++Q  +P + +E ++ N  ++  E  +W+P+N +++ +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  ++  G    ++ A  Q    CESC +  S QW+AWGPPN+ C+LC +CW YWK+YGGLK PT+
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILNQYLDKEDCFFYSLVFDPVQKTLLADQGEIRVGCKFQAEIPDRLAEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQ 409          
BLAST of Metastasis-associated protein MTA1 vs. UniProt/SwissProt
Match: sp|Q9BTC8|MTA3_HUMAN (Metastasis-associated protein MTA3 OS=Homo sapiens OX=9606 GN=MTA3 PE=1 SV=2)

HSP 1 Score: 442.58 bits (1137), Expect = 3.483e-146
Identity = 215/424 (50.71%), Postives = 293/424 (69.10%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK-----ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAA--------NPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQ 1250
            + NMYRVGD+VYFE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+SN+L+ +ADK     E  S+  + + LT++Q H LKHRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD   KT+ + KG IR+G +YQ ++P    E ++   ++   E  +W+PN+ +++ +I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + + +Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y+KPNP  + T     G ++ A        NP     CESC +  S QW++WGPPN+ C+LC  CW YWK+YGGLK PT+ + +
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKEIEEESETTVEADLTDKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSLKTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHSYDLSSAISVLVPLGGPVLCRDEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYSKPNPNQISTSNGKPGAVNGAVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCAICWLYWKKYGGLKMPTQSEEE 425          
BLAST of Metastasis-associated protein MTA1 vs. UniProt/SwissProt
Match: sp|A6QL72|MTA3_BOVIN (Metastasis-associated protein MTA3 OS=Bos taurus OX=9913 GN=MTA3 PE=2 SV=1)

HSP 1 Score: 437.187 bits (1123), Expect = 3.952e-144
Identity = 215/424 (50.71%), Postives = 292/424 (68.87%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK-----ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAA--------NPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQ 1250
            + NMYRVGD+VYFE S+  PY IR+IEELNKT TG VEAKV+CFYRRRD+SN+L+ +ADK     E  S+  + + LT++Q H LKHRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD   KT+ + KG IR+G +YQ ++P    E ++   ++   E  +W+PN+ +++ +I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  + + + +  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y KPNP  + T     G ++ A        NP     CESC +  S QW++WGPPN+ C+LC TCW YWK+YGGLK PT+ + +
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTATGNVEAKVLCFYRRRDISNTLIMLADKHAKEIEEESETTVEADLTDKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSVKTLLADKGEIRVGPRYQADIPEMLLEGESDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHSMDTLYRHGYDLSSAISVLVPLGGPVLCRDEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTY-KPNPNQISTSNGKPGAVNGAVGTTFQPQNPLLGRACESCYATQSHQWYSWGPPNMQCRLCATCWLYWKKYGGLKMPTQSEEE 424          
BLAST of Metastasis-associated protein MTA1 vs. UniProt/SwissProt
Match: sp|Q924K8|MTA3_MOUSE (Metastasis-associated protein MTA3 OS=Mus musculus OX=10090 GN=Mta3 PE=1 SV=1)

HSP 1 Score: 432.95 bits (1112), Expect = 1.534e-142
Identity = 217/424 (51.18%), Postives = 292/424 (68.87%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK-----ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAA-----NPQT---NXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQ 1250
            + NMYRVGD+VYFE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+SN+L+ +ADK     E  S+  + + LTE+Q H LKHRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD   KT+ + KG IR+G +YQ ++P    E  +   ++   E  +W+PN+ +++ +I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + +  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y KPNP  + +     G ++ A      PQ+      CESC +  S QW++WGPPN+ C+LC TCW YWK+YGGLK PT+ D +
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISNTLIMLADKHAKETEEESETPVEADLTEKQKHQLKHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSVKTLLADKGEIRVGPKYQADIPDMLPEDSDER-EQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHGYDLSSAISVLVPLGGPVLCRDEMEEWSASEACLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTY-KPNPNQISSSNGKAGTVNGAVGTQFQPQSALLGRACESCYATQSHQWYSWGPPNMQCRLCATCWLYWKKYGGLKMPTQSDEE 423          
BLAST of Metastasis-associated protein MTA1 vs. UniProt/SwissProt
Match: sp|Q9R190|MTA2_MOUSE (Metastasis-associated protein MTA2 OS=Mus musculus OX=10090 GN=Mta2 PE=1 SV=1)

HSP 1 Score: 435.261 bits (1118), Expect = 2.632e-142
Identity = 207/408 (50.74%), Postives = 288/408 (70.59%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNS--QENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNP-AVLFTGL---LSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTR 1238
            + NMYRVGD+VYFE S+  PY +R+IEELNKT  G VEAKVVC +RRRD+S+SL  +AD       +E+    ++E+Q H LKHRELF++RQ E+LPATHIRGK  VT  N+ +++  Y + E+ FFY+LV+D VQKT+ + +G IR+G ++Q  +P + +E ++ N  ++  E  +W+P+N +++ +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  ++  G    ++ A  Q    CESC +  S QW+AWGPPN+ C+LC +CW YWK+YGGLK PT+
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILNQYLDKEDCFFYSLVFDPVQKTLLADQGEIRVGCKFQAEIPDRLAEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQ 409          
BLAST of Metastasis-associated protein MTA1 vs. UniProt/SwissProt
Match: sp|O94776|MTA2_HUMAN (Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1)

HSP 1 Score: 435.261 bits (1118), Expect = 2.689e-142
Identity = 208/408 (50.98%), Postives = 286/408 (70.10%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNS--QENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNP-AVLFTGL---LSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTR 1238
            + NMYRVGD+VYFE S+  PY +R+IEELNKT  G VEAKVVC +RRRD+S+SL  +AD       +E+    ++E+Q H LKHRELF++RQ E+LPATHIRGK  VT  N+ +++  Y   E+ FFY+LV+D VQKT+ + +G IR+G +YQ  +P +  E ++ N  ++  E  +W+P+N +++ +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  ++  G    ++ A  Q    CESC +  S QW+AWGPPN+ C+LC +CW YWK+YGGLK PT+
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQ 409          
BLAST of Metastasis-associated protein MTA1 vs. TrEMBL
Match: T1JGP3 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 466.463 bits (1199), Expect = 4.596e-151
Identity = 250/561 (44.56%), Postives = 349/561 (62.21%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNSQEN-----LMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQV-NVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT---GLLSAAN---PQ--TNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSN-HSATMLVHKSVTAHLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDSMELVDQNNPLLYEEFKNQKNGFFMKPSPEFKIGCKLFNEKLRINFRMSRCFDRENRMHLALKCITKFEMKNL--LNEFFKN 1664
            + NMYRVGD+VYFETS+ +P+QIR+IEELNKT  G VEAKV+CFYRRRD+S SL+ +ADK  ++ E+        +L ++Q H LKHRELF++RQ+ETLPATHIRGK  VT  N+ E +L+Y N ++TFFY+LVYD  QKT+ + KG IR+GS+YQ  ++P      +  + K  + ETL+W P + +++ +I+ F+ I RS+GT+AR+LD +SSV+QP+L  + AAA+RD+TL  A + + + NY   +A+S L P     L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS K ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIPNY KPNPA +     GL++ +N   PQ  +   CESC    S QW+AWGP  + C+LC  CWSYWK+YGGLK PTR D Q     N   +    SA  L     +   ++C   GC K F+    L  H  T H   + +        P++       +  F++  SP  ++  +L  + LR        F   N + +  +C ++ + ++   L  + KN
Sbjct:    2 AANMYRVGDYVYFETSSTSPFQIRRIEELNKTPNGNVEAKVMCFYRRRDISGSLILLADKHQSALEDDHDGEQQDSLADKQRHQLKHRELFLSRQVETLPATHIRGKCTVTLLNETESLLSYLNKDDTFFYSLVYDPQQKTLLADKGEIRVGSRYQAESIPLVKDAGEEDDRKLSDLETLIWTPYHSLTDRQIDQFLVIARSVGTFARALDCSSSVKQPSLHMSAAAASRDVTLFHAMDTIHRHNYDVAEAISSLVPSTGPVLCRDEMEEWSASEANLFEEALEKYGKDFNDIRQDFLPWKSLKNVIEYYYMWKTTDRYVQQKRVKAVEAESKLKQVYIPNYNKPNPAAISNNKPGLMNGSNTNDPQAVSGKPCESCYIFQSSQWYAWGPLQMQCRLCSICWSYWKKYGGLKQPTRLDEQWWNRDNEGLRVIFDSAERLAAHMASHRPHRCTISGCGKEFKLKAHLARHCATAHGLAIRA----GSPRPIM-----KTRAAFYLCTSPVTRVARRLCRDLLRPRHAARNPFQPVNHVAIKQECTSRVQGRSTDDLKVYLKN 553          
BLAST of Metastasis-associated protein MTA1 vs. TrEMBL
Match: K1P5F7 (Metastasis-associated protein MTA1 OS=Crassostrea gigas OX=29159 GN=CGI_10010713 PE=4 SV=1)

HSP 1 Score: 465.307 bits (1196), Expect = 7.048e-151
Identity = 236/476 (49.58%), Postives = 316/476 (66.39%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK---------ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNA-NYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFTGLLSAANPQTNXXX-XXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVTAHLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDS 1427
            + NMYRVGD+V+FETS+  PYQIR+IEELNKT  G VEAKVVCFYRRRD+S+SL  +ADK         +++  E+ +  + ++Q H LKHRELF++RQ+ETLPATHIRGK  VT  N+ E +L+Y N ++TFFY+LVYD  QKT+ + KG IR+GS+YQ  VP +  E ++  N K    E L+W P N +S+ +++ F+ I RS+GT+AR+LD TS+VRQP+L  + AAA+RDITL  A + + ++ Y    A + L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS K +VE+YYMWKT+  Y+Q KRIK  E E KLKQVYIPNY KPNPA +  G ++  + Q +    ESC +  S QW++WGP ++ C+LC +CW YWK+YGGLK PTR D          P  N     +   + +  +++C   GC K FR    L  H+ T H  ++ S
Sbjct:    2 AANMYRVGDYVFFETSSTTPYQIRRIEELNKTPNGNVEAKVVCFYRRRDISSSLTLLADKHQTDSDGGLDDSELESKLDEVGDKQKHQLKHRELFLSRQVETLPATHIRGKCTVTLLNETESLLSYLNKDDTFFYSLVYDPQQKTLLADKGEIRVGSRYQAEVPDKPLEGEDTDNRKMEELEDLIWNPENGLSDRQVDQFLIISRSVGTFARALDCTSTVRQPSLHMSAAAASRDITLFHAMDNLHKSVYELSKAYASLVPTGGPMLCRDEMEEWSASEANLFEEALDKYGKDFNDIRQDFLPWKSLKSIVEYYYMWKTTDRYVQQKRIKAAEAESKLKQVYIPNYNKPNPAAI-NGKMNGVDGQVSGRACESCYAAHSSQWYSWGPAHMQCRLCSSCWIYWKKYGGLKMPTRLD-------GERPTPNQRQERIAQIN-SMRMHRCTIAGCGKEFRLKAHLARHLATAHGLVVRS 468          
BLAST of Metastasis-associated protein MTA1 vs. TrEMBL
Match: A0A2T7NZ96 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_14155 PE=4 SV=1)

HSP 1 Score: 462.996 bits (1190), Expect = 1.746e-149
Identity = 239/502 (47.61%), Postives = 307/502 (61.16%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENN------------------------------------------SQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFTGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVTAHLYQCPQIGCDKHFRQAVQLHNHITTTHS 1412
            + NMYRVGD+VYFETS+ +PY IR+IEELNKT  G VEAKV+CFYRRRD+SNSL+ +ADK ++                                          S+    S + E+Q H LKHRELF++RQ+ETLPATHIRGK  VT  N+ E + +Y N E+TFFY+LVYD  QKT+ + KG IR+GS++Q  VP +  E+++   +    ETL+W P N +S +EI+ F+ I RS+GT+AR+LD TS+VRQP+L  + AAA+RDITL  A + + +  Y    A+  L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS K +VE+YYMWKT+  Y+Q KRIK  E E KLKQVYIPNY KPNPA L   +  A    +   CESC +  S QWF+WGP ++ C+LC  CW YWK+YGGLK PTR D +         +  H  +M   K        C   GC K F+    L  H+ T H 
Sbjct:    2 AANMYRVGDYVYFETSSTSPYLIRRIEELNKTPNGNVEAKVMCFYRRRDISNSLIVLADKHHSNTLDDEPDRKRSSSPTETSSSPPSDTTNVNGNGNGGGTGGEESEVKPFSDVPEKQRHQLKHRELFLSRQVETLPATHIRGKCVVTLLNETESLTSYLNKEDTFFYSLVYDPQQKTLLADKGEIRVGSKFQAEVPSKFIEVEDDQRQSDQLETLIWRPENGLSKKEIDQFLVIARSVGTFARALDCTSTVRQPSLHMSAAAASRDITLFHAMDTLHKHGYDISKAIRSLVPDGGPVLCRDEMEEWSASEANLFEEALDKYGKDFNDIRQDFLPWKSLKSIVEYYYMWKTTDRYVQQKRIKAAEAESKLKQVYIPNYNKPNPAALAGKVNGADGQVSGRACESCYTAHSSQWFSWGPAHMQCRLCSACWMYWKKYGGLKMPTRLDGERPAPTQRQERVAHMNSMRTQK--------CTISGCGKEFKLKTHLARHLATAHG 495          
BLAST of Metastasis-associated protein MTA1 vs. TrEMBL
Match: A0A1S3HPM7 (metastasis-associated protein MTA3 OS=Lingula unguis OX=7574 GN=LOC106157049 PE=4 SV=1)

HSP 1 Score: 460.685 bits (1184), Expect = 6.078e-149
Identity = 239/491 (48.68%), Postives = 313/491 (63.75%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNSQENLM-----STLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVL---------------------FTGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVTAHLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDS 1427
            + NMYRVGD+VYFETS+ +PYQIR+IEELNKT  G VEAKV+CFYRRRD+SNSL+ +ADK  ++ E+         ++E+Q H LKHRELF++RQ+ETLPATHIRGK+ VT  N+ EL+ +Y N E+TFFY+LVYD  QKT+ + KG IR+G +YQ +V     E ++   K  + E L+W P   +S+ +I+ F+ I R++GT+AR+LD TS+VRQP+L  + AAA+RD+TL  A + + +  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWK+ K +VE+YYMWKT+  Y+Q KRIK  E E KLKQVYIPNY KPNPA L                       G+LS A       CESC +  S QW+AWGP ++ C+LC +CW YWK+YGGLK PTR D          P  N     L   +    +++C   GC K F+    L  H+ T H   + S
Sbjct:    2 AANMYRVGDYVYFETSSTSPYQIRRIEELNKTPNGNVEAKVMCFYRRRDISNSLIMLADKHQSTLEDDQEMEENDDVSEQQRHQLKHRELFLSRQVETLPATHIRGKSTVTLLNETELLASYLNKEDTFFYSLVYDPQQKTLLADKGEIRVGGRYQADVQPLLKEGESDGRKMEDLEELVWNPETHLSDRQIDQFMVIARAVGTFARALDCTSTVRQPSLHMSAAAASRDVTLFHAMDTLHKHQYNTATAISSLVPPGGPVLCRDEMEEWSASEANLFEEALDKYGKDFNDIRQDFLPWKTLKSIVEYYYMWKTTDRYVQQKRIKAAEAESKLKQVYIPNYNKPNPAQLPNNKNGSAASAAAGAAAPGAGGEGVLSRA-------CESCYTAHSSQWYAWGPAHMQCRLCSSCWIYWKKYGGLKMPTRLD-------GERPAPNQRQERLAQMAAL-RMHKCTISGCGKEFKLKAHLARHLATAHGLAIRS 477          
BLAST of Metastasis-associated protein MTA1 vs. TrEMBL
Match: H3CG45 (Metastasis associated 1 family, member 2 OS=Tetraodon nigroviridis OX=99883 PE=4 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 9.493e-148
Identity = 218/425 (51.29%), Postives = 297/425 (69.88%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNS--QENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSN 1286
            + NMYRVGD+VYFE S+  PY IR+IEELNKT  G VEAKVVC +RRRD+S++L  +AD       +E+   TL+EEQ H LKHRELF++RQ E+LPATHIRGK  VT  N+ ++++NY + ++ FFY+LV+D VQKT+ + +G IR+GS+YQ  +P + +E +     +   ET +W+PNN++ + +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+ NY    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F  I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  +       G+  AA  Q    CESC ++ S QW+AWGPPN+ C+LC  CW+YWK+YGGLK PT  D  ++   +S P+ +
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCLFRRRDISSNLNTLADSNAREFEEESKQPTLSEEQKHQLKHRELFLSRQFESLPATHIRGKCNVTLLNETDVLVNYLDKDDCFFYSLVFDPVQKTLLADQGEIRVGSKYQAEIPDKLAEGETDTRVQEKLETKLWDPNNQLKDPQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQKNNYDLASAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFTDIRQDFLPWKSLASVVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIMVPGSKPGMNGAAGFQKGLSCESCHTVQSSQWYAWGPPNMQCRLCAACWNYWKKYGGLKTPTHLDGTARASSDSGPRGH 426          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Cavefish
Match: mta2 (metastasis associated 1 family member 2 [Source:NCBI gene;Acc:103046385])

HSP 1 Score: 444.506 bits (1142), Expect = 2.077e-147
Identity = 212/425 (49.88%), Postives = 296/425 (69.65%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK--ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSN 1286
            + NMYRVGD+VYFE S+  PY IR+IEELNKT  G VEAKVVC +RRRD+S +L  +AD    +  +E+    ++E+Q H LKHRELF++RQ E+LPATHIRGK  VT  N+ +++  Y   E+ FFY+LV+D VQKT+ + +G IR+GS+YQ  +P + +E ++ N  +   ET +W+P+N++ + +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  +       G+  AA  Q    CESC +  S QW+AWGPPN+ C+LC +CW YWK+YGGLK PT+ +  ++   +++P+ +
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCLFRRRDISGNLNTLADSNARDFEEESKQPAISEQQKHQLKHRELFLSRQFESLPATHIRGKCNVTLLNETDVLTGYLEREDCFFYSLVFDPVQKTLLADQGEIRVGSKYQAEIPDKLAEGESDNRVQEKLETKVWDPDNQLKDSQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQKNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASVVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIMAPGNKPGINGAAGFQKGLCCESCHTAQSPQWYAWGPPNMQCRLCASCWVYWKKYGGLKTPTQLEGATRTGSDAAPRGH 426          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Cavefish
Match: mta2 (metastasis associated 1 family member 2 [Source:NCBI gene;Acc:103046385])

HSP 1 Score: 445.662 bits (1145), Expect = 2.703e-147
Identity = 212/425 (49.88%), Postives = 296/425 (69.65%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK--ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSN 1286
            + NMYRVGD+VYFE S+  PY IR+IEELNKT  G VEAKVVC +RRRD+S +L  +AD    +  +E+    ++E+Q H LKHRELF++RQ E+LPATHIRGK  VT  N+ +++  Y   E+ FFY+LV+D VQKT+ + +G IR+GS+YQ  +P + +E ++ N  +   ET +W+P+N++ + +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+  Y    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  +       G+  AA  Q    CESC +  S QW+AWGPPN+ C+LC +CW YWK+YGGLK PT+ +  ++   +++P+ +
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCLFRRRDISGNLNTLADSNARDFEEESKQPAISEQQKHQLKHRELFLSRQFESLPATHIRGKCNVTLLNETDVLTGYLEREDCFFYSLVFDPVQKTLLADQGEIRVGSKYQAEIPDKLAEGESDNRVQEKLETKVWDPDNQLKDSQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQKNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASVVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIMAPGNKPGINGAAGFQKGLCCESCHTAQSPQWYAWGPPNMQCRLCASCWVYWKKYGGLKTPTQLEGATRTGSDAAPRGH 426          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Cavefish
Match: mta3 (metastasis-associated protein MTA3 [Source:NCBI gene;Acc:103047709])

HSP 1 Score: 433.721 bits (1114), Expect = 7.680e-145
Identity = 212/421 (50.36%), Postives = 285/421 (67.70%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK-----ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVL------FTGLLSAANPQT------NXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQD 1244
            + NMYRVGD+V+FE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+S SL+Q+ADK     E   +      L+E+Q H L+HRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD  QKT+ + KG IR+G ++Q +VP    E +  +  +   E  MW+P   ++N++I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + +  Y    A+S L P G   L RDEME+WS++E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y KPNP  +         +  AA P           CESC ++ S QW++WGPPN+ C+LC +CW YWK+YGGLK P+R +
Sbjct:    2 AANMYRVGDYVFFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISQSLIQLADKHAKDLEEEKESPTEPDLSEKQKHQLRHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPTQKTLLADKGEIRVGPRFQADVPEMLQEGEADDRDQSKLEVKMWDPECPLTNKQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHRHGYDLSSALSVLVPQGGPVLCRDEMEEWSSSEANLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYNKPNPNQISVSNGKMATMNGAAGPGPFHTAGGGRACESCFAMQSPQWYSWGPPNMQCRLCVSCWMYWKKYGGLKMPSRAE 422          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Cavefish
Match: mta3 (metastasis-associated protein MTA3 [Source:NCBI gene;Acc:103047709])

HSP 1 Score: 434.491 bits (1116), Expect = 4.061e-143
Identity = 212/421 (50.36%), Postives = 285/421 (67.70%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK-----ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVL------FTGLLSAANPQT------NXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQD 1244
            + NMYRVGD+V+FE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+S SL+Q+ADK     E   +      L+E+Q H L+HRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD  QKT+ + KG IR+G ++Q +VP    E +  +  +   E  MW+P   ++N++I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + +  Y    A+S L P G   L RDEME+WS++E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y KPNP  +         +  AA P           CESC ++ S QW++WGPPN+ C+LC +CW YWK+YGGLK P+R +
Sbjct:    2 AANMYRVGDYVFFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISQSLIQLADKHAKDLEEEKESPTEPDLSEKQKHQLRHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPTQKTLLADKGEIRVGPRFQADVPEMLQEGEADDRDQSKLEVKMWDPECPLTNKQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHRHGYDLSSALSVLVPQGGPVLCRDEMEEWSSSEANLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYNKPNPNQISVSNGKMATMNGAAGPGPFHTAGGGRACESCFAMQSPQWYSWGPPNMQCRLCVSCWMYWKKYGGLKMPSRAE 422          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Cavefish
Match: mta3 (metastasis-associated protein MTA3 [Source:NCBI gene;Acc:103047709])

HSP 1 Score: 434.876 bits (1117), Expect = 4.823e-143
Identity = 212/421 (50.36%), Postives = 285/421 (67.70%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK-----ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVL------FTGLLSAANPQT------NXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQD 1244
            + NMYRVGD+V+FE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+S SL+Q+ADK     E   +      L+E+Q H L+HRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD  QKT+ + KG IR+G ++Q +VP    E +  +  +   E  MW+P   ++N++I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + +  Y    A+S L P G   L RDEME+WS++E  LFEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y KPNP  +         +  AA P           CESC ++ S QW++WGPPN+ C+LC +CW YWK+YGGLK P+R +
Sbjct:    2 AANMYRVGDYVFFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISQSLIQLADKHAKDLEEEKESPTEPDLSEKQKHQLRHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPTQKTLLADKGEIRVGPRFQADVPEMLQEGEADDRDQSKLEVKMWDPECPLTNKQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHRHGYDLSSALSVLVPQGGPVLCRDEMEEWSSSEANLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYNKPNPNQISVSNGKMATMNGAAGPGPFHTAGGGRACESCFAMQSPQWYSWGPPNMQCRLCVSCWMYWKKYGGLKMPSRAE 422          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004904.1 (pep scaffold:Pmarinus_7.0:GL478538:1563:25625:1 gene:ENSPMAG00000004405.1 transcript:ENSPMAT00000004904.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 407.912 bits (1047), Expect = 8.231e-133
Identity = 210/430 (48.84%), Postives = 278/430 (64.65%), Query Frame = 3
Query:   51 VGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENN-------------------SQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTE--NTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNY--ETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT------GLLSAANPQ---TNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQD 1244
            V D+V+FE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+S++L+ +ADK  +                    +   +  L+E+Q H LKHRELF++RQ E+L ATHIRGK  VT  N+ E + +Y   E  + F+Y+LVYD  QKT+ + KG IR+G +YQ +VP    E  +    R     ET +W+P + +++ +I+ F+ I RS+GT+AR+LD TSSVRQP+L  + AAA+RDITL  A + + ++ Y    A+  L P G   L RDEME+WSA E  LFEE L KYGK F  I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIPNY KPNP  +FT      G  +A   Q   T   CESC +  S QW++WGPP + C+LC +CW+YWK+YGGL+ PTR D
Sbjct:    8 VADYVFFENSSSNPYLIRRIEELNKTPSGNVEAKVVCFYRRRDISSTLITLADKHASLAVIYCKSPGDPHETEEMEEEMESVDDLSEKQRHQLKHRELFLSRQFESLAATHIRGKCSVTLLNETEALSSYLEREKQDCFYYSLVYDPAQKTLLADKGEIRVGPRYQADVPDMLKEGPDFEDDRDQVKLETKIWDPESPLTDRQIDQFMVIARSVGTFARALDCTSSVRQPSLHMSAAAASRDITLFHAMDTLHRSTYEVAKAIGLLVPQGGPVLCRDEMEEWSAAEANLFEEALEKYGKDFTDIRLDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNPNQIFTKQGVPNGSGTAGPGQASGTGRACESCFASQSQQWYSWGPPAMQCRLCSSCWTYWKKYGGLRLPTRLD 437          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004333.1 (pep scaffold:Pmarinus_7.0:GL478400:3217:57231:1 gene:ENSPMAG00000003940.1 transcript:ENSPMAT00000004333.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 311.612 bits (797), Expect = 4.351e-96
Identity = 186/454 (40.97%), Postives = 253/454 (55.73%), Query Frame = 3
Query:   51 VGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNSQENLMST----LTEEQLHLLKHRELFITRQ--------LETL----PATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANY-IFEDAVSFLTPG--GSLTLVRDEMEDWSANEGKLFEEGLGKYGK--SFHHIYNDF-LPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNP---------AVLFTG------LLSAA-NPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSAT 1298
            + D+V+FE S+  PY IR+IEELNKT  G VEAKVVCFYRRRD+S++L+ +ADK        M      L +E+    K    F   +         E+L    PA H RGK RVT  N+ E + +Y + E+ FFY+LVYD  QKT+ + KG IR+G +YQ ++P    + +     +   E  +W+P N +    I+ F+ I RS+GT+AR+LD +SSVRQP+L  + AAA+RDITL   ++ M + N       +  LTP    +L    D++     N    F  G G   K      I  DF LPWK+   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIPNY KPNP         A +  G      +LSA  N      CESC +  S QW++WGPPN+ C+LC  CW+YWK+YGGLK PTR +        +     HS+ 
Sbjct:    8 LSDYVFFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSNLISLADKHAILSIRYMPVPKQDLGDERQCERKSEHPFCKEKKTSGRLGSSESLTLFAPALHSRGKCRVTLLNETEALNSYLDKEDCFFYSLVYDPTQKTLLADKGEIRVGPRYQADIPDFLKDGEPDCRDQLKLEARVWDPENPLMQRHIDQFLVIARSVGTFARALDCSSSVRQPSLHMSAAAASRDITLVGRWDAMHEINVNQIMSPLEKLTPNVHDALPSHVDKLTSLVINSASTFFSGNGPSSKDNGQAEILTDFILPWKTLSSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNPNQIAATPVKAAVANGTPPIGLVLSAPQNASVGRACESCFATISCQWYSWGPPNMQCRLCSACWTYWKKYGGLKMPTRLESDRAALLRAGGLGPHSSV 461          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001817.1 (pep scaffold:Pmarinus_7.0:GL481328:4843:21472:1 gene:ENSPMAG00000001651.1 transcript:ENSPMAT00000001817.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 7.739e-20
Identity = 77/280 (27.50%), Postives = 133/280 (47.50%), Query Frame = 3
Query:  162 FYRRRDLSNSLLQMADK----ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQN------ANYKRRNYETLMWEPNNKMSNEEIENFITIC-RSLGTYARSLD--LTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVS--FLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWK 956
            +YR+ ++ +S+ Q+  +    EN+S  +L+         +++ RELFI+  ++T  A+ +RGK  V+ F+D     ++    +TFFY L Y+   + ++S +G IR+G  +Q  +P     + +      +      +E  +W P   +S+ ++  ++    RS+  YA   D  LT             AA+RD T   A + +  + Y    A+    L P       R   + WS +E K F  GL ++GK+F  I  + LP K   +LV FYY WK
Sbjct:  126 YYRQSEVPDSVYQLLVQDRHNENDSGRDLVIVDP-----VIRSRELFISDCIDTYHASALRGKCGVSHFSDIFAAKDFKAKSDTFFYILGYNPETRRLNSTQGEIRVGPSHQAKLPELLVPLGSLVPDSESGGDGTAFEERVWIPG--ISDCDLIMYLRAARRSMAAYAGMCDGGLTED--------GCLAASRDDTTINALDVLHASGYDRGKALQTLLLKP-----FPRSVDKRWSDDETKRFVRGLRQFGKNFFRIRKELLPHKETGELVTFYYYWK 385          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Sea Lamprey
Match: rcor1 (REST corepressor 1 [Source:ZFIN;Acc:ZDB-GENE-050506-79])

HSP 1 Score: 52.7582 bits (125), Expect = 1.905e-7
Identity = 41/174 (23.56%), Postives = 75/174 (43.10%), Query Frame = 3
Query:  447 SGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETL-MWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQ 965
            +G G IR+GS +Q  +P  +  +     + R+ E + +W P++ +  E+++ ++++ + +  Y+                        + L  A+N  +       D  +F            + ++W   E  LFE+  G +GKSFH I    LP KS   LV  YY WK ++
Sbjct:   67 TGGGGIRVGSAFQATIPEFSPVMPRERTRDRDREDVPVWSPHHSIPEEQLDEYLSVAKEVHGYSTEQHW------------------GLLLWHAHNIERS----LADMPNFAP----------DADEWGETERALFEQAYGFHGKSFHLI-QQMLPGKSIGSLVRHYYTWKQTR 207          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Nematostella
Match: EDO40223 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7M6])

HSP 1 Score: 338.191 bits (866), Expect = 2.086e-108
Identity = 193/456 (42.32%), Postives = 264/456 (57.89%), Query Frame = 3
Query:   57 DFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK------ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPA---------VLFTGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCK--LCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVH-KSVTAHLYQCPQIGCDKHFR 1370
            D+VY ET+   PYQIR+IEEL KT+ G VEAKV CFYR+RDLS++L   A+K      E+   E     L +   H L HRE+F++RQ E + A  IRGK  VT +N+ E++  Y   E+ F Y LVYD  QK++ + +G + IG  YQ  VP++  +    +      ETL+W+P+N +S+ +++ F+ + RS+GT+AR+LD +SSV+QP+L  + AAA+RD+TL  A   +  + Y    A+S L P G   L RDEMEDWSA E  LFEE L KYGK F+ I  DFLPWKS   +VE+YYMWKT+  YLQ KR K    E  L Q+YIP     NPA         ++ T      +    + CE C   +S QW+ W P N   K  LC  CW YWK+YGGLK P +            P++  +A+   H  SV AHL +   + C+  +R
Sbjct:    1 DYVYVETNPSLPYQIRRIEELTKTSNGQVEAKVQCFYRKRDLSSTLGIQAEKHLLQAEEDAEVEMGDIELEDVSRHQLSHREVFLSRQYENINANTIRGKCLVTLYNEAEVLPKYLEKEDWFCYFLVYDPQQKSLVADRGEMGIGPNYQCLVPKKCIDPSTDDRDLSQMETLVWKPDNSLSDRQVDQFLVVARSVGTFARALDCSSSVKQPSLHMSAAAASRDVTLFHAMTTLHNSMYQVGKALSQLVPSGGPVLCRDEMEDWSAGEANLFEEALQKYGKDFNDIQKDFLPWKSFSSIVEYYYMWKTTDRYLQQKRQKAVSKECNLTQIYIPGLAPSNPAQPGKKQTSTIILTPPPGVTSNLVGATCEGCYGCTSQQWYPWSPSNSQHKFWLCTLCWIYWKKYGGLKKPGK---------TLMPENVKNASRAWHFSSVFAHLSR--HLTCNHGYR 445          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Nematostella
Match: EDO29602 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T363])

HSP 1 Score: 259.61 bits (662), Expect = 1.271e-78
Identity = 174/456 (38.16%), Postives = 234/456 (51.32%), Query Frame = 3
Query:   60 FVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADK------ENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFIT-ICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPA---------VLFTGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCK--LCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVH-KSVTAHLYQCPQIGCDKHFR 1370
            +VY ET+   PYQIR+IEEL KT+ G VEAKV CFYR+RDLS++L   A+K      E+   E     L +   H L HRE+F++RQ E + A  IRGK  VT +N+ E++  Y   E+ F Y LVYD  QK++ + +G + IG  YQ  VP++  + +  N      +  +      + N++   F+    R   TY   L  T       L A    ++  +    A   +  + Y    A+S L P G   L RDEMEDWSA E  LFEE L KYGK F+ I  DFLPWKS   +VE+YYMWKT+  YLQ KR K    E  L Q+YIP     NPA         ++ T      +    + CE C   +S QW+ W P N   K  LC  CW YWK+YGGLK P +            P++  +AT   H  SV AHL +   + C+  +R
Sbjct:    2 YVYVETNPSLPYQIRRIEELTKTSNGQVEAKVQCFYRKRDLSSTLGIQAEKHLLQAEEDAEVEMGDIELEDVSRHQLSHREVFLSRQYENINANTIRGKCLVTLYNEAEVLPKYLEKEDWFCYFLVYDPQQKSLVADRGEMGIGPNYQCLVPKKCIDRKLINAFEVTIDIRL-----PLQNKDSTIFVVRKPRERTTYHIILMHTC------LHALTKTSSFHVGFFHAMTTLHNSMYQVGKALSQLVPSGGPVLCRDEMEDWSAGEANLFEEALQKYGKDFNDIQKDFLPWKSFSSIVEYYYMWKTTDRYLQQKRQKAVSKECNLTQIYIPGLAPSNPAQPGKKQTSTIILTPPPGVTSNLVGATCEGCYGCTSQQWYPWSPSNSQHKFWLCTLCWIYWKKYGGLKKPGK---------TLMPENVKNATRAWHFSSVFAHLSR--HLTCNHGYR 435          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Nematostella
Match: EDO44958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU61])

HSP 1 Score: 69.707 bits (169), Expect = 8.284e-14
Identity = 44/161 (27.33%), Postives = 83/161 (51.55%), Query Frame = 3
Query:  162 FYRRRDLSNSLLQMADKENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFND-NELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEI--QNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYA 635
            +YR  ++  S+ Q+  ++ N +      + E+  +L+K RELFI+   +  P + +RGK  V  F D  E +  Y   E++FFY L Y+   + + + KG IR+G+ +Q  +P    ++  ++ + K    E L W P   + + ++  ++   RS+  YA
Sbjct:    8 YYRPSEVPESVYQLLVQDRNHEHGSKDHILED--NLVKERELFISDATDVYPVSALRGKCVVRPFTDMAEDLKQYITKEDSFFYLLGYNPETRRLANTKGEIRVGASHQAILPECQEKVPDKSDSSKETCREKLTWSP--VLEDYDLTIYLCAARSMAQYA 164          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Nematostella
Match: EDO33362 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF7])

HSP 1 Score: 53.1434 bits (126), Expect = 2.055e-7
Identity = 44/180 (24.44%), Postives = 70/180 (38.89%), Query Frame = 3
Query:  462 IRIGSQYQVNVPRQASEI---------QNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIF---EDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQ 965
            +R+GS+YQ  +P   S++          NA    R+   L+W P   M++ +++ ++   +                                    YN  Q    +F    +    LT   + T   DE   WS  +  LFE+  G +GKSF  I    LP KS   LV++YY WK ++
Sbjct:    1 MRVGSEYQATIPEMVSDVCLFYLDKDMDNA----RHCALLVWAPTKNMTDSKLDEYLRTAKD--------------------------------KHGYNVEQALGMLFWHKHNIEKSLTDLANFTPFPDE---WSLEDKVLFEQAFGSHGKSFRRI-QQMLPDKSVSSLVKYYYSWKKTR 140          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Medaka
Match: mta2 (metastasis associated 1 family member 2 [Source:NCBI gene;Acc:101156685])

HSP 1 Score: 444.891 bits (1143), Expect = 3.946e-147
Identity = 213/425 (50.12%), Postives = 293/425 (68.94%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNS--QENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSN 1286
            + NMYRVGD+VYFE S+  PY IR+IEELNKT  G VEAKVVC +RRRD+S +L  +AD       +E+   +L E+Q H LKHRELF++RQ E+LPATHIRGK  VT  N+ +++  Y   E+ FFY+LV+D VQKT+ + +G IR+GS+YQ  +P   +E +  +  +   ET +W+P+N++ + +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+ NY    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  +       G+  AA  Q    CESC +  S QW+AWGPPN+ C+LC +CW YWK+YGGLK PT+ +  ++    + P+++
Sbjct:    2 AANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCLFRRRDISGNLNTLADSNAREFEEESNQPSLAEQQKHQLKHRELFLSRQFESLPATHIRGKCNVTLLNETDVLAGYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGSKYQAEIPDMLAEDETDSRVQEKLETKVWDPDNQLKDPQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQKNNYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASVVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIMVPGSKPGMNGAAGFQKGLSCESCHTAQSPQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRAGSEAGPRAH 426          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Medaka
Match: mta3 (metastasis associated 1 family member 3 [Source:NCBI gene;Acc:101156364])

HSP 1 Score: 437.958 bits (1125), Expect = 2.661e-144
Identity = 215/439 (48.97%), Postives = 293/439 (66.74%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKE----NNSQENLMST-LTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNP--AVLFTGLLSAANPQTNXXXXXXX------------XXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHS 1292
            + NMYRVGD+V+FE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+S+SL+Q+ADK        +EN   T LT++Q H L+HRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD  QKT+ + KG IR+G ++Q +VP    E +     +   E  +W+P   ++N++I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + + NY    A+S L P G   L RDEME+WSA+E  +FEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y KPNP    +  G ++  N        +              ++ S QW++WGPPN+ C+LC +CW YWK+YGGLK P+R +   +E  + SP SN S
Sbjct:    2 AANMYRVGDYVFFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISHSLIQLADKHAKELEEEKENPTETELTDKQKHQLRHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPTQKTLLADKGEIRVGPRFQADVPEMLQEGEADERDQSKLEEKLWDPECPLTNKQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHRHNYDLSSALSVLVPAGGPVLCRDEMEEWSASEAAMFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYNKPNPNQISVTNGKMATVNGAGPGAFHAAAGGGGGRACESCYTMQSAQWYSWGPPNMQCRLCVSCWMYWKKYGGLKMPSRAE-GPEERTSPSPASNES 439          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Medaka
Match: mta3 (metastasis associated 1 family member 3 [Source:NCBI gene;Acc:101156364])

HSP 1 Score: 437.958 bits (1125), Expect = 6.638e-144
Identity = 215/439 (48.97%), Postives = 293/439 (66.74%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKE----NNSQENLMST-LTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNP--AVLFTGLLSAANPQTNXXXXXXX------------XXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHS 1292
            + NMYRVGD+V+FE S+  PY IR+IEELNKT +G VEAKVVCFYRRRD+S+SL+Q+ADK        +EN   T LT++Q H L+HRELF++RQ E+LPATHIRGK  V   N+ E +L+Y + E+TFFY+LVYD  QKT+ + KG IR+G ++Q +VP    E +     +   E  +W+P   ++N++I+ F+ + R++GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + + + NY    A+S L P G   L RDEME+WSA+E  +FEE L KYGK F+ I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIP Y KPNP    +  G ++  N        +              ++ S QW++WGPPN+ C+LC +CW YWK+YGGLK P+R +   +E  + SP SN S
Sbjct:    2 AANMYRVGDYVFFENSSSNPYLIRRIEELNKTASGNVEAKVVCFYRRRDISHSLIQLADKHAKELEEEKENPTETELTDKQKHQLRHRELFLSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPTQKTLLADKGEIRVGPRFQADVPEMLQEGEADERDQSKLEEKLWDPECPLTNKQIDQFLVVARAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHRHNYDLSSALSVLVPAGGPVLCRDEMEEWSASEAAMFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPTYNKPNPNQISVTNGKMATVNGAGPGAFHAAAGGGGGRACESCYTMQSAQWYSWGPPNMQCRLCVSCWMYWKKYGGLKMPSRAE-GPEERTSPSPASNES 439          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Medaka
Match: mta1 (metastasis associated 1 [Source:NCBI gene;Acc:101173183])

HSP 1 Score: 425.246 bits (1092), Expect = 4.265e-140
Identity = 220/445 (49.44%), Postives = 290/445 (65.17%), Query Frame = 3
Query:   33 SNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNSQENL-----MSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFTGL-----------------LSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATM 1301
            + NMYRVGD+VYFE S+  P  IR+IEELNKT  G VEAKVVCFYRRRD+S++L+ +ADK     E       M+ L E+Q H L+HRELF++RQLE+LPATHIRGK  VT  N+ E + +Y   E+ FFY+LVYD  QKT+ + KG IR+G++YQ ++     E ++ +      E  +WEPN+ ++ ++I+ F+ + RS+GT+AR+LD +SSVRQP+L  + AAA+RDITL  A + +  A Y    A++ L P G   L RDEME+WSA+E  LFEE L KYGK F  I  DFLPWKS   ++E+YYMWKT+  Y+Q KR+K  E E KLKQVYIPNY KPNP  L   +                  S   P     CESC + SS QW++WGPPN+ C+LC +CW+YWK+YGGLK PTR + + +   N S  S H   M
Sbjct:    2 AANMYRVGDYVYFENSSSNPLLIRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALADKHARELEEEMENPEMADLPEKQKHQLRHRELFLSRQLESLPATHIRGKCCVTLLNETEALKSYLEREDAFFYSLVYDPQQKTLLADKGEIRVGNKYQADITDLLKEDEDDDRDLTKMEEKVWEPNSSLTEKQIDQFLVVARSVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHAAGYDMTRAIAALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNPNQLSNNVKPALLNGAVAGGVPGPPGSGQIPGLGRACESCYTSSSYQWYSWGPPNMQCRLCASCWTYWKKYGGLKMPTRLEGE-RPGPNRSTMSPHGLPM 445          
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Medaka
Match: mta2 (metastasis associated 1 family member 2 [Source:NCBI gene;Acc:101156685])

HSP 1 Score: 425.631 bits (1093), Expect = 1.228e-139
Identity = 205/400 (51.25%), Postives = 277/400 (69.25%), Query Frame = 3
Query:   60 FVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNS--QENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFT-----GLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTR 1238
            +VYFE S+  PY IR+IEELNKT  G VEAKVVC +RRRD+S +L  +AD       +E+   +L E+Q H LKHRELF++RQ E+LPATHIRGK  VT  N+ +++  Y   E+ FFY+LV+D VQKT+ + +G IR+GS+YQ  +P   +E +  +  +   ET +W+P+N++ + +I+ F+ + R++GT+AR+LD +SS+RQP+L  + AAA+RDITL  A + +Q+ NY    A+S L P G   L RDEME+WSA+E  LFEE L KYGK F+ I  DFLPWKS   +V+FYYMWKT+  Y+Q KR+K  E + KLKQVYIP YTKPNP  +       G+  AA  Q    CESC +  S QW+AWGPPN+ C+LC +CW YWK+YGGLK PT+
Sbjct:   16 YVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCLFRRRDISGNLNTLADSNAREFEEESNQPSLAEQQKHQLKHRELFLSRQFESLPATHIRGKCNVTLLNETDVLAGYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGSKYQAEIPDMLAEDETDSRVQEKLETKVWDPDNQLKDPQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQKNNYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASVVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIMVPGSKPGMNGAAGFQKGLSCESCHTAQSPQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQ 415          
BLAST of Metastasis-associated protein MTA1 vs. Planmine SMEST
Match: SMESG000081507.1 (SMESG000081507.1)

HSP 1 Score: 1357.81 bits (3513), Expect = 0.000e+0
Identity = 669/672 (99.55%), Postives = 671/672 (99.85%), Query Frame = 3
Query:   27 MASNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFTGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVTAHLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDSMELVDQNNPLLYEEFKNQKNGFFMKPSPEFKIGCKLFNEKLRINFRMSRCFDRENRMHLALKCITKFEMKNLLNEFFKNPKLDLLKKKYISRNFSNLQAVIEKISKVCPTEKLCTNEIVNLKHLRSNNISSEKQPVISEHTRPVNETDKRLYINTGFSVPKRNTISNEALCLVPTFQVSEEIRNLRLKIGASFLRKLSRKPFHQN 2042
            MASNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLAAAVAAATRDITLTEAYNKMQQANYIFEDAVSFLTPGG+LTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFTGLLSAANPQTNSGCESCGSLSSGQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVTAHLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDSMELVDQNNPLLYEEFKNQKNGFFMKPSPEFKIGCKLFNEKLRINFRMSRCFDRENRMHLALKCITKFEMKNLLNEFFKNPKLDLLKKKYISRNFSNLQAVIEKISKVCPTEKLCTNEIVNLKHLRSNNISS+KQPVISEHTRPVNETDKRLYINTG SVPKRNTISNEALCLVPTFQVSEEIRNLRLKIGASFLRKLSRKPFHQN
Sbjct:    1 MASNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLAAAVAAATRDITLTEAYNKMQQANYIFEDAVSFLTPGGALTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFTGLLSAANPQTNSGCESCGSLSSGQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVTAHLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDSMELVDQNNPLLYEEFKNQKNGFFMKPSPEFKIGCKLFNEKLRINFRMSRCFDRENRMHLALKCITKFEMKNLLNEFFKNPKLDLLKKKYISRNFSNLQAVIEKISKVCPTEKLCTNEIVNLKHLRSNNISSDKQPVISEHTRPVNETDKRLYINTGLSVPKRNTISNEALCLVPTFQVSEEIRNLRLKIGASFLRKLSRKPFHQN 672          
BLAST of Metastasis-associated protein MTA1 vs. Planmine SMEST
Match: SMESG000081507.1 (SMESG000081507.1)

HSP 1 Score: 1347.03 bits (3485), Expect = 0.000e+0
Identity = 664/667 (99.55%), Postives = 666/667 (99.85%), Query Frame = 3
Query:   42 MYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFTGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVTAHLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDSMELVDQNNPLLYEEFKNQKNGFFMKPSPEFKIGCKLFNEKLRINFRMSRCFDRENRMHLALKCITKFEMKNLLNEFFKNPKLDLLKKKYISRNFSNLQAVIEKISKVCPTEKLCTNEIVNLKHLRSNNISSEKQPVISEHTRPVNETDKRLYINTGFSVPKRNTISNEALCLVPTFQVSEEIRNLRLKIGASFLRKLSRKPFHQN 2042
            MYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLAAAVAAATRDITLTEAYNKMQQANYIFEDAVSFLTPGG+LTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFTGLLSAANPQTNSGCESCGSLSSGQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVTAHLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDSMELVDQNNPLLYEEFKNQKNGFFMKPSPEFKIGCKLFNEKLRINFRMSRCFDRENRMHLALKCITKFEMKNLLNEFFKNPKLDLLKKKYISRNFSNLQAVIEKISKVCPTEKLCTNEIVNLKHLRSNNISS+KQPVISEHTRPVNETDKRLYINTG SVPKRNTISNEALCLVPTFQVSEEIRNLRLKIGASFLRKLSRKPFHQN
Sbjct:    1 MYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLAAAVAAATRDITLTEAYNKMQQANYIFEDAVSFLTPGGALTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFTGLLSAANPQTNSGCESCGSLSSGQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVTAHLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDSMELVDQNNPLLYEEFKNQKNGFFMKPSPEFKIGCKLFNEKLRINFRMSRCFDRENRMHLALKCITKFEMKNLLNEFFKNPKLDLLKKKYISRNFSNLQAVIEKISKVCPTEKLCTNEIVNLKHLRSNNISSDKQPVISEHTRPVNETDKRLYINTGLSVPKRNTISNEALCLVPTFQVSEEIRNLRLKIGASFLRKLSRKPFHQN 667          
BLAST of Metastasis-associated protein MTA1 vs. Planmine SMEST
Match: SMESG000062477.1 (SMESG000062477.1)

HSP 1 Score: 382.104 bits (980), Expect = 1.211e-122
Identity = 243/614 (39.58%), Postives = 329/614 (53.58%), Query Frame = 3
Query:   27 MASNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKEN--------NSQENLMST----------------------LTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTP------------GGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCEN-EHKLKQVYIPNYTKPNPAVLFTGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVT-------AHLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDSMELVDQNNPLLYEEFKNQKNGFFMKPSPEFKIGCKLFNE------KLRINFRMSRCFDRE----------------NRMHLALKCITKFEMKNLLNE 1652
            M +NNMYRVGDFVYFETS  APYQIRKIEELNKT  GAVEAK +C+YRRRD+S SL+Q A+K          +  E+  S+                      L   Q H  KHRELF++RQ+ETLPATHIRGK  VT +ND E I +Y N E+TFFY   YD  QKT+H+ + +IR+GS +Q  V  +A + +     ++    L +  N     + I  FI I RSLGT AR+ +  S    P L  + A+A+RD TL  A++   ++N     AVS + P            GG   L +DE+E W+ANE  LF +G+ KYGK F+ I N  LPWKS K ++EFYYMWK++  Y   KR K     +HKLKQVYIP++ KPNPAVL T  L       + GCESC +  S QW++WGP +L C+LC +CWSYWKRYGGL+NP      S+E  N +     +   L +  ++          ++C Q  CDK FR   QL+ H+   H+  +    +++ +  +L    K+  NG  M     F  G  +         K+ + FR+ R    +                + M L  K I KF  K++ N+
Sbjct:    1 MTTNNMYRVGDFVYFETSVTAPYQIRKIEELNKTPQGAVEAKAICYYRRRDISKSLIQQAEKHRFLEDDEFFHDSESPSSSPKIHNPKYLETNDIGYFKDSHLLNPIQCHQAKHRELFLSRQIETLPATHIRGKCNVTLYNDAEPIFDYLNKEDTFFYKFTYDPSQKTLHADRNAIRVGSDFQTQV--KAFDKKKVQKSQKPEGELAY--NLSSDKDNISQFILITRSLGTLARAFEPYSYTHNPELLFSAASASRDFTLQRAHDYWFESNGCIATAVSLILPGNIKIFIYYFWVGGCPRLFKDELEQWTANEYSLFHQGMEKYGKDFYTIRNQLLPWKSLKGIIEFYYMWKSTDKYWSAKRHKSNNTLDHKLKQVYIPSFLKPNPAVLCTKPLD----HNSHGCESCLATKSPQWYSWGPQHLSCRLCVSCWSYWKRYGGLRNPA-----SRELANEN--GPETVLNLANGEISNSDNLNQVGNFKCTQPNCDKEFRVKSQLYRHLYNIHA--VSQPGIMNGSWDILNHYSKSLNNGSSMNHLLNFPGGRGMMKPRSTLVFKINLRFRLGRVLLSDYIKPKHIAKKPNSMDSSDMELFFKKIEKFPFKSISND 597          
BLAST of Metastasis-associated protein MTA1 vs. Planmine SMEST
Match: SMESG000062477.1 (SMESG000062477.1)

HSP 1 Score: 381.719 bits (979), Expect = 2.937e-122
Identity = 243/614 (39.58%), Postives = 329/614 (53.58%), Query Frame = 3
Query:   27 MASNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKEN--------NSQENLMST----------------------LTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTP------------GGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCEN-EHKLKQVYIPNYTKPNPAVLFTGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVT-------AHLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDSMELVDQNNPLLYEEFKNQKNGFFMKPSPEFKIGCKLFNE------KLRINFRMSRCFDRE----------------NRMHLALKCITKFEMKNLLNE 1652
            M +NNMYRVGDFVYFETS  APYQIRKIEELNKT  GAVEAK +C+YRRRD+S SL+Q A+K          +  E+  S+                      L   Q H  KHRELF++RQ+ETLPATHIRGK  VT +ND E I +Y N E+TFFY   YD  QKT+H+ + +IR+GS +Q  V  +A + +     ++    L +  N     + I  FI I RSLGT AR+ +  S    P L  + A+A+RD TL  A++   ++N     AVS + P            GG   L +DE+E W+ANE  LF +G+ KYGK F+ I N  LPWKS K ++EFYYMWK++  Y   KR K     +HKLKQVYIP++ KPNPAVL T  L       + GCESC +  S QW++WGP +L C+LC +CWSYWKRYGGL+NP      S+E  N +     +   L +  ++          ++C Q  CDK FR   QL+ H+   H+  +    +++ +  +L    K+  NG  M     F  G  +         K+ + FR+ R    +                + M L  K I KF  K++ N+
Sbjct:    1 MTTNNMYRVGDFVYFETSVTAPYQIRKIEELNKTPQGAVEAKAICYYRRRDISKSLIQQAEKHRFLEDDEFFHDSESPSSSPKIHNPKYLETNDIGYFKDSHLLNPIQCHQAKHRELFLSRQIETLPATHIRGKCNVTLYNDAEPIFDYLNKEDTFFYKFTYDPSQKTLHADRNAIRVGSDFQTQV--KAFDKKKVQKSQKPEGELAY--NLSSDKDNISQFILITRSLGTLARAFEPYSYTHNPELLFSAASASRDFTLQRAHDYWFESNGCIATAVSLILPGNIKIFIYYFWVGGCPRLFKDELEQWTANEYSLFHQGMEKYGKDFYTIRNQLLPWKSLKGIIEFYYMWKSTDKYWSAKRHKSNNTLDHKLKQVYIPSFLKPNPAVLCTKPLD----HNSHGCESCLATKSPQWYSWGPQHLSCRLCVSCWSYWKRYGGLRNPA-----SRELANEN--GPETVLNLANGEISNSDNLNQVGNFKCTQPNCDKEFRVKSQLYRHLYNIHA--VSQPGIMNGSWDILNHYSKSLNNGSSMNHLLNFPGGRGMMKPRSTLVFKINLRFRLGRVLLSDYIKPKHIAKKPNSMDSSDMELFFKKIEKFPFKSISND 597          
BLAST of Metastasis-associated protein MTA1 vs. Planmine SMEST
Match: SMESG000062477.1 (SMESG000062477.1)

HSP 1 Score: 375.17 bits (962), Expect = 5.694e-120
Identity = 240/609 (39.41%), Postives = 325/609 (53.37%), Query Frame = 3
Query:   42 MYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRRDLSNSLLQMADKEN--------NSQENLMST----------------------LTEEQLHLLKHRELFITRQLETLPATHIRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGSQYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLGTYARSLDLTSSVRQPNLXXXXXXXTRDITLTEAYNKMQQANYIFEDAVSFLTP------------GGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPKKLVEFYYMWKTSQHYLQLKRIKRCEN-EHKLKQVYIPNYTKPNPAVLFTGLLSAANPQTNXXXXXXXXXXXXQWFAWGPPNLHCKLCDTCWSYWKRYGGLKNPTRQDRQSKEFQNSSPQSNHSATMLVHKSVT-------AHLYQCPQIGCDKHFRQAVQLHNHITTTHSELLDSMELVDQNNPLLYEEFKNQKNGFFMKPSPEFKIGCKLFNE------KLRINFRMSRCFDRE----------------NRMHLALKCITKFEMKNLLNE 1652
            MYRVGDFVYFETS  APYQIRKIEELNKT  GAVEAK +C+YRRRD+S SL+Q A+K          +  E+  S+                      L   Q H  KHRELF++RQ+ETLPATHIRGK  VT +ND E I +Y N E+TFFY   YD  QKT+H+ + +IR+GS +Q  V  +A + +     ++    L +  N     + I  FI I RSLGT AR+ +  S    P L  + A+A+RD TL  A++   ++N     AVS + P            GG   L +DE+E W+ANE  LF +G+ KYGK F+ I N  LPWKS K ++EFYYMWK++  Y   KR K     +HKLKQVYIP++ KPNPAVL T  L       + GCESC +  S QW++WGP +L C+LC +CWSYWKRYGGL+NP      S+E  N +     +   L +  ++          ++C Q  CDK FR   QL+ H+   H+  +    +++ +  +L    K+  NG  M     F  G  +         K+ + FR+ R    +                + M L  K I KF  K++ N+
Sbjct:    1 MYRVGDFVYFETSVTAPYQIRKIEELNKTPQGAVEAKAICYYRRRDISKSLIQQAEKHRFLEDDEFFHDSESPSSSPKIHNPKYLETNDIGYFKDSHLLNPIQCHQAKHRELFLSRQIETLPATHIRGKCNVTLYNDAEPIFDYLNKEDTFFYKFTYDPSQKTLHADRNAIRVGSDFQTQV--KAFDKKKVQKSQKPEGELAY--NLSSDKDNISQFILITRSLGTLARAFEPYSYTHNPELLFSAASASRDFTLQRAHDYWFESNGCIATAVSLILPGNIKIFIYYFWVGGCPRLFKDELEQWTANEYSLFHQGMEKYGKDFYTIRNQLLPWKSLKGIIEFYYMWKSTDKYWSAKRHKSNNTLDHKLKQVYIPSFLKPNPAVLCTKPLD----HNSHGCESCLATKSPQWYSWGPQHLSCRLCVSCWSYWKRYGGLRNPA-----SRELANEN--GPETVLNLANGEISNSDNLNQVGNFKCTQPNCDKEFRVKSQLYRHLYNIHA--VSQPGIMNGSWDILNHYSKSLNNGSSMNHLLNFPGGRGMMKPRSTLVFKINLRFRLGRVLLSDYIKPKHIAKKPNSMDSSDMELFFKKIEKFPFKSISND 592          
The following BLAST results are available for this feature:
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTA37.895e-14850.71metastasis associated 1 family member 3 [Source:HG... [more]
MTA37.254e-14750.71metastasis associated 1 family member 3 [Source:HG... [more]
MTA39.306e-14650.71metastasis associated 1 family member 3 [Source:HG... [more]
MTA36.288e-14550.71metastasis associated 1 family member 3 [Source:HG... [more]
MTA25.599e-14350.98metastasis associated 1 family member 2 [Source:HG... [more]
back to top
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-403.256e-3733.72pep chromosome:WBcel235:V:3704995:3710124:1 gene:W... [more]
lin-403.285e-3733.72pep chromosome:WBcel235:V:3704988:3712796:1 gene:W... [more]
lin-403.285e-3733.72pep chromosome:WBcel235:V:3704995:3712771:1 gene:W... [more]
lin-403.411e-3733.72pep chromosome:WBcel235:V:3705545:3712771:1 gene:W... [more]
lin-403.411e-3733.72pep chromosome:WBcel235:V:3705545:3712796:1 gene:W... [more]
back to top
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTA1-like1.282e-11438.10gene:FBgn0027951 transcript:FBtr0078734[more]
MTA1-like2.047e-10937.66gene:FBgn0027951 transcript:FBtr0290206[more]
MTA1-like3.757e-9138.97gene:FBgn0027951 transcript:FBtr0078733[more]
MTA1-like7.394e-9138.97gene:FBgn0027951 transcript:FBtr0330315[more]
Gug4.303e-928.18gene:FBgn0010825 transcript:FBtr0333048[more]
back to top
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mta24.263e-14750.00metastasis associated 1 family, member 2 [Source:Z... [more]
mta26.738e-14749.88metastasis associated 1 family, member 2 [Source:Z... [more]
mta32.209e-14549.77metastasis associated 1 family, member 3 [Source:Z... [more]
mta32.209e-14549.77metastasis associated 1 family, member 3 [Source:Z... [more]
mta34.156e-14349.77metastasis associated 1 family, member 3 [Source:Z... [more]
back to top
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gemin61.942e-14252.07gem nuclear organelle associated protein 6 [Source... [more]
gemin65.280e-14049.76gem nuclear organelle associated protein 6 [Source... [more]
gemin61.323e-13949.76gem nuclear organelle associated protein 6 [Source... [more]
gemin63.126e-13949.76gem nuclear organelle associated protein 6 [Source... [more]
gemin65.502e-13949.76gem nuclear organelle associated protein 6 [Source... [more]
back to top
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mta38.999e-14851.18metastasis associated 3 [Source:MGI Symbol;Acc:MGI... [more]
Mta39.941e-14651.18metastasis associated 3 [Source:MGI Symbol;Acc:MGI... [more]
Mta36.740e-14551.18metastasis associated 3 [Source:MGI Symbol;Acc:MGI... [more]
Mta32.193e-14351.18metastasis associated 3 [Source:MGI Symbol;Acc:MGI... [more]
Mta23.762e-14350.74metastasis-associated gene family, member 2 [Sourc... [more]
back to top
BLAST of Metastasis-associated protein MTA1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BTC8|MTA3_HUMAN3.483e-14650.71Metastasis-associated protein MTA3 OS=Homo sapiens... [more]
sp|A6QL72|MTA3_BOVIN3.952e-14450.71Metastasis-associated protein MTA3 OS=Bos taurus O... [more]
sp|Q924K8|MTA3_MOUSE1.534e-14251.18Metastasis-associated protein MTA3 OS=Mus musculus... [more]
sp|Q9R190|MTA2_MOUSE2.632e-14250.74Metastasis-associated protein MTA2 OS=Mus musculus... [more]
sp|O94776|MTA2_HUMAN2.689e-14250.98Metastasis-associated protein MTA2 OS=Homo sapiens... [more]
back to top
BLAST of Metastasis-associated protein MTA1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1JGP34.596e-15144.56Uncharacterized protein OS=Strigamia maritima OX=1... [more]
K1P5F77.048e-15149.58Metastasis-associated protein MTA1 OS=Crassostrea ... [more]
A0A2T7NZ961.746e-14947.61Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S3HPM76.078e-14948.68metastasis-associated protein MTA3 OS=Lingula ungu... [more]
H3CG459.493e-14851.29Metastasis associated 1 family, member 2 OS=Tetrao... [more]
back to top
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mta22.077e-14749.88metastasis associated 1 family member 2 [Source:NC... [more]
mta22.703e-14749.88metastasis associated 1 family member 2 [Source:NC... [more]
mta37.680e-14550.36metastasis-associated protein MTA3 [Source:NCBI ge... [more]
mta34.061e-14350.36metastasis-associated protein MTA3 [Source:NCBI ge... [more]
mta34.823e-14350.36metastasis-associated protein MTA3 [Source:NCBI ge... [more]
back to top
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000004904.18.231e-13348.84pep scaffold:Pmarinus_7.0:GL478538:1563:25625:1 ge... [more]
ENSPMAT00000004333.14.351e-9640.97pep scaffold:Pmarinus_7.0:GL478400:3217:57231:1 ge... [more]
ENSPMAT00000001817.17.739e-2027.50pep scaffold:Pmarinus_7.0:GL481328:4843:21472:1 ge... [more]
rcor11.905e-723.56REST corepressor 1 [Source:ZFIN;Acc:ZDB-GENE-05050... [more]
back to top
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO402232.086e-10842.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296021.271e-7838.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449588.284e-1427.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333622.055e-724.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Metastasis-associated protein MTA1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mta23.946e-14750.12metastasis associated 1 family member 2 [Source:NC... [more]
mta32.661e-14448.97metastasis associated 1 family member 3 [Source:NC... [more]
mta36.638e-14448.97metastasis associated 1 family member 3 [Source:NC... [more]
mta14.265e-14049.44metastasis associated 1 [Source:NCBI gene;Acc:1011... [more]
mta21.228e-13951.25metastasis associated 1 family member 2 [Source:NC... [more]
back to top
BLAST of Metastasis-associated protein MTA1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081507.10.000e+099.55SMESG000081507.1[more]
SMESG000081507.10.000e+099.55SMESG000081507.1[more]
SMESG000062477.11.211e-12239.58SMESG000062477.1[more]
SMESG000062477.12.937e-12239.58SMESG000062477.1[more]
SMESG000062477.15.694e-12039.41SMESG000062477.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026760 ID=SMED30026760|Name=Metastasis-associated protein MTA1|organism=Schmidtea mediterranea sexual|type=transcript|length=2147bp
TCTATATAAATCTTATATGAAAACAAATGGCATCTAATAATATGTATAGA
GTAGGAGATTTCGTTTACTTCGAGACTTCAGCTGGTGCACCTTATCAGAT
TCGCAAAATTGAAGAGCTTAATAAAACAACTACGGGAGCAGTTGAAGCAA
AAGTAGTATGTTTTTATCGCCGAAGAGATTTATCTAATTCATTATTACAA
ATGGCCGATAAAGAAAATAATTCACAGGAAAATTTGATGTCGACATTAAC
AGAAGAACAATTGCATTTATTAAAACATAGAGAATTGTTCATTACCCGTC
AATTAGAAACTTTACCAGCTACTCATATTCGGGGAAAAGCTCGTGTTACA
CAATTCAATGACAATGAATTGATTCTAAATTATAGCAATACTGAAAACAC
ATTTTTTTACAACCTAGTGTATGATTGTGTACAAAAAACTGTTCACAGTG
GTAAAGGTTCAATAAGAATTGGATCGCAGTATCAGGTAAATGTTCCGCGA
CAAGCATCAGAAATTCAAAACGCAAATTACAAACGAAGAAATTATGAAAC
ACTAATGTGGGAGCCAAATAATAAAATGAGTAATGAGGAAATCGAAAATT
TTATAACAATTTGCCGATCATTGGGCACTTATGCTCGCTCACTTGATTTA
ACCAGCAGTGTTAGACAACCAAATTTAGCAGCTGCGGTCGCTGCAGCTAC
CAGGGATATCACATTAACGGAAGCATATAATAAAATGCAGCAGGCAAATT
ATATTTTTGAGGATGCTGTTTCATTTTTAACCCCCGGAGGATCTTTAACA
CTTGTTCGCGATGAAATGGAAGATTGGTCTGCTAATGAAGGGAAATTGTT
TGAAGAAGGTCTCGGAAAATATGGCAAATCCTTTCATCACATTTATAATG
ATTTTCTTCCTTGGAAGAGTCCTAAAAAGCTCGTGGAATTCTATTATATG
TGGAAAACATCACAGCATTATTTACAGTTGAAAAGAATTAAAAGATGTGA
AAATGAACATAAGCTCAAACAAGTTTACATACCAAATTATACAAAACCGA
ATCCAGCAGTTTTATTTACCGGCTTATTATCAGCAGCAAATCCTCAAACC
AACTCAGGTTGTGAAAGTTGTGGCAGTTTATCTTCAGGTCAATGGTTTGC
GTGGGGTCCCCCAAATCTCCACTGTAAACTTTGTGATACTTGTTGGAGTT
ATTGGAAACGATATGGAGGTCTTAAGAATCCAACAAGACAAGATCGTCAA
AGTAAAGAATTTCAAAATTCTTCACCTCAATCAAATCATAGTGCTACAAT
GTTAGTACATAAATCCGTGACAGCCCATTTATATCAGTGTCCCCAGATTG
GTTGTGATAAACATTTCCGACAAGCTGTTCAACTCCACAACCACATTACT
ACTACTCATTCTGAGTTATTGGACTCTATGGAACTTGTTGATCAAAATAA
TCCACTCCTGTATGAAGAGTTTAAAAATCAAAAAAATGGATTTTTCATGA
AACCATCACCTGAATTTAAAATCGGTTGTAAATTATTCAACGAAAAGTTA
CGTATAAATTTCCGAATGTCTCGGTGTTTTGATCGAGAAAATCGAATGCA
TCTAGCATTAAAGTGCATTACTAAATTTGAGATGAAAAATCTTCTCAATG
AGTTTTTTAAAAATCCTAAGTTGGATTTATTGAAAAAAAAATATATCTCA
AGGAATTTCAGTAATTTACAAGCTGTAATAGAAAAGATATCGAAAGTATG
TCCAACGGAAAAGTTATGTACCAATGAAATTGTAAATCTCAAACATTTAA
GAAGTAATAATATCAGTTCTGAGAAACAGCCAGTCATTTCGGAACACACG
CGACCGGTCAATGAAACTGACAAACGATTGTACATTAATACTGGATTTTC
CGTACCAAAAAGAAATACAATCTCTAATGAAGCCTTATGTTTGGTTCCTA
CATTTCAAGTCTCAGAAGAAATTAGGAATCTCAGATTAAAAATTGGAGCA
AGCTTTCTGAGGAAATTGAGCCGAAAGCCATTTCATCAGAATTAAAAATA
AAAATGTTCTTTAGACGTTTTTTTACAGTTTTATATATAAATAAATATAA
GGTTCTATTTTGAAATGGCATATTATGAACTTGATAGGTTAAATGTG
back to top

protein sequence of SMED30026760-orf-1

>SMED30026760-orf-1 ID=SMED30026760-orf-1|Name=SMED30026760-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=673bp
MASNNMYRVGDFVYFETSAGAPYQIRKIEELNKTTTGAVEAKVVCFYRRR
DLSNSLLQMADKENNSQENLMSTLTEEQLHLLKHRELFITRQLETLPATH
IRGKARVTQFNDNELILNYSNTENTFFYNLVYDCVQKTVHSGKGSIRIGS
QYQVNVPRQASEIQNANYKRRNYETLMWEPNNKMSNEEIENFITICRSLG
TYARSLDLTSSVRQPNLAAAVAAATRDITLTEAYNKMQQANYIFEDAVSF
LTPGGSLTLVRDEMEDWSANEGKLFEEGLGKYGKSFHHIYNDFLPWKSPK
KLVEFYYMWKTSQHYLQLKRIKRCENEHKLKQVYIPNYTKPNPAVLFTGL
LSAANPQTNSGCESCGSLSSGQWFAWGPPNLHCKLCDTCWSYWKRYGGLK
NPTRQDRQSKEFQNSSPQSNHSATMLVHKSVTAHLYQCPQIGCDKHFRQA
VQLHNHITTTHSELLDSMELVDQNNPLLYEEFKNQKNGFFMKPSPEFKIG
CKLFNEKLRINFRMSRCFDRENRMHLALKCITKFEMKNLLNEFFKNPKLD
LLKKKYISRNFSNLQAVIEKISKVCPTEKLCTNEIVNLKHLRSNNISSEK
QPVISEHTRPVNETDKRLYINTGFSVPKRNTISNEALCLVPTFQVSEEIR
NLRLKIGASFLRKLSRKPFHQN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR043151BAH_sf
IPR040138MIER/MTA
IPR000679Znf_GATA
IPR015880Znf_C2H2-like
IPR001025BAH_dom
IPR000949ELM2_dom
IPR001005SANT/Myb
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
IPR017884SANT_dom
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0008270zinc ion binding
GO:0003682chromatin binding
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 57..77
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 262..325
e-value: 1.7E-24
score: 87.4
NoneNo IPR availableGENE3DG3DSA:1.10.1740.200coord: 140..261
e-value: 4.1E-34
score: 119.5
NoneNo IPR availablePANTHERPTHR10865:SF29METASTASIS ASSOCIATED 1-LIKE, ISOFORM Dcoord: 3..606
NoneNo IPR availableCDDcd04709BAH_MTAcoord: 4..162
e-value: 5.9999E-72
score: 228.045
NoneNo IPR availableCDDcd11661SANT_MTA3_likecoord: 266..311
e-value: 1.75499E-19
score: 79.9659
NoneNo IPR availableSUPERFAMILYSSF82061BAH domaincoord: 8..133
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 436..461
e-value: 0.0012
score: 28.2
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 438..461
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 436..462
score: 9.868
IPR000949ELM2 domainSMARTSM01189ELM2_2coord: 146..200
e-value: 1.3E-9
score: 47.9
IPR000949ELM2 domainPFAMPF01448ELM2coord: 146..198
e-value: 1.2E-7
score: 32.4
IPR000949ELM2 domainPROSITEPS51156ELM2coord: 144..255
score: 16.311
IPR000679Zinc finger, GATA-typeSMARTSM00401GATA_3coord: 356..410
e-value: 6.7E-4
score: 19.4
IPR001025Bromo adjacent homology (BAH) domainSMARTSM00439BAH_4coord: 5..143
e-value: 1.2E-20
score: 84.5
IPR001025Bromo adjacent homology (BAH) domainPFAMPF01426BAHcoord: 5..138
e-value: 1.4E-25
score: 89.5
IPR001025Bromo adjacent homology (BAH) domainPROSITEPS51038BAHcoord: 5..143
score: 15.917
IPR001005SANT/Myb domainSMARTSM00717santcoord: 263..312
e-value: 0.0016
score: 27.7
IPR043151Bromo adjacent homology (BAH) domain superfamilyGENE3DG3DSA:2.30.30.490coord: 2..128
e-value: 8.7E-12
score: 46.6
IPR040138Mesoderm induction early response protein/metastasis-associated proteinPANTHERPTHR10865METASTASIS-ASSOCIATED PROTEIN AND MESODERM INDUCTION EARLY RESPONSE PROTEINcoord: 3..606
IPR017884SANT domainPROSITEPS51293SANTcoord: 262..314
score: 15.732
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 265..317