Leishmanolysin-like peptidase

Overview
NameLeishmanolysin-like peptidase
Smed IDSMED30026759
Length (bp)2359
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leishmanolysin-like peptidase (SMED30026759) t-SNE clustered cells

Violin plots show distribution of expression levels for Leishmanolysin-like peptidase (SMED30026759) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leishmanolysin-like peptidase (SMED30026759) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leishmanolysin-like peptidase (SMED30026759) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026759

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026759SMESG000008414.1 SmedASXL_014256SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30026759SMESG000008414.1 dd_Smed_v4_4448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30026759SMESG000008414.1 dd_Smed_v4_4448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026759SMESG000008414.1 dd_Smed_v6_4448_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026759SMESG000008414.1 dd_Smed_v4_5141_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30026759SMESG000008414.1 dd_Smed_v4_5141_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026759SMESG000008414.1 dd_Smed_v4_4448_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026759SMESG000008414.1 dd_Smed_v4_4448_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the epidermisSMED30026759SMESG000008414.1 dd_Smed_v4_4448_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30026759SMESG000008414.1 dd_Smed_v4_4448_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Match: LMLN (leishmanolysin like peptidase [Source:HGNC Symbol;Acc:HGNC:15991])

HSP 1 Score: 196.823 bits (499), Expect = 1.022e-52
Identity = 157/487 (32.24%), Postives = 232/487 (47.64%), Query Frame = 1
Query:  145 LTGSHVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKA-----------QNTGLLLVDRPCQQSSY-RINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINXXXXXXXXXXX--XXXXADADIVL----LVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIIT---HEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQ-FNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYM-XXXXXXXXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKI-SGLNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFT 1530
            L  S  C H +P  +E++  +    L ++   KR +  +LRI   Y  S       ELL        +NL+++ +FP+A           +  G +L+ R C  + Y R   +  + C+  C   T C    VP+++L+ C    G      +       G++DAD VL    L T        ++YA  C  EA +DRPI G  NLC N I  +++ +E V +++   HE+IHALGFS   +AFY   +G+P+ SR   G P     S   Y W+DK++  + R      +          V P V+  AR HF+CP L  ++LE+ G    G+ L+H+++  L NE MT  S+     +S ITLAL+ DTGWY  NYS    LD+G   GC    K C  ++ Q + + Q L P+C+   S    L C   +    +CNL K    L   YQYF  L G+   D+ YY GS    +YCP    F+
Sbjct:   58 LGSSPPCRHHVPSDTEVINKVH---LKANHVVKRDVDEHLRIKTVYDKSVE-----ELLPEK-----KNLVKNKLFPQAISYLEKTFQVRRPAGTILLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYRGGKWPHGAVGVPDQEGISDADFVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMI--STQPQEFVGMLSTVKHEVIHALGFSAGLFAFYHDKDGNPLTSRFADGLPPFNY-SLGLYQWSDKVVRKVERLWDVRDNKIVRHTVYLLVTPRVVEEARKHFDCPVLEGMELENQGG--VGTELNHWEKRLLENEAMTG-SHTQNRVLSRITLALMEDTGWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQKRQMLSPYCDTLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCPFSQEFS 525          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Match: LMLN (leishmanolysin like peptidase [Source:HGNC Symbol;Acc:HGNC:15991])

HSP 1 Score: 189.889 bits (481), Expect = 1.061e-50
Identity = 150/455 (32.97%), Postives = 217/455 (47.69%), Query Frame = 1
Query:  241 KRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKA-----------QNTGLLLVDRPCQQSSY-RINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINXXX--XXXXXXXXXXXXADADIVL----LVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIIT---HEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQ-FNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYM-XXXXXXXXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKI-SGLNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFT 1530
            KR +  +LRI   Y  S       ELL        +NL+++ +FP+A           +  G +L+ R C  + Y R   +  + C+  C   T C    VP+++L+ C    G              G++DAD VL    L T        ++YA  C  EA +DRPI G  NLC N I  +++ +E V +++   HE+IHALGFS   +AFY   +G+P+ SR   G P     S   Y W+DK++  + R      +          V P V+  AR HF+CP L  ++LE+ G    G+ L+H+++  L NE MT  S+     +S ITLAL+ DTGWY  NYS    LD+G   GC    K C  ++ Q + + Q L P+C+   S    L C   +    +CNL K    L   YQYF  L G+   D+ YY GS    +YCP    F+
Sbjct:   35 KRDVDEHLRIKTVYDKSVE-----ELLPEK-----KNLVKNKLFPQAISYLEKTFQVRRPAGTILLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYRGGKWPHGAVGVPDQEGISDADFVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMI--STQPQEFVGMLSTVKHEVIHALGFSAGLFAFYHDKDGNPLTSRFADGLPPFNY-SLGLYQWSDKVVRKVERLWDVRDNKIVRHTVYLLVTPRVVEEARKHFDCPVLEGMELENQGG--VGTELNHWEKRLLENEAMTG-SHTQNRVLSRITLALMEDTGWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQKRQMLSPYCDTLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCPFSQEFS 473          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Match: LMLN (leishmanolysin like peptidase [Source:HGNC Symbol;Acc:HGNC:15991])

HSP 1 Score: 157.532 bits (397), Expect = 1.360e-39
Identity = 143/486 (29.42%), Postives = 212/486 (43.62%), Query Frame = 1
Query:  145 LTGSHVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKA-----------QNTGLLLVDRPCQQSSY-RINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTIN--XXXXXXXXXXXXXXXADADIVL----LVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIIT---HEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQ-FNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXXXXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKISG-LNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFT 1530
            L  S  C H +P  +E++  +    L ++   KR +  +LRI   Y  S       ELL        +NL+++ +FP+A           +  G +L+ R C  + Y R   +  + C+  C   T C    VP+++L+ C                   G++DAD VL    L T        ++YA  C  EA +DRPI G  NLC N I  +++ +E V +++   HE+IHALGFS   +AFY   +G+P+ SR   G P     S   Y W+DK++  + R      +          V P V+  AR HF+CP L  ++LE+ G    G+ L+H+++  L NE MT  S+     +S ITLAL+ DTG                                     Q L P+C+   S    L C   +    +CNL K    L   YQYF  L G+   D+ YY GS    +YCP    F+
Sbjct:   58 LGSSPPCRHHVPSDTEVINKVH---LKANHVVKRDVDEHLRIKTVYDKSVE-----ELLPEK-----KNLVKNKLFPQAISYLEKTFQVRRPAGTILLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYRGGKWPHGAVGVPDQEGISDADFVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMI--STQPQEFVGMLSTVKHEVIHALGFSAGLFAFYHDKDGNPLTSRFADGLPPFN-YSLGLYQWSDKVVRKVERLWDVRDNKIVRHTVYLLVTPRVVEEARKHFDCPVLEGMELENQG--GVGTELNHWEKRLLENEAMTG-SHTQNRVLSRITLALMEDTG------------------------------------RQMLSPYCDTLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCPFSQEFS 488          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Match: LMLN (leishmanolysin like peptidase [Source:HGNC Symbol;Acc:HGNC:15991])

HSP 1 Score: 151.754 bits (382), Expect = 7.088e-38
Identity = 137/454 (30.18%), Postives = 199/454 (43.83%), Query Frame = 1
Query:  241 KRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKA-----------QNTGLLLVDRPCQQSSY-RINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINXXX--XXXXXXXXXXXXADADIVL----LVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIIT---HEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQ-FNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXXXXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKI-SGLNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFT 1530
            KR +  +LRI   Y  S       ELL        +NL+++ +FP+A           +  G +L+ R C  + Y R   +  + C+  C   T C    VP+++L+ C    G              G++DAD VL    L T        ++YA  C  EA +DRPI G  NLC N I  +++ +E V +++   HE+IHALGFS   +AFY   +G+P+ SR   G P     S   Y W+DK++  + R      +          V P V+  AR HF+CP L  ++LE+ G    G+ L+H+++  L NE MT  S+     +S ITLAL+ DTG                                     Q L P+C+   S    L C   +    +CNL K    L   YQYF  L G+   D+ YY GS    +YCP    F+
Sbjct:   35 KRDVDEHLRIKTVYDKSVE-----ELLPEK-----KNLVKNKLFPQAISYLEKTFQVRRPAGTILLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYRGGKWPHGAVGVPDQEGISDADFVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMI--STQPQEFVGMLSTVKHEVIHALGFSAGLFAFYHDKDGNPLTSRFADGLPPFN-YSLGLYQWSDKVVRKVERLWDVRDNKIVRHTVYLLVTPRVVEEARKHFDCPVLEGMELENQG--GVGTELNHWEKRLLENEAMTG-SHTQNRVLSRITLALMEDTG------------------------------------RQMLSPYCDTLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCPFSQEFS 436          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Celegans
Match: Y43F4A.1 (Leishmanolysin-like peptidase [Source:UniProtKB/Swiss-Prot;Acc:O62446])

HSP 1 Score: 185.267 bits (469), Expect = 2.378e-49
Identity = 155/483 (32.09%), Postives = 219/483 (45.34%), Query Frame = 1
Query:  163 CNHPIPHISEIVTGITSEPLPSHIRRKRSISPN-----------LRIYYDYQSSFTNY--PYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQS--SYRINTENIKGCSFGC-ENATCLGFPVPDKYLKVCTTINXXXXXXXXXXXXXXXADADIVLLVTY---TSCGG-ATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENV-KIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQ-FNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXX-XXLDPFC-NVPFSRGRTLA---CSLFREYFYLCNLNKISGLNPT-YQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVF 1527
            C++  P I +I+  +  E    H  R+   S +           LRI   Y  S  N        + TT++  A    ++ +  +   T + L  R C  S   Y+    N+  C  GC E  TC    +P  +L  C   N T     +G  G GV D D +L VT      C G  TL+YA  C  EA  DRPI G +NLC + + V++   E +   + HEI+HALGFSV  YAF+R   G P   RN +G P S      YY W+   ITT+ R          +   +  V P V   AR HF C  L   +LE+ G +  G+ L+H+++    NE MT        + S +TLA L DTGWY  NY    +L +G Q GC    K C  ++  +    +   P+C ++     +++A   C+  R+   LCNL       P+ Y+ F SL GVNP   +YY GS    +YCP    F
Sbjct:   26 CSYQNPRIEDILLEVPIEHEHPHRHRRGLPSSDPTSPPVEKFAPLRIQLHYDKSIQNLTAEVQNFVNTTLLPEAVGYWENALRVRPMTTPIRL-RRKCISSFYYYKQGMRNV-ACDKGCRERTTCGEADIPRDHLLDCLACNNTDDCKTTGELGEGVKDTDFILYVTAHDSKRCEGPETLSYAAHCQQEADFDRPIAGNVNLCPSALSVHNHDYEILTSTVKHEILHALGFSVGLYAFFRDSEGKPRTKRNRYGRPTSLNKQKGYYDWDSNTITTVLRENWWTGEGKVIHPIHMMVTPKVREEARRHFGCDKLEGAELENQGGE--GTYLTHWEKRAYENEAMTGTHTQNPVY-SRLTLAFLEDTGWYQPNYEVAEDLHWGKQLGCDFAMKSCGEWIHEKKILGEDAYPYCSDIKHDGSKSMAITRCTTQRDSLALCNLVPFQKELPSQYRNFMSLPGVNPDGAKYYGGSVEMADYCPFLQEF 503          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Fly
Match: Invadolysin (gene:FBgn0086359 transcript:FBtr0082181)

HSP 1 Score: 181.415 bits (459), Expect = 7.400e-48
Identity = 149/485 (30.72%), Postives = 219/485 (45.15%), Query Frame = 1
Query:  154 SHVCNHPIPHISEIVTGITSEPLPS----------HIRRKRSISPN--LRIYYDYQSSFTNYPYAE--LLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINXXXXXXXXXXXXX---XXADADIVLLV----TYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVN-SKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNI-FGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMX-XXXXXXXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKIS-GLNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFT 1530
            +H C H  P   E+V G+  +   S          H  R+RS++    LRI   Y  S       +  L+  TV+  A    +  +  + +  G++ ++R C  +   +   +   C   C+  T C    VPD +L VC   N TG   +  S      G+ +AD V  V    T     G T+AYA  C  EA LDRPI G  NLC  +I     +++  +  + HEI+HALGFSV  YAF+R  +G P   R +  G P        +   N+ I   +  + +      +   +  V P V+   R HFNC  L   +LED G +  G+AL+H+++  L NE MT        F S ITLAL+ D+GWY  NYS    L +G   GC    + C  ++Q + ++ +S+ PFC+          C+  R    LCNL +    L   YQ F SL  V   +  +Y GS    ++CP    FT
Sbjct:   32 AHNCQHQHPKAHEVVHGVRIQLADSEDDSAGDPARHSVRRRSVAAEQPLRILLVYDESVYRLEEEKFNLINDTVLPEAVQFWEQALMVR-ETKGVIRLNRKCDSTQVYVKNGHTH-CIDHCKATTMCGEVQVPDAHLDVCRVCNATGQNCRIDSNTQPGEGIENADFVFYVSARQTQRCFKGLTVAYAAHCQQEAALDRPIAGHANLCPESISTKPQELQTLISTVKHEILHALGFSVSLYAFFRDDDGKPRTPRKLDTGKPYLNEKLQIHQWSNETIRKVVRENWSVRGGHVNKVVDMMVTPRVIAEVRAHFNCNKLEGAELEDQGGE--GTALTHWEKRILENEAMTGTHTQSPVF-SRITLALMEDSGWYRANYSMATPLTWGKGLGCAFAMRSCKDWIQYNHARGRSIHPFCSKVKQDPLQTECTDDRNSVALCNLIRHEFELPKGYQNFDSLNHVKDGEEGFYGGSVSLADHCPYIQEFT 511          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Zebrafish
Match: lmln (leishmanolysin-like (metallopeptidase M8 family) [Source:ZFIN;Acc:ZDB-GENE-081104-298])

HSP 1 Score: 202.986 bits (515), Expect = 3.005e-55
Identity = 158/473 (33.40%), Postives = 222/473 (46.93%), Query Frame = 1
Query:  154 SHVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAE--LLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSY-RINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINXXXXXXXXXX--XXXXXADADIVLLV---TYTSCGGATL-AYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENV-KIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQ-FNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXXX-XLDPFCNVPFSRGRTLACSLFREYFYLCNLNKISGLNPT-YQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFT 1530
            +H C+H +P  +E++  +  +P       KRS    L I  +Y SS      A+  L+K  ++  A + LQ   F   + +G +L+ R C  + Y R   +  + C   C N T C    VP+ +L+ C   + +G          G GVA AD VL V   T   CG   + AYA  C  E+ LDRPI G  NLC N I    +  E +   + HEIIHALGFS   +AFY    G P+  R+  G P     S   Y W+DK+I   +R              +    P V+  AR HFNCP L  ++LE+ G    G+ L+H+++  L NE MT  S+      S ITLA++ DTGWY  NYS   NL +G   GC    K C  ++      + +L P+C+   S    L C   +    +CNL K S   P  YQYF  + GV   D+  Y G+    +YCP    F+
Sbjct:   33 THTCDHKVPLHTEVIHKVFLKP---DRLTKRSTDQQLNIKIEYDSSLDGLDEAKSSLVKDKLLPQAIDYLQK-AFRVRRQSGPILLSRQCATNQYLRKRDDPHRYCQGPCANVTKCGPVVVPEHHLQQCRVCSESGKSCGPVGPPDGEGVARADFVLYVSAMTTERCGQENIVAYAAYCQLESELDRPIAGYANLCPNMISTQPQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDGGKPLTPRSASGLPAYNE-SLGLYQWSDKVIKRATRLWDIRGGQMVRHTVHLLATPRVVEEARRHFNCPILEGMELENQGG--AGTELNHWEKRLLENEAMTG-SHTQNRVFSRITLAIMEDTGWYRANYSMAENLQWGRGLGCDFVMKSCKFWIDQHRHKRPTLSPYCDSVRSAPLQLTCRQDQLAVAVCNLQKFSNALPAEYQYFDHIPGVPKEDLSAYGGAVEIADYCPFSQEFS 497          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Zebrafish
Match: lmln (leishmanolysin-like (metallopeptidase M8 family) [Source:ZFIN;Acc:ZDB-GENE-081104-298])

HSP 1 Score: 197.593 bits (501), Expect = 1.141e-53
Identity = 152/443 (34.31%), Postives = 207/443 (46.73%), Query Frame = 1
Query:  241 KRSISPNLRIYYDYQSSFTNYPYAE--LLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSY-RINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINXXXXXXXXXX--XXXXXADADIVLLV---TYTSCGGATL-AYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKEN-VKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQ-FNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXXXXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKISGLNPT-YQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFT 1530
            KRS    L I  +Y SS      A+  L+K  ++  A + LQ   F   + +G +L+ R C  + Y R   +  + C   C N T C    VP+ +L+ C   + +G          G GVA AD VL V   T   CG   + AYA  C  E+ LDRPI G  NLC N I    +  E  +  + HEIIHALGFS   +AFY    G P+  R+  G P     S   Y W+DK+I   +R              +    P V+  AR HFNCP L  ++LE+ G    G+ L+H+++  L NE MT  S+      S ITLA++ DTGWY  NYS   NL +G   GC    K C  ++       +L P+C+   S    L C   +    +CNL K S   P  YQYF  + GV   D+  Y G+    +YCP    F+
Sbjct:   15 KRSTDQQLNIKIEYDSSLDGLDEAKSSLVKDKLLPQAIDYLQK-AFRVRRQSGPILLSRQCATNQYLRKRDDPHRYCQGPCANVTKCGPVVVPEHHLQQCRVCSESGKSCGPVGPPDGEGVARADFVLYVSAMTTERCGQENIVAYAAYCQLESELDRPIAGYANLCPNMISTQPQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDGGKPLTPRSASGLPAYNE-SLGLYQWSDKVIKRATRLWDIRGGQMVRHTVHLLATPRVVEEARRHFNCPILEGMELENQGG--AGTELNHWEKRLLENEAMTG-SHTQNRVFSRITLAIMEDTGWYRANYSMAENLQWGRGLGCDFVMKSCKFWIDQHRHKPTLSPYCDSVRSAPLQLTCRQDQLAVAVCNLQKFSNALPAEYQYFDHIPGVPKEDLSAYGGAVEIADYCPFSQEFS 452          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Xenopus
Match: LMLN (leishmanolysin-like (metallopeptidase M8 family) [Source:NCBI gene;Acc:100487583])

HSP 1 Score: 69.3218 bits (168), Expect = 1.246e-11
Identity = 59/169 (34.91%), Postives = 85/169 (50.30%), Query Frame = 1
Query:  394 LLLVDRPCQQSSY-RINTENIKGCSFGCENATCLG-FPVPDKYLKVCTTINXXXXX--XXXXXXXXXXADADIVLLV---TYTSCGGATL-AYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIIT---HEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFP 867
            +L  +R C  + Y +   +  + C   C  +T  G   VP+++L+ C   + T           G G+ D D VL V   T   C    + AYA  C  EA +DRPI G  NLC N I  +++ +E V +++   HEIIHALGFS   +AFY   +G+P+  R I G P
Sbjct:   10 ILCHNRQCATNQYLKKRDDPHRYCHGACSESTRSGPVIVPEEHLQQCRVCSETQWHCGPSGPPDGPGIPDTDFVLYVSAMTTERCSQENIVAYAAYCQLEAEMDRPIAGYANLCPNMI--STQPQEFVGMLSTVKHEIIHALGFSAGLFAFYYDDDGNPLTPRYINGLP 176          

HSP 2 Score: 63.1586 bits (152), Expect = 9.266e-10
Identity = 41/137 (29.93%), Postives = 62/137 (45.26%), Query Frame = 1
Query: 1123 MTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXX-XXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKI-SGLNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVF 1527
            +TP   NG+ +          +  WY  NYS    LD+G ++GC    K C  ++    +  Q L PFC+   S    L C   ++   +CNL +  S L   YQYF  + GV   D+ +Y G+    ++CP    F
Sbjct:  167 LTPRYINGLPYF---------NERWYRANYSMAERLDWGRRQGCDFAMKSCKFWIDKLKRKNQRLSPFCDTVRSNPLQLTCRQDQKAVAICNLQRFASPLPQEYQYFDDIPGVLADDLPHYGGAVEIADFCPFAQEF 294          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Mouse
Match: Lmln (leishmanolysin-like (metallopeptidase M8 family) [Source:MGI Symbol;Acc:MGI:2444736])

HSP 1 Score: 191.43 bits (485), Expect = 4.555e-51
Identity = 151/479 (31.52%), Postives = 218/479 (45.51%), Query Frame = 1
Query:  163 CNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKA-----------QNTGLLLVDRPCQQSSY-RINTENIKGCSFGCE-NATCLGFPVPDKYLKVCTTINXXXX--XXXXXXXXXXXADADIVL----LVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVN-SKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQ-FNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXXXXL-DPFCNVPFSRGRTLACSLFREYFYLCNLNKISG-LNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFT 1530
            C H +   +E++  +    L ++   KR    +LRI   Y  S       ELL        R L+++ +FP+A           +  G +L+ R C  + Y R   +  + C+  C  +  C    VP+++L+ C                   GV DAD VL    L T        ++YA  C  EA +DRPI G  NLC N I     +    +  + HEIIHALGFS   +AFY   +G+P+ SR+  G P     S   Y W+DK++  + R      +          V P V+  AR HFNCP L  ++LE+ G    G+ L+H+++  L NE MT  S+     +S ITLAL+ DTGWY  NYS    LD+G   GC    K C  ++    Q + +  P+C+   S    L C   +    +CNL +    L P YQYF  L G+   D+ YY GS    +YCP    F+
Sbjct:   53 CRHHVLSDTEVINKVH---LKTNHVTKRDADGHLRIKTIYDQSIE-----ELLPEK-----RYLVKNKLFPQAISYLEKTFQVRRPAGRILLSRQCATNQYLRKENDPHRYCTGECAVHTKCGPVIVPEEHLQQCRVCREGKWPCGAVGVLDPEGVRDADFVLYVGALATERCSHENIISYAAYCQQEAKMDRPIAGYANLCPNMISTQPQEFIGMLSTVKHEIIHALGFSAGLFAFYHDQDGNPLTSRSADGLPPFNY-SLGLYQWSDKVVRKVERLWNVRDNKIVRHTVYLLVTPRVVEEARKHFNCPVLEGMELENQGG--MGTELNHWEKRLLENEAMTG-SHTQNRVLSRITLALMEDTGWYKANYSMAEKLDWGRGLGCEFVRKSCKFWIDQHRQRRQVPSPYCDTLRSNPLQLTCRQDQRAVAVCNLQRFPNPLPPEYQYFDELTGIPAEDLPYYGGSVEIADYCPFSQEFS 514          
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Match: sp|Q8BMN4|LMLN_MOUSE (Leishmanolysin-like peptidase OS=Mus musculus OX=10090 GN=Lmln PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 3.186e-50
Identity = 151/479 (31.52%), Postives = 218/479 (45.51%), Query Frame = 1
Query:  163 CNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKA-----------QNTGLLLVDRPCQQSSY-RINTENIKGCSFGCE-NATCLGFPVPDKYLKVCTTINXXXX--XXXXXXXXXXXADADIVL----LVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVN-SKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQ-FNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXXXXL-DPFCNVPFSRGRTLACSLFREYFYLCNLNKISG-LNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFT 1530
            C H +   +E++  +    L ++   KR    +LRI   Y  S       ELL        R L+++ +FP+A           +  G +L+ R C  + Y R   +  + C+  C  +  C    VP+++L+ C                   GV DAD VL    L T        ++YA  C  EA +DRPI G  NLC N I     +    +  + HEIIHALGFS   +AFY   +G+P+ SR+  G P     S   Y W+DK++  + R      +          V P V+  AR HFNCP L  ++LE+ G    G+ L+H+++  L NE MT  S+     +S ITLAL+ DTGWY  NYS    LD+G   GC    K C  ++    Q + +  P+C+   S    L C   +    +CNL +    L P YQYF  L G+   D+ YY GS    +YCP    F+
Sbjct:   53 CRHHVLSDTEVINKVH---LKTNHVTKRDADGHLRIKTIYDQSIE-----ELLPEK-----RYLVKNKLFPQAISYLEKTFQVRRPAGRILLSRQCATNQYLRKENDPHRYCTGECAVHTKCGPVIVPEEHLQQCRVCREGKWPCGAVGVLDPEGVRDADFVLYVGALATERCSHENIISYAAYCQQEAKMDRPIAGYANLCPNMISTQPQEFIGMLSTVKHEIIHALGFSAGLFAFYHDQDGNPLTSRSADGLPPFNY-SLGLYQWSDKVVRKVERLWNVRDNKIVRHTVYLLVTPRVVEEARKHFNCPVLEGMELENQGG--MGTELNHWEKRLLENEAMTG-SHTQNRVLSRITLALMEDTGWYKANYSMAEKLDWGRGLGCEFVRKSCKFWIDQHRQRRQVPSPYCDTLRSNPLQLTCRQDQRAVAVCNLQRFPNPLPPEYQYFDELTGIPAEDLPYYGGSVEIADYCPFSQEFS 514          
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Match: sp|Q61YG1|LMLN_CAEBR (Leishmanolysin-like peptidase OS=Caenorhabditis briggsae OX=6238 GN=CBG03556 PE=3 SV=2)

HSP 1 Score: 186.037 bits (471), Expect = 1.657e-48
Identity = 147/439 (33.49%), Postives = 206/439 (46.92%), Query Frame = 1
Query:  262 LRIYYDYQSSFTNY--PYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQS--SYRINTENIKGCSFGC-ENATCLGFPVPDKYLKVCTTINXXXXXXXXXXXXXXXADADIVLLVTY---TSCGG-ATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENV-KIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQ-FNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXX-XXLDPFC-NVPFSRGRTLA---CSLFREYFYLCNLNKISG-LNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVF 1527
            LRI   Y  S  N        + TT++  A    ++ +  +   T + L  R C  S   Y+    N+  C  GC E  TC    +P+ +L  C   N T     +G  G GV ++D +L VT      C G  TL+YA  C  EA  DRPI G +NLC + + V++   E +   + HEI+HALGFSV  YAF+R  +G P   RN +G P S      YY W+   ITT+ R          +      V P V   AR HF C  L   +LE+ G +  G+ L+H+++    NE MT        + S +TLA L DTGWY  NY    +L +G Q GC    K C  ++  +    +   P+C ++     +++A   C+  R+   LCNL      L P Y+ F SL GVNP   +YY GS    +YCP    F
Sbjct:   70 LRIQLHYDKSIQNLTAEVQHFVNTTLLPEAVGYWENALRVRPMKTPIRL-RRKCISSFYYYKQGMRNV-ACDKGCRERTTCGEADIPNDHLLDCLACNNTDDCQTTGEMGEGVKESDFILYVTAHNSKRCEGPETLSYAAHCQQEADFDRPIAGNVNLCPSALSVHNHDYEILTSTVKHEILHALGFSVGLYAFFRDKDGKPRTKRNRYGRPTSLNKQRGYYDWDKNTITTVLREEWWTGEGKVIHPIQMMVTPKVREEARRHFGCDKLEGAELENQGGE--GTVLTHWEKRAYENEAMTGTHTQNPVY-SRLTLAFLEDTGWYQPNYEVAEDLHWGKQLGCDFAMKSCGEWIHQKRILGEDAYPYCSDIKHDGTKSMAITRCTSQRDSLALCNLIPFQKELPPQYRNFMSLPGVNPDGAKYYGGSVEMADYCPFLQEF 503          
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Match: sp|O62446|LMLN_CAEEL (Leishmanolysin-like peptidase OS=Caenorhabditis elegans OX=6239 GN=Y43F4A.1 PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 3.025e-48
Identity = 155/483 (32.09%), Postives = 219/483 (45.34%), Query Frame = 1
Query:  163 CNHPIPHISEIVTGITSEPLPSHIRRKRSISPN-----------LRIYYDYQSSFTNY--PYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQS--SYRINTENIKGCSFGC-ENATCLGFPVPDKYLKVCTTINXXXXXXXXXXXXXXXADADIVLLVTY---TSCGG-ATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENV-KIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQ-FNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXX-XXLDPFC-NVPFSRGRTLA---CSLFREYFYLCNLNKISGLNPT-YQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVF 1527
            C++  P I +I+  +  E    H  R+   S +           LRI   Y  S  N        + TT++  A    ++ +  +   T + L  R C  S   Y+    N+  C  GC E  TC    +P  +L  C   N T     +G  G GV D D +L VT      C G  TL+YA  C  EA  DRPI G +NLC + + V++   E +   + HEI+HALGFSV  YAF+R   G P   RN +G P S      YY W+   ITT+ R          +   +  V P V   AR HF C  L   +LE+ G +  G+ L+H+++    NE MT        + S +TLA L DTGWY  NY    +L +G Q GC    K C  ++  +    +   P+C ++     +++A   C+  R+   LCNL       P+ Y+ F SL GVNP   +YY GS    +YCP    F
Sbjct:   26 CSYQNPRIEDILLEVPIEHEHPHRHRRGLPSSDPTSPPVEKFAPLRIQLHYDKSIQNLTAEVQNFVNTTLLPEAVGYWENALRVRPMTTPIRL-RRKCISSFYYYKQGMRNV-ACDKGCRERTTCGEADIPRDHLLDCLACNNTDDCKTTGELGEGVKDTDFILYVTAHDSKRCEGPETLSYAAHCQQEADFDRPIAGNVNLCPSALSVHNHDYEILTSTVKHEILHALGFSVGLYAFFRDSEGKPRTKRNRYGRPTSLNKQKGYYDWDSNTITTVLRENWWTGEGKVIHPIHMMVTPKVREEARRHFGCDKLEGAELENQGGE--GTYLTHWEKRAYENEAMTGTHTQNPVY-SRLTLAFLEDTGWYQPNYEVAEDLHWGKQLGCDFAMKSCGEWIHEKKILGEDAYPYCSDIKHDGSKSMAITRCTTQRDSLALCNLVPFQKELPSQYRNFMSLPGVNPDGAKYYGGSVEMADYCPFLQEF 503          
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Match: sp|Q29AK2|LMLN_DROPS (Leishmanolysin-like peptidase OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA17800 PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 4.586e-47
Identity = 165/588 (28.06%), Postives = 248/588 (42.18%), Query Frame = 1
Query:  136 CWKLT--GSHVCNHPIPHISEIVTGITSE-------------PLPSHIRRKRSISPN--LRIYYDYQSSFTNYPYAE--LLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINXXXXXXXXXXXXX---XXADADIVLLV----TYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVN-SKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSR-NIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXX-XXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKIS-GLNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFTDPSFXXXXXXXXXX------XXXXXXXXSYFGPDSMCFSN--------YIQNPSSGSYYGASCQKYTKNSLTGGYTVYIANSVFSCPSPTRQ 1764
            CW L    +H C H  P   E+V G+  +                 H  R+RS++    LRI   Y  S       +  L+  TV+  A    +  +  + +  G++ ++R C  +   +   +   C   C+  T C    VP+++L VC   N TG   +  S      G+ +AD V  V    T     G T+AYA  C  EA LDRPI G  NLC  +I     +++  +  + HEI+HALGFSV  YAF+R   G P   R +  G P        +   N+ I   +  + +      + + +  V P V+  AR HF+C  L   +LED G +  G+AL+H+++  L NE MT        F S ITLAL+ D+GWY  NYS    L +G   GC    + C  ++Q      +S+ PFC+          C+  R    LCNL +    L  +YQ F SL  V   +  +Y GS    ++CP    FT  S       ++            N     +G  S CF +                 ++G+ C KYT     G   + + N  + C  P ++
Sbjct:   21 CWLLATANAHNCQHQHPKAHEVVHGVRIQLADSDDDDAAGSSDAAVHSVRRRSVTAEQPLRILLVYDDSVYRLEEEKFNLINDTVLPEAVQFWEQALMVR-ETKGIIRLNRKCDSTQVYVKNGHTH-CIDQCKATTMCGEVQVPNEHLDVCRVCNATGQNCRIDSNTQPGDGIQNADFVFYVSARQTQRCFKGLTVAYAAHCQQEAALDRPIAGHANLCPESISTKPQELQTLISTVKHEILHALGFSVSLYAFFRDDEGRPRTPRKSETGKPFLNEKLQIHQWSNETIRKVVRENWSVRGGHVNKEVDMMVTPRVVAEARAHFDCDKLEGAELEDQGGE--GTALTHWEKRILENEAMTGTHTQSPVF-SRITLALMEDSGWYRANYSMATPLSWGKGLGCSFAMRSCKDWIQMNHARGRSIHPFCSKVKQDPLQTECTDDRNSVALCNLIRHDYELPKSYQNFDSLQNVKSGEEGFYGGSVSLADHCPYIQEFTWRSKNIIVRGSHCRFVENNPKPEKNFALESYGHGSKCFDHSEAMWEERSCHQTREWQHWGSGCYKYT--CFDGRLHILVGNYTYKCSFPGQK 601          
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Match: sp|Q9VH19|LMLN_DROME (Leishmanolysin-like peptidase OS=Drosophila melanogaster OX=7227 GN=Invadolysin PE=2 SV=2)

HSP 1 Score: 181.415 bits (459), Expect = 7.418e-47
Identity = 149/485 (30.72%), Postives = 219/485 (45.15%), Query Frame = 1
Query:  154 SHVCNHPIPHISEIVTGITSEPLPS----------HIRRKRSISPN--LRIYYDYQSSFTNYPYAE--LLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINXXXXXXXXXXXXX---XXADADIVLLV----TYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVN-SKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNI-FGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMX-XXXXXXXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKIS-GLNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFT 1530
            +H C H  P   E+V G+  +   S          H  R+RS++    LRI   Y  S       +  L+  TV+  A    +  +  + +  G++ ++R C  +   +   +   C   C+  T C    VPD +L VC   N TG   +  S      G+ +AD V  V    T     G T+AYA  C  EA LDRPI G  NLC  +I     +++  +  + HEI+HALGFSV  YAF+R  +G P   R +  G P        +   N+ I   +  + +      +   +  V P V+   R HFNC  L   +LED G +  G+AL+H+++  L NE MT        F S ITLAL+ D+GWY  NYS    L +G   GC    + C  ++Q + ++ +S+ PFC+          C+  R    LCNL +    L   YQ F SL  V   +  +Y GS    ++CP    FT
Sbjct:   32 AHNCQHQHPKAHEVVHGVRIQLADSEDDSAGDPARHSVRRRSVAAEQPLRILLVYDESVYRLEEEKFNLINDTVLPEAVQFWEQALMVR-ETKGVIRLNRKCDSTQVYVKNGHTH-CIDHCKATTMCGEVQVPDAHLDVCRVCNATGQNCRIDSNTQPGEGIENADFVFYVSARQTQRCFKGLTVAYAAHCQQEAALDRPIAGHANLCPESISTKPQELQTLISTVKHEILHALGFSVSLYAFFRDDDGKPRTPRKLDTGKPYLNEKLQIHQWSNETIRKVVRENWSVRGGHVNKVVDMMVTPRVIAEVRAHFNCNKLEGAELEDQGGE--GTALTHWEKRILENEAMTGTHTQSPVF-SRITLALMEDSGWYRANYSMATPLTWGKGLGCAFAMRSCKDWIQYNHARGRSIHPFCSKVKQDPLQTECTDDRNSVALCNLIRHEFELPKGYQNFDSLNHVKDGEEGFYGGSVSLADHCPYIQEFT 511          
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Match: A0A1S3IM89 (Leishmanolysin-like peptidase OS=Lingula unguis OX=7574 GN=LOC106165097 PE=3 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.674e-56
Identity = 183/544 (33.64%), Postives = 260/544 (47.79%), Query Frame = 1
Query:  160 VCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYP--YAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSS--YRINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINXXXXXXXXXXXXXXXADADIVLLVTYTSCGG----ATLAYAGSCFGEATLDRPILGVINLCSNTIQVN-SKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIF-GFPNSGVVSNSYYMWNDKXXXXXXXXXXXXX-XXXXLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXX-XXXXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKISGLNP-TYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVF-------TDPSFXXXXXXXXXXXXXXXXXXSYFGPDSMCFSNY-------IQNPSSGSYYGASCQKYTKNSLTG 1707
            VCNH IP   E++  ++ EPL  H+ +KRSI+  LRI   + SS    P     L+K  ++  A +  ++ +  + Q  G + ++R C Q+   YR        C  GCE  T C   PVP  +L+ C  I   G   ++G  G GV +AD VL V+  +        T+AYA  C  E ++DRP+ G INLC  +I      + E V  I HEI+HALGFS   +A YR  NGDP+  R+IF G P         Y W+ K++ T+SR    V  +     F   V P V   AR HFNC TL   +LE+ G+   G+ L+H+++    +E MT         IS ITLAL+ DTGWY VNY+    L +G   GC   +K C  +++ ++ Q +S+ PFC    S      C+  R+   LCNL +     P  YQYF+   G  P     Y GS    +YCP    F       T          +N      N     +GP+S CF ++          P+   ++G+ C KY+ NS  G
Sbjct:   23 VCNHYIPAQHEVLHDVSLEPL--HLMKKRSINQRLRIREVFHSSVNRLPPDKLTLVKHRLLPAALSYWENTLVVR-QTAGPIRLNRNCSQNDIIYRAGYYP-PYCVHGCEQTTYCGHVPVPYDHLEACR-IYQDGHYHETGYAGRGVLNADFVLYVSAVASSKCDPEVTVAYAAYCQLEGSMDRPVAGFINLCPYSISTKLHDMTEMVSTIKHEILHALGFSAGLFAMYRDKNGDPLTERDIFTGRPEMFNNELGVYQWSSKVVRTVSRRDWRVRGAVIQRHFYLMVTPKVTEEARRHFNCSTLEGAELENQGSI--GTKLTHWEKRVFEHEAMTGTYTQNPK-ISRITLALMEDTGWYRVNYAMAEPLQWGKNLGCDFVKKSCMEWIKMRTEQKKSILPFCTKVKSTPLRTLCTTDRDAVALCNLKQYPKPIPFMYQYFSETSGDLPGTAAQYGGSVGLADYCPYVQEFVWRDRTDTIQRGSRCTLSSNTAEVHGNHFLETYGPNSKCFEHHGIWSLKRCNMPAPLKHFGSGCYKYSCNSTVG 558          
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Match: A0A1B6E3E1 (Leishmanolysin-like peptidase (Fragment) OS=Clastoptera arizonana OX=38151 GN=g.26426 PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 4.723e-56
Identity = 165/472 (34.96%), Postives = 236/472 (50.00%), Query Frame = 1
Query:  163 CNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRI--YYDYQSSFTNYPYAELLKTTVMEPARNLL-QSLIFPKAQNTGLLLVDRPCQ--QSSYRINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINXXXXX--XXXXXXXXXXADADIVLLV----TYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENV-KIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXX-XXXXLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXX-XXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKISGLNPT-YQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFT 1530
            C+H  P  +E+V G+  EP  +H+ RKR++   LRI  YYD+     +    EL+  TV+  A +   Q+L+  K ++  ++ ++R C+  Q  YR   +    C   CE  T C    VP+++L++C T N TG          G G+ADAD V  V    T     G T+AYA  C  EA LDRPI G  NLC ++I    +  E +   + HEI+HALGFSV  +AFYR   G+P+ +R   G P       +   W+DK+I T+ R    V       +    V P V+   R HFNC TL   +LED G +  G+AL+H+++    NE MT        + S +TLAL+ DTGWYT NYS    L +G   GC   +  C  +M ++    +S+ PFC+          C+  R    LCNL + + + P  YQ F S+  V+     YY GS    +YCP    FT
Sbjct:   46 CSHVHPTPNEVVYGVHLEP--AHVMRKRNVDQPLRILLYYDFSVYRLDKEKFELINNTVLPEAVHFWEQALMVRKTES--IIRLNRKCENNQVFYR-KGDPYSYCKNACEEKTMCGEVQVPEQHLEICRTCNATGMDCGAADSKVGEGIADADFVFYVSAMQTERCHKGLTVAYAAHCQQEAALDRPIAGHANLCPDSISTKPQELEILLSTVKHEILHALGFSVSLFAFYRDSKGNPLTAREDNGKPRLNEKLQAR-QWSDKVIKTVVRKNWVVHGEVVDREVQLMVTPKVVDEVRRHFNCSTLEGAELEDQGEE--GTALTHWEKRVFENEAMTGTHTQNPVY-SRLTLALMEDTGWYTANYSMAQYLSWGRNLGCDFVKTSCKQWMDTKRTQGKSIHPFCDKVKRDPLETECTDDRSSVALCNLVEHTTVLPKFYQNFDSIPHVSKGQEGYYGGSVSLADYCPYIQEFT 508          
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Match: A0A1D2NG41 (Leishmanolysin-like peptidase (Fragment) OS=Orchesella cincta OX=48709 GN=Ocin01_02459 PE=3 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.100e-55
Identity = 163/471 (34.61%), Postives = 227/471 (48.20%), Query Frame = 1
Query:  163 CNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRI--YYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDR-PCQQSSYRINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINXXXX---XXXXXXXXXXXADADIVL----LVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVN-SKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXX-XXXLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXXXXLD-PFCNVPFSRGRTLACSLFREYFYLCNLNK-ISGLNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFT 1530
            C+H  P   EIV G   EP   H+ +KRSI   LRI  YYD      +    EL+  TV+  A +  +  +  +     ++L  R P QQ  Y+ +  +   C   CE  T C    VP+ +L VC   N  G    V  + + G G+ADAD V     L T+    G T+AYA  C  E+ LDRPI G  NLC  +I     ++   +  + HEI+HALGFSV  YAFYR   G+P+  R+  G P       +   W+D++I  + R    V   + + +    V P V+   R HFNCP L   +LED G +  G+AL+H+++    NE MT        + S ITLAL+ DTGWY  NY    +LD+G++ GC   +K C  +M +         P+CN   +      C+       LCNL K  S L+  YQ F  L  V   +V +Y GS    +YCP    FT
Sbjct:  220 CSHVYPRPHEIVHGAFIEP--HHVMKKRSIDQPLRIVLYYDESVHNLDQEKKELINNTVLPEAISYWERALKVRRTERSIVLNRRCPNQQVYYKADDPH-PYCKVECEAKTMCGEVQVPEDHLDVCRVCNENGTNCRVAPNSTAGEGIADADFVFYVSALQTHRCKHGFTVAYAAHCQQESALDRPIAGHANLCPKSISTKPQELDTLISTVKHEILHALGFSVSLYAFYRDDAGNPLTPRDNKGKPPLNAEMQAR-QWSDRVIKMVERKDWKVREGNITRKMQMIVTPRVVKEVRRHFNCPDLEGAELEDQGEE--GTALTHWEKRIFENEAMTGTHTQNPVY-SRITLALMEDTGWYRANYDMAQHLDWGHRLGCDFAKKSCMEWMSTAKARGQDPLPYCNKVKAEPLETQCTDDHSSVALCNLVKYTSPLSMEYQNFDWLPNVPDDNVTFYGGSVTLADYCPYVQEFT 683          
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Match: A0A1S3IL60 (Leishmanolysin-like peptidase OS=Lingula unguis OX=7574 GN=LOC106165073 PE=3 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 3.067e-55
Identity = 182/546 (33.33%), Postives = 257/546 (47.07%), Query Frame = 1
Query:  154 SHVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYP--YAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSS--YRINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINXXXXXXXXXXXXXXXADADIVLLVTYTSCGG----ATLAYAGSCFGEATLDRPILGVINLCSNTIQVN-SKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIF-GFPNSGVVSNSYYMWNDKXXXXXXXXXXXXX-XXXXLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXX-XXXXXXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKISGLNP-TYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVF-------TDPSFXXXXXXXXXXXXXXXXXXSYFGPDSMCFSNY-------IQNPSSGSYYGASCQKYTKNSLTG 1707
              VCNH IP   E++  ++ EPL  H+ +KRSI+  LRI   + SS    P     L+K  ++  A +  ++ +  + Q  G + ++R C Q+   YR        C  GCE  T C   PVP  +L+ C  I   G   ++G  G GV +AD VL V+  +        T+AYA  C  E ++DRP+ G INLC  +I      + E V  I HEI+HALGFS   +A YR  NGDP+  R+IF G P         Y W+ K++ T+SR    V  +     F   V P V   AR HFNC TL   +LE+ G+   G+ L+H+++    +E MT         IS ITLAL+ DTGWY VNY+    L +G   GC   +K C  +++    Q +S+ PFC    S      C+  R+   LCNL +     P  YQYF+      P     Y GS    +YCP    F       T          +N      N     +GP+S CF ++          P+   ++G+ C KY+ NS  G
Sbjct:   21 ERVCNHYIPAQHEVLHDVSLEPL--HLMKKRSINQRLRIREVFHSSVNRLPPDKLTLVKHRLLPAALSYWENTLVVR-QTAGPIRLNRNCSQNDIIYRAGYYP-PYCVHGCEQTTYCGHVPVPYDHLEACR-IYQDGHYHETGYAGRGVLNADFVLYVSAVASSKCDPEVTVAYAAYCQLEGSMDRPVAGFINLCPYSISTKLHDMTEMVSTIKHEILHALGFSAGLFAMYRDKNGDPLTERDIFTGRPEMFNNELGVYQWSSKVVRTVSRRDWRVRGAVIQRHFYLMVTPKVTEEARRHFNCSTLEGAELENQGSI--GTKLTHWEKRVFEHEAMTGTYTQNPK-ISRITLALMEDTGWYRVNYAMAEPLQWGKNLGCDFVKKSCMEWIKMRTEQKKSILPFCTKVKSTPLRTLCTTDRDAVALCNLKQYPKPIPFMYQYFSETNEDLPGTAAQYGGSVGLADYCPYVQEFVWRDRTDTIQRGSRCTLSSNTAEVHGNHFLETYGPNSKCFEHHGIWSLKRCNMPAPLKHFGSGCYKYSCNSTVG 558          
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Match: A0A402FM61 (Leishmanolysin-like peptidase OS=Paroedura picta OX=143630 GN=parPi_0020346 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 5.195e-55
Identity = 168/486 (34.57%), Postives = 238/486 (48.97%), Query Frame = 1
Query:  151 GSHVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKA-----------QNTGLLLVDRPCQQSSY-RINTENIKGCSFGC-ENATCLGFPVPDKYLKVCTTI--NXXXXXXXXXXXXXXXADADIVLLV---TYTSCGGATL-AYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIIT---HEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQFNGFVL--PNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYM-XXXXXXXXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKI-SGLNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFT 1530
             S  C+H +P   E++  +  +   +HI+ KRS    LRI  +Y  S       ELL        R+L++  +FP+A           + TG +L+ R C  + Y R   +  + C   C E   C    VP+K+L+ C     N             GV DAD +L V   T   CG   + AYA  C  EA +DRPI G  NLC N I  +++ +E V +++   HEIIHALGFS   +AFY    G+P+ +R   G P S   S   Y W++K++    R      +   L+ N F+L  P V+  AR HFNCP L  ++LE+ G    G+ L+H+++  L NE MT        F S ITLAL+ DTGWY  NYS    LD+G  KGC    K C  ++ Q + + + + P+C+   S    L C   ++   +CNL K    L   YQYF SL GV P ++ YY GS    +YCP    F+
Sbjct:   41 ASAACHHRVPSAEEVIYKVYLKQ--NHIK-KRSTDGQLRIKTEYDGSVE-----ELLPEK-----RHLIKHKLFPQAISYLEKTFQVRKPTGTILLSRQCVTNQYIRKKDDPHRYCRGACAEFTRCGPVIVPEKHLQQCRVCRENEWLCGPAGLPDQEGVQDADFILYVSALTTERCGQENIIAYAAYCQLEANMDRPIAGYANLCPNMI--STQPQEFVGMLSTVKHEIIHALGFSAGLFAFYHDNEGNPLTARYAEGVP-SFNESLGLYQWSNKVVRNAVRIWDVRGNKI-LRHNIFLLITPKVVEEARKHFNCPILEGMELENQGG--MGTELNHWEKRLLENEAMTGSHTQNRVF-SRITLALMEDTGWYKANYSMAEKLDWGQGKGCDFVMKSCKFWIDQKRKKKEEVAPYCDTLRSNPLQLTCRQDKKAVAVCNLQKFPQQLPQEYQYFDSLDGVMPEELPYYGGSVEIADYCPFSQEFS 506          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Cavefish
Match: lmln (leishmanolysin like peptidase [Source:NCBI gene;Acc:103047341])

HSP 1 Score: 200.29 bits (508), Expect = 2.662e-54
Identity = 171/555 (30.81%), Postives = 250/555 (45.05%), Query Frame = 1
Query:  157 HVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSY-RINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINXXXXXXXXXXXXXXXA--DADIVL---LVTYTSCGGATL-AYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKEN-VKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXL-QFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYM-XXXXXXXXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKISGLNPT-YQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFTD------PSFXXXXXXXXXXXXXXXXXXSYFGPDSMCF---SNYIQNPSSGSY----YGASCQKYTKNSLTGGYTVYIANSVFSC 1746
            H CNH +P  +E++  +  +P     +R       ++I+YD      +   + L+K  +   A + LQ   F   + TG +L+ R C  + Y R   +  + C   C + T C    VPD++L+ C   + TG          G     AD +L    VT   CG   + AYA  C  EA LDRPI G  NLC N I    +  E  +  + HEIIHALGFS   +AFY   +G P+  R   G P     +   Y W+D++I   +R            + +  V P V+  AR HFNCP L  ++LE+ G    G+ L+H+++  L NE MT        F S ITLA++ DTGWY  NYS   NL++G   GC    K C  ++ Q +    SL P+C         L+C   +    +CNL K S   PT YQYF S+ GV   D+  Y G+    ++CP    F+                 N   +  N     +GP+S+C    S ++      S     +G+ C K T  +L  G  V++ +  F C
Sbjct:   60 HSCNHKVPLPTEVIHNVHLKP-GRLTKRSTEQQLKIQIFYDSSLDVLDEDKSSLVKDKLFPQAIDYLQR-AFRVRRQTGPVLLSRQCSTNQYLRKKDDPHRYCQGACADITRCGPVIVPDEHLQQCRVCSETGKSCGPVGPPDGEGVDRADFLLYVSAVTTERCGQENIVAYAAYCQLEAELDRPIAGYANLCPNMISTQLQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDDGKPLTPRFASGLPAFNE-TLGLYQWSDRVIRRSTRLWDIRGRHMVRHEVHLMVTPRVVEEARRHFNCPILEGMELENQGG--MGTELNHWEKRLLENEAMTGSHTQNRVF-SRITLAIMEDTGWYRANYSMAENLEWGKGLGCDFVMKSCKFWIDQQRHARLSLTPYCESVRGTPLQLSCRQDQLAVAVCNLQKYSQPLPTEYQYFDSIPGVPEEDLSMYGGAVEIADFCPFSQEFSWHLSGEYQRSSYCRIQENQPDSWRNYAAEEYGPNSVCLYQKSAFVMKQCKKSMTYPDWGSGCYKMTCTAL--GLLVWVQDQSFLC 606          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Cavefish
Match: lmln (leishmanolysin like peptidase [Source:NCBI gene;Acc:103047341])

HSP 1 Score: 200.29 bits (508), Expect = 3.377e-54
Identity = 171/555 (30.81%), Postives = 250/555 (45.05%), Query Frame = 1
Query:  157 HVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSY-RINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINXXXXXXXXXXXXXXXA--DADIVL---LVTYTSCGGATL-AYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKEN-VKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXL-QFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYM-XXXXXXXXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKISGLNPT-YQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFTD------PSFXXXXXXXXXXXXXXXXXXSYFGPDSMCF---SNYIQNPSSGSY----YGASCQKYTKNSLTGGYTVYIANSVFSC 1746
            H CNH +P  +E++  +  +P     +R       ++I+YD      +   + L+K  +   A + LQ   F   + TG +L+ R C  + Y R   +  + C   C + T C    VPD++L+ C   + TG          G     AD +L    VT   CG   + AYA  C  EA LDRPI G  NLC N I    +  E  +  + HEIIHALGFS   +AFY   +G P+  R   G P     +   Y W+D++I   +R            + +  V P V+  AR HFNCP L  ++LE+ G    G+ L+H+++  L NE MT        F S ITLA++ DTGWY  NYS   NL++G   GC    K C  ++ Q +    SL P+C         L+C   +    +CNL K S   PT YQYF S+ GV   D+  Y G+    ++CP    F+                 N   +  N     +GP+S+C    S ++      S     +G+ C K T  +L  G  V++ +  F C
Sbjct:   60 HSCNHKVPLPTEVIHNVHLKP-GRLTKRSTEQQLKIQIFYDSSLDVLDEDKSSLVKDKLFPQAIDYLQR-AFRVRRQTGPVLLSRQCSTNQYLRKKDDPHRYCQGACADITRCGPVIVPDEHLQQCRVCSETGKSCGPVGPPDGEGVDRADFLLYVSAVTTERCGQENIVAYAAYCQLEAELDRPIAGYANLCPNMISTQLQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDDGKPLTPRFASGLPAFNE-TLGLYQWSDRVIRRSTRLWDIRGRHMVRHEVHLMVTPRVVEEARRHFNCPILEGMELENQGG--MGTELNHWEKRLLENEAMTGSHTQNRVF-SRITLAIMEDTGWYRANYSMAENLEWGKGLGCDFVMKSCKFWIDQQRHARLSLTPYCESVRGTPLQLSCRQDQLAVAVCNLQKYSQPLPTEYQYFDSIPGVPEEDLSMYGGAVEIADFCPFSQEFSWHLSGEYQRSSYCRIQENQPDSWRNYAAEEYGPNSVCLYQKSAFVMKQCKKSMTYPDWGSGCYKMTCTAL--GLLVWVQDQSFLC 606          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004358.1 (pep scaffold:Pmarinus_7.0:GL476418:369102:375246:1 gene:ENSPMAG00000003980.1 transcript:ENSPMAT00000004358.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 3.378e-19
Identity = 69/229 (30.13%), Postives = 109/229 (47.60%), Query Frame = 1
Query:  259 NLRIYYDYQSSFTNYP--YAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENI-KGCSFGC-ENATCLGFPVPDKYLKVCTTINXXXX--XXXXXXXXXXXADADIVLLVTYTSCG----GATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENV-KIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDK 912
             LR+   Y SS  + P    + +K  +   A + +QS +F ++    +LL +R C  + Y +   +  + C   C E   C    VPD++L+ C   +  G        + G G  DAD VL V+            +AYA  C  EA LDRPI G  NLC + + +++  + ++   + HE+IHALGFS   +AFYR  +G P+  R   G P     +   Y W+++
Sbjct:    2 RLRVRLIYDSSVDSLPNEKRDFIKMRLFPEAVDYIQSALFVRSPGAKILL-NRYCATNHYFMKHRDPHRYCQSACAETTRCGPVTVPDEHLQQCRVCDEGGRNCGSIGPAGGPGEPDADYVLYVSALGTDRCQQEGVVAYAAYCQLEAQLDRPIAGYANLCPDKVSLDAGEQPDMLSTVKHEVIHALGFSAGLFAFYRDDDGQPLTPRYGNGLPPFNDTTG-LYQWSER 228          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002113.1 (pep scaffold:Pmarinus_7.0:GL501047:4779:9283:1 gene:ENSPMAG00000001917.1 transcript:ENSPMAT00000002113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 1.337e-17
Identity = 54/143 (37.76%), Postives = 69/143 (48.25%), Query Frame = 1
Query: 1108 LYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXXXX-LDPFCNVPFSRGRTLACSLFREYFYLCNLNKISGLNPT-YQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFT 1530
            L NE MT  S+      S  TLAL+ DTGWY  NYS    L +G   GC+   + C ++M  +S S   + PFC         L C   R    LCNL + +   PT YQY   L GV+ AD+Q Y G     +YCP    F+
Sbjct:    1 LQNEAMT-GSHTQRRIFSRFTLALMEDTGWYHANYSHAEALGWGRGLGCVFAMQSCKAWMDHRSDSGLNVAPFCKEVRGHPLRLGCGAGRSALVLCNLQRYTNPLPTHYQYLDFLPGVSSADMQLYGGLVEIADYCPFSQEFS 142          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Nematostella
Match: EDO44382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW33])

HSP 1 Score: 173.711 bits (439), Expect = 6.309e-46
Identity = 124/404 (30.69%), Postives = 180/404 (44.55%), Query Frame = 1
Query:  397 LLVDRPCQQSSYRINTE------NIKGCSFGCENATCLGFPVPDKYLKVCTTINXXXXXXXXXXXXXXXA-----DADIVLLVT---YTSCGGA-TLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKEN-VKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXX-XXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKI-SGLNPTYQYFTSLVGVNP--------ADVQYYSGSSPYNEYCPTYMVFT 1530
            + + R C+ ++Y +  E      +++ C   C    C    VP ++L  C   +  G            +       D VL V+    + C  A  +AYA  C  E  LDRP+ G  NLC + +  + +   N +  + HE+ HALGFS   YAFYR   G P+  R   G P     +N Y   N  +     +         +   +  V P V+  AR HFNC TL   ++E+ G    G+ L+H+++    NE MT        F S +TLAL+ DTGWY  NYS    LD+G   GC+  ++ C ++MQS     +S +PFC         + C+  +    LCNL K    L P YQYF+ L   +         AD   Y G+ P  +YCP Y  FT
Sbjct:   66 IKLQRTCKNNAYFLKDETGTKLGDVQYCKEECVTTRCGPVTVPARHLDQCRVCDARGLECVRMPGDEWASGPGITRRDFVLYVSSIQTSHCSVANAVAYASYCQQEHMLDRPVAGFANLCPDRLDTDPRHYSNLISTVKHEVYHALGFSAGLYAFYRDKQGAPLTQRRKHGLPVYNDKTNLYQWSNKVVKKVTRKKWQVRHGHVTHSVSMIVTPRVVRVAREHFNCATLEGAEIENQGGT--GTELTHWEKRLFENEAMTGTYTQNPVF-SRLTLALMEDTGWYKANYSMAETLDWGRNLGCVFAKESCRTWMQSHVAHNKSSEPFCYTLKQAPLRMRCTHSKLSIALCNLRKYPQPLPPEYQYFSHLPKESSRKTREAVFADTDSYGGAVPLADYCPFYQKFT 466          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Nematostella
Match: EDO33070 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST90])

HSP 1 Score: 164.466 bits (415), Expect = 4.179e-43
Identity = 158/563 (28.06%), Postives = 243/563 (43.16%), Query Frame = 1
Query:  241 KRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTE------NIKGCSFGCENATCLGFP--VPDKYLKVCTTINXXXXXXXXXXXXXXXA---DADIVLLVTYT--SCGG-ATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXX--------XXXLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXXXXLD-PFCNV--PFSRGRTLACSLFREYFYLCNLNKISGLNPT-YQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFTDPSFXXX------XXXXXXXXXXXXXXXSYFGPDSMCF-SNYIQNPSSGSY------YGASCQKYTKNSLTGGYTVYIANSVFSCPSPTRQTYTLSDGSSNTFLCPG 1812
            +R++  +LRI   Y        +  ++K  + E  +    +  F   Q    +++DR C   SY +          ++ C   C+ +  L  P  VP   +  C   N  G    + +  S      D D VL VT +   C    TLAYA  C  E  +DRP+ G +N+C + + V++  KE +    HEI HALGFS   YAF+RY NG  I  R+  G P   +     Y W+D+ I TI R    + +        S+++Q    V P V    ++HFNC +L   +LE+ G    G+ L+H+++    NE MT        F S +TLAL+ DTGWY  N+     L +G   GC+     C +++  Q + +    PFC      +  +   CS  +    +CNL + +   P  YQYF SL G+N   +  Y GS    ++CP Y  F   S             +N      N    Y+G D+ CF    +   S  +       +G+ C KY  +    G  + I    + C  P  Q  ++   SS+ +L  G
Sbjct:    3 RRNVENSLRISLVYLELEPLRLHVSVVKKVLSEAIQYFHDT--FRVRQTVERIILDRRCLNDSYFLKNATGDGPGKVRFCKVACDASKPLCGPRNVPRSDVAACRVCNEHGEDCHAENNSSSGVGKNDTDFVLYVTASMEKCEKRETLAYAAVCQQEGNVDRPVAGFLNICPDKMNVSNDQKELLATFKHEIFHALGFSPSLYAFFRYDNGTAITPRSDTGMPPYDLALGR-YTWSDRTIKTIERKDWMIRTDKGNNGMVSHTVQL--MVTPRVQQEVQDHFNCSSLEGAELENQGGP--GTELAHWEKRVFENEGMTGAFTQNAVF-SRVTLALMEDTGWYRSNFKMAETLRWGKNLGCLFVNNSCKAWLTQQQRLKEKAYPFCQTLKNSTEAQRTYCSNDKTSVAMCNLAQYTQPLPVEYQYFESLAGINNPGL--YGGSVDLADFCPYYQGFVWTSKGAGLLGSYCLSSSNQKTEEKNYGLEYYGSDAKCFLQGQVWEKSKCAVRWISVDWGSGCYKYRCDQ--DGLKIIIGGLTYQCYHPG-QVLSIEMQSSDGWLHKG 552          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Medaka
Match: lmln (leishmanolysin like peptidase [Source:NCBI gene;Acc:101175034])

HSP 1 Score: 177.948 bits (450), Expect = 9.589e-47
Identity = 150/471 (31.85%), Postives = 212/471 (45.01%), Query Frame = 1
Query:  163 CNHPIPHISEIVTGITSEPLPSHIRRKRSISPN---LRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSY-RINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINX--XXXXXXXXXXXXXXADADIVLLV---TYTSCGGATL-AYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKEN-VKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQ-FNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYM-XXXXXXXXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKISGLNP-TYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFT 1530
            CNH +P  +E++  +  +P     R  +  SP+   L+I   Y SS   Y     L+  +   A + LQ   F      G +L+ R C  + Y R   +  + C   C + T C    VP  +L+ C   +             G GV  +D VL V   T   CG   + AYA  C  EA LDRPI G  NLC   I    +  E  +  + HEIIHALGFS   +AFY    G P+  R   G P     S   Y W++ +I  +SR              +  V P V+  ARNHFNCP L  ++LE+ G    G+ L+H+++  L NE MT  S+      S +TLA++ D+GWY  NYS    LD+G   GC    K C  +M +   +  ++ P+CN   S    L C   +    +CNL K     P  YQYF  +  V    + +Y G+    +YCP    F+
Sbjct:   38 CNHRVPSPAEVIHHVYLKPE----RLTKRSSPDVLQLKIKIIYDSSRC-YKLFCSLQDKLFPQAIDFLQR-AFSVKHRVGPILLSRLCATNQYMRKRNDPHRYCQESCADVTRCGPVIVPHHHLQQCKVCSEFGKSCGPTGPPDGPGVEGSDFVLYVSGITTERCGQENIVAYAAYCQLEAELDRPIAGYANLCPTMISSQPQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDEGKPLTPRFASGLPAFNE-SLGLYQWSEAVIRRVSRLWDIRGGVMVRHHVHVMVTPRVVEEARNHFNCPILEGMELENQGG--AGTELNHWEKRLLENEAMTG-SHTQNRVFSRLTLAIMEDSGWYRANYSLAQRLDWGRGLGCDFVMKSCKLWMDKQSQRRHAVTPYCNTVRSSPLQLTCRQDQLAVAVCNLQKYPEKLPLEYQYFDQISDVAADQLSFYGGAVEIADYCPFSQEFS 498          
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Match: SMESG000008414.1 (SMESG000008414.1)

HSP 1 Score: 1123.61 bits (2905), Expect = 0.000e+0
Identity = 626/630 (99.37%), Postives = 628/630 (99.68%), Query Frame = 1
Query:   19 MNFFLIAF*SNNVHNYQLIFSAMYKNYXXXXXXXXXXXNCWKLTGSHVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENIKGCSFGCENATCLGFPVPDKYLKVCTTINXXXXXXXXXXXXXXXADADIVLLVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXXXXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKISGLNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFTDPSFXXXXXXXXXXXXXXXXXXSYFGPDSMCFSNYIQNPSSGSYYGASCQKYTKNSLTGGYTVYIANSVFSCPSPTRQTYTLSDGSSNTFLCPGDDKAAAKSMKPSMILCSLIIAFKLMDSSGVFE 1908
            MNFFLIAF SNNVHNYQLIFSAMYKNYILLILLALIKLNCWKLTGSHVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENIKGCSFGCENATCLGFPVPDKYLKVCTTINGTGGVIQSGSQGSGVADADIVLLVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKIITTI+RSRTSVTSSYSLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMQSQSQSQSLDPFCNVPF+RGRTLACSLFREYFYLCNLNKISGLNPTYQYFTSL GVNPADVQYYSGSSPYNEYCPTYMVFTDPSFVCNNELNNNVPNLYNVVPSYFGPDSMCFSNYIQNPSSGSYYGASCQKYTKNSLTGGYTVYIANSVFSCPSPTRQTYTLSDGSSNTFLCPGDDKAAAKSMKPSMILCSLIIAFKLMDSSGVFE
Sbjct:    1 MNFFLIAFLSNNVHNYQLIFSAMYKNYILLILLALIKLNCWKLTGSHVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENIKGCSFGCENATCLGFPVPDKYLKVCTTINGTGGVIQSGSQGSGVADADIVLLVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKIITTITRSRTSVTSSYSLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMQSQSQSQSLDPFCNVPFARGRTLACSLFREYFYLCNLNKISGLNPTYQYFTSLAGVNPADVQYYSGSSPYNEYCPTYMVFTDPSFVCNNELNNNVPNLYNVVPSYFGPDSMCFSNYIQNPSSGSYYGASCQKYTKNSLTGGYTVYIANSVFSCPSPTRQTYTLSDGSSNTFLCPGDDKAAAKSMKPSMILCSLIIAFKLMDSSGVFE 630          
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Match: SMESG000008414.1 (SMESG000008414.1)

HSP 1 Score: 1082.4 bits (2798), Expect = 0.000e+0
Identity = 605/608 (99.51%), Postives = 607/608 (99.84%), Query Frame = 1
Query:   85 MYKNYXXXXXXXXXXXNCWKLTGSHVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENIKGCSFGCENATCLGFPVPDKYLKVCTTINXXXXXXXXXXXXXXXADADIVLLVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXXXXLDPFCNVPFSRGRTLACSLFREYFYLCNLNKISGLNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFTDPSFXXXXXXXXXXXXXXXXXXSYFGPDSMCFSNYIQNPSSGSYYGASCQKYTKNSLTGGYTVYIANSVFSCPSPTRQTYTLSDGSSNTFLCPGDDKAAAKSMKPSMILCSLIIAFKLMDSSGVFE 1908
            MYKNYILLILLALIKLNCWKLTGSHVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENIKGCSFGCENATCLGFPVPDKYLKVCTTINGTGGVIQSGSQGSGVADADIVLLVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKIITTI+RSRTSVTSSYSLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMQSQSQSQSLDPFCNVPF+RGRTLACSLFREYFYLCNLNKISGLNPTYQYFTSL GVNPADVQYYSGSSPYNEYCPTYMVFTDPSFVCNNELNNNVPNLYNVVPSYFGPDSMCFSNYIQNPSSGSYYGASCQKYTKNSLTGGYTVYIANSVFSCPSPTRQTYTLSDGSSNTFLCPGDDKAAAKSMKPSMILCSLIIAFKLMDSSGVFE
Sbjct:    1 MYKNYILLILLALIKLNCWKLTGSHVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENIKGCSFGCENATCLGFPVPDKYLKVCTTINGTGGVIQSGSQGSGVADADIVLLVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKIITTITRSRTSVTSSYSLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMQSQSQSQSLDPFCNVPFARGRTLACSLFREYFYLCNLNKISGLNPTYQYFTSLAGVNPADVQYYSGSSPYNEYCPTYMVFTDPSFVCNNELNNNVPNLYNVVPSYFGPDSMCFSNYIQNPSSGSYYGASCQKYTKNSLTGGYTVYIANSVFSCPSPTRQTYTLSDGSSNTFLCPGDDKAAAKSMKPSMILCSLIIAFKLMDSSGVFE 608          
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Match: SMESG000008405.1 (SMESG000008405.1)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 323/545 (59.27%), Postives = 392/545 (71.93%), Query Frame = 1
Query:  157 HVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENIKGCSFGCENATCLGFPVPDKYLKVCTTINXXXXXXXXXXXXXXXADADIVLLVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKXXXXXXXXXXXXXXXXXLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXXX-XLDPFCNVPFSRGRTLACSLFREYFYLCNLNKISGLNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFTDPSFXXXXXXXXXXXXXXXXXXSYFGPDSMCFSNYIQNPSSGSYYGASCQKYTKNSLTGGYTVYIANSVFSCPSPTRQTYTLSDGS 1788
            HVC+H IP +SE+V GI   PLP + R KR+ S NLRIY+DYQSSFT+  +AE LKT +MEPA+N+LQS+I PK+ N GLLLVDR C  S  R+N++N KGC++GC    CLG  VP  YLK C  ++  G    +GS G+G++D DIVLLVTYT+C   TLAYAGSCF E  LDRPILGV+NLCSN I   +  +   K+I HEIIH+LGFSVDKYAFYRY +G PIV RN +GFPN GV +N YY WN+ II  I R R SV S+Y++ F GFVLPNVL AAR HF+CPTL AVDLEDYG     SA SHFDEYFL+NELMTP SN  +DF+S ITLALL DTGWY V++SAVGN DYG +KGC+LPEKGCY+YMQ +     +LDP CN     G  L CS++R YFY CNL K + + P  QYF SL G+  ADVQ+Y+G SPYNEYCP Y V + P+FVCN+  NNNV   YN +PSYFG DSMC + YI N  + S YGASCQK++ N  +  Y+ +I NS+  CPS   Q +T S+GS
Sbjct:   25 HVCDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTSSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQTECLGIVVPSVYLKACKIVDSLGNFQTTGSDGAGISDIDIVLLVTYTNCSANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYG--GASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLFKYTSVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCPGYWVSSKPNFVCNDMQNNNVITGYNSIPSYFGSDSMCINTYINNGLNTSIYGASCQKFSYNP-SSSYSFFIGNSILKCPSNVIQNFTTSNGS 566          
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Match: SMESG000036783.1 (SMESG000036783.1)

HSP 1 Score: 426.017 bits (1094), Expect = 9.568e-140
Identity = 242/545 (44.40%), Postives = 340/545 (62.39%), Query Frame = 1
Query:  184 ISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINXXXXXXXXXXXXXXXADADIVLLVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVS-NSYYMWNDKXXXXXXXXXXXXXXXXXLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXXXX-LDPFCNVPFSRGRTLACSLFREYFYLCNLNKISGLNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFTDPSFXXXXXXXXXXXXXXXXXXSYFGPDSMCFSNYIQNPSSGSYYGASCQKYTKNSLTGGYTVYIANSVFSCPSPTRQTYTLSDGSSNTFLCP 1809
            + E+VTGI  +    + R ++S S +LRI+Y Y  SF +YP ++ +K  +MEP++  ++ ++  K    G+L VDR C     R N + I+GC  GC  AT CLG  +P++YLK C  I  +G +I S S+G G+A+ DI+++V +T C   T A A SCF E  LDRPILGVI +C    QVN  V E+VKII HEIIHALGF+++KYA++R  NG PIV R+ FG P  G  +   YY+WNDKII  + R+R SV   Y    + FVL N++  A+ HF CP + AVDLED G    GSAL+HFDEY L+N++MTP +NN +D IS  TLALL DTGWY V+YS   + DYG  KGC LP KGCY YM+ Q Q  + LDPFC+  F  G    CS  R Y+  C+L   + ++   QYF  + G+   D Q+Y+G S +NE+CP  ++F+ P+  CN+  N+ + + YN++ SY+G DS+C  N ++N     YYGASCQKY+ N+ +  Y ++I  +  +CPS     + + +    +  CP
Sbjct:   24 LDEMVTGIEIDQNLQNYRTRKS-SSHLRIHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIANVDIIIVVAFTHCNDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIERYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAG--GSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVSKENQYFREIHGIKKEDAQFYAGQSEFNEFCPFKVIFSAPNSFCNDITNSYLQDKYNILTSYYGKDSLCIENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTCPSNVASHFVIDNFYKISVKCP 565          
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Match: SMESG000076084.1 (SMESG000076084.1)

HSP 1 Score: 210.305 bits (534), Expect = 8.640e-58
Identity = 179/563 (31.79%), Postives = 271/563 (48.13%), Query Frame = 1
Query:  157 HVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSY---RINTENIKGCSFGC-ENATCLGFPVPDKYLKVCTTINXXXXXXXXXXXXXXXADADIVLLVTYTSCG----GATLAYAGSCFGEATLDRPILGVINLCSNTIQVN-SKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIF-GFPNSGVVSN--SYYMWNDKXXXXXXXXXXXXXXXXXLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMXXXXXX-XXLDPFCNVPFSRGRTLA--CSLFREYFYLCNLNKIS-GLNPTYQYFTSLVGVNPADVQYYSGSSPYNEYCPTYMVFTDPSFXXXXXXXXXXXXXXXXXXSY--------FGPDSMCF--SNYIQNPSSG-----SYYGASCQKYTKNSLTGGYTVYIANSVFSCPS 1752
            H C+  + H     T I+ +     +RR++    NL+I+  Y  SF    ++ L KT +++PA   LQ+ ++ + + + + L  R C  +     +IN E    C  GC +  TC    VP ++L  C  I     +++ G++G GV D D +L +           + LAYA SC  E+ LDRPI G IN C   +  +   + +++ I  HE+IHALGF++ ++AFYR PNG P   R+IF G P+ G + +  + Y+W++++  +  R   S    +       VLP V+  AR +FNC TL  V+LED G    G +++H+++  L N++MT         +S ITLAL+ DTGWY  NY     + +G   GC   E  CY Y+Q +S   QS++PFC +       L+  CS  R  +  CNL+K    L P ++YFT       +   YY G S    YCP    F    +  +        +      +Y        FGP S CF  S      S G     S  GA C K+T + L  G  V + N  + CPS
Sbjct:   75 HKCSLDLEHEG---TAISVKQDFVKVRRRKRTLTNLKIHPHYDDSFNFQKHSFLYKTYIIQPAIEYLQNALYVRNRYSNIKL-QRKCDSNRLAFVKINEEFSYYCGDGCSQRTTCGDVEVPLEHLMACRQI-MNSRLVKVGAEGPGVNDTDFILYIESRQSKKCDDSSVLAYASSCQSESQLDRPIAGSINFCPGRLSSDFGHLSQSLFIAKHELIHALGFAITQFAFYRDPNGAPYTPRSIFTGRPDLGFLQDRSNIYLWSNRVTRSTVRRWQSAVGFFLKNVTLMVLPTVVQEARKYFNCSTLTGVELEDQG--GLGVSITHWEKRILENDIMTATFTQEAR-VSRITLALMYDTGWYIPNYELADYISWGRHLGCDFLEMSCYEYIQHRSIRGQSIEPFCAIINRHEEELSGFCSADRHAYAYCNLDKHQYQLEPQHRYFTDDQIYQSS---YYGGKSTAANYCPYPQEFN--WYKGDRVSRTTQCSESRNNQNYQNNFLLQEFGPKSSCFALSKKWSVYSCGKKIVPSMIGAGCYKFTCSPLF-GLLVTVNNQTYQCPS 623          
The following BLAST results are available for this feature:
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
LMLN1.022e-5232.24leishmanolysin like peptidase [Source:HGNC Symbol;... [more]
LMLN1.061e-5032.97leishmanolysin like peptidase [Source:HGNC Symbol;... [more]
LMLN1.360e-3929.42leishmanolysin like peptidase [Source:HGNC Symbol;... [more]
LMLN7.088e-3830.18leishmanolysin like peptidase [Source:HGNC Symbol;... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y43F4A.12.378e-4932.09Leishmanolysin-like peptidase [Source:UniProtKB/S... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Invadolysin7.400e-4830.72gene:FBgn0086359 transcript:FBtr0082181[more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lmln3.005e-5533.40leishmanolysin-like (metallopeptidase M8 family) [... [more]
lmln1.141e-5334.31leishmanolysin-like (metallopeptidase M8 family) [... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
LMLN1.246e-1134.91leishmanolysin-like (metallopeptidase M8 family) [... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Lmln4.555e-5131.52leishmanolysin-like (metallopeptidase M8 family) [... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BMN4|LMLN_MOUSE3.186e-5031.52Leishmanolysin-like peptidase OS=Mus musculus OX=1... [more]
sp|Q61YG1|LMLN_CAEBR1.657e-4833.49Leishmanolysin-like peptidase OS=Caenorhabditis br... [more]
sp|O62446|LMLN_CAEEL3.025e-4832.09Leishmanolysin-like peptidase OS=Caenorhabditis el... [more]
sp|Q29AK2|LMLN_DROPS4.586e-4728.06Leishmanolysin-like peptidase OS=Drosophila pseudo... [more]
sp|Q9VH19|LMLN_DROME7.418e-4730.72Leishmanolysin-like peptidase OS=Drosophila melano... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IM891.674e-5633.64Leishmanolysin-like peptidase OS=Lingula unguis OX... [more]
A0A1B6E3E14.723e-5634.96Leishmanolysin-like peptidase (Fragment) OS=Clasto... [more]
A0A1D2NG411.100e-5534.61Leishmanolysin-like peptidase (Fragment) OS=Orches... [more]
A0A1S3IL603.067e-5533.33Leishmanolysin-like peptidase OS=Lingula unguis OX... [more]
A0A402FM615.195e-5534.57Leishmanolysin-like peptidase OS=Paroedura picta O... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lmln2.662e-5430.81leishmanolysin like peptidase [Source:NCBI gene;Ac... [more]
lmln3.377e-5430.81leishmanolysin like peptidase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004358.13.378e-1930.13pep scaffold:Pmarinus_7.0:GL476418:369102:375246:1... [more]
ENSPMAT00000002113.11.337e-1737.76pep scaffold:Pmarinus_7.0:GL501047:4779:9283:1 gen... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO443826.309e-4630.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330704.179e-4328.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lmln9.589e-4731.85leishmanolysin like peptidase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008414.10.000e+099.37SMESG000008414.1[more]
SMESG000008414.10.000e+099.51SMESG000008414.1[more]
SMESG000008405.10.000e+059.27SMESG000008405.1[more]
SMESG000036783.19.568e-14044.40SMESG000036783.1[more]
SMESG000076084.18.640e-5831.79SMESG000076084.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026759 ID=SMED30026759|Name=Leishmanolysin-like peptidase|organism=Schmidtea mediterranea sexual|type=transcript|length=2359bp
GTTTGTATTGCTATATTTATGAACTTTTTTTTAATAGCATTTTAAAGTAA
TAATGTTCATAATTATCAATTGATATTCAGTGCAATGTATAAAAATTATA
TTTTGTTAATTTTATTAGCCTTGATAAAATTAAATTGTTGGAAATTGACT
GGAAGCCATGTTTGCAATCATCCTATCCCACATATTTCAGAAATTGTGAC
CGGGATAACGTCTGAACCTTTGCCTTCGCATATCAGGAGGAAAAGAAGTA
TCTCACCTAATTTAAGAATTTATTATGACTACCAAAGTTCATTTACTAAT
TATCCCTATGCTGAACTGTTGAAAACTACTGTTATGGAGCCGGCAAGAAA
TCTTCTCCAGTCCCTGATATTTCCTAAAGCCCAAAATACGGGGCTTTTAC
TTGTTGATAGGCCTTGTCAACAGTCATCTTATCGAATAAATACAGAGAAT
ATTAAGGGATGTAGCTTTGGATGTGAAAACGCTACATGTTTGGGTTTCCC
TGTTCCAGATAAGTATTTAAAGGTATGTACGACTATAAATGGTACTGGGG
GTGTTATACAATCAGGATCTCAAGGGTCTGGAGTTGCAGATGCAGATATT
GTCTTGTTAGTAACTTATACTTCTTGTGGTGGAGCTACATTAGCATATGC
AGGATCATGTTTCGGCGAGGCTACTTTGGACAGACCAATACTTGGTGTCA
TTAACCTGTGTTCAAATACCATTCAAGTTAATTCAAAAGTGAAAGAAAAT
GTCAAAATTATAACCCATGAAATAATACATGCATTAGGATTTTCTGTTGA
TAAATATGCATTTTATCGTTATCCTAATGGTGATCCAATAGTTTCCCGAA
ACATTTTTGGTTTCCCAAATTCGGGAGTGGTGTCTAACAGCTATTATATG
TGGAACGATAAAATAATCACTACCATTAGTAGAAGTCGGACTTCAGTCAC
CTCAAGCTATAGCCTTCAATTTAATGGTTTTGTTCTTCCTAATGTTTTGA
CAGCTGCTCGTAATCATTTCAACTGTCCAACGCTTATTGCCGTAGACCTT
GAAGATTATGGAACCGATACTGGTGGATCGGCATTAAGTCATTTCGATGA
ATATTTTCTATATAATGAACTGATGACCCCTGTCTCCAACAATGGAATCG
ATTTCATATCAAATATAACTCTAGCTCTTCTAAATGATACTGGATGGTAT
ACCGTAAACTATTCAGCAGTCGGTAATTTAGACTATGGATACCAAAAAGG
ATGTATACTGCCAGAAAAAGGATGCTACAGTTATATGCAATCACAATCTC
AATCTCAATCTCTGGATCCATTTTGTAATGTTCCTTTCAGCAGGGGAAGA
ACTCTTGCATGCTCCTTATTCAGGGAATATTTTTATTTGTGTAATCTCAA
TAAAATCAGCGGTTTAAACCCAACGTATCAGTATTTTACTTCTCTTGTTG
GAGTCAACCCCGCCGATGTTCAATATTATTCTGGCTCTTCTCCTTACAAT
GAATATTGCCCCACTTATATGGTATTTACAGATCCTAGTTTTGTATGTAA
TAATGAATTAAATAATAATGTTCCAAACTTGTACAATGTAGTTCCATCTT
ACTTTGGACCGGATTCAATGTGTTTTTCGAATTATATACAAAATCCTTCT
TCAGGAAGTTATTATGGAGCATCTTGTCAAAAATATACAAAAAATTCGTT
GACTGGCGGCTACACAGTATACATTGCAAATTCAGTTTTTAGCTGTCCGT
CACCAACTCGACAAACATATACGTTGAGTGATGGATCATCCAATACATTT
TTATGTCCGGGTGACGATAAAGCGGCGGCCAAAAGTATGAAACCATCAAT
GATCCTATGCTCACTAATAATAGCGTTCAAATTGATGGATTCCAGCGGGG
TATTTGAATAGATGATTATTTGAAGAATGTGATCTTATTAACTGAAGCAT
ATTTACACCTCAACAAATTGTTTACTTACTGCCTTAGATGATTAATCAGT
ACATTTTTTTCATATTTTATTTATTCTAATGGCTATTTAAGTTATTTATT
TTAAGACATTTATTTTTGAGCACATAAATATCATCGAAACTGTCATTTTT
TTATTCAAAATGTTTGAAACTGATAGTGGCAAAAGTTTTGTGCTGGCTCT
GTTGGTAAGCATATCAGTCGCATCTCTTAAAATCGAAATAGTTTGATTAC
AGTATTCGAATCTTTTTCCATTTTTTGGATATTAGTATGGAAACTATAAG
CTAACGAATGTATGAACCATAAATAAGCTTCATTTAATGGATTTTTGAAA
AGGTCAGTCAAAATTTTAAGTGCTTTGTCAATGGAAAGAAAATAGTTTTA
TCAAAGCGG
back to top

protein sequence of SMED30026759-orf-1

>SMED30026759-orf-1 ID=SMED30026759-orf-1|Name=SMED30026759-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=609bp
MYKNYILLILLALIKLNCWKLTGSHVCNHPIPHISEIVTGITSEPLPSHI
RRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQ
NTGLLLVDRPCQQSSYRINTENIKGCSFGCENATCLGFPVPDKYLKVCTT
INGTGGVIQSGSQGSGVADADIVLLVTYTSCGGATLAYAGSCFGEATLDR
PILGVINLCSNTIQVNSKVKENVKIITHEIIHALGFSVDKYAFYRYPNGD
PIVSRNIFGFPNSGVVSNSYYMWNDKIITTISRSRTSVTSSYSLQFNGFV
LPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPV
SNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSY
MQSQSQSQSLDPFCNVPFSRGRTLACSLFREYFYLCNLNKISGLNPTYQY
FTSLVGVNPADVQYYSGSSPYNEYCPTYMVFTDPSFVCNNELNNNVPNLY
NVVPSYFGPDSMCFSNYIQNPSSGSYYGASCQKYTKNSLTGGYTVYIANS
VFSCPSPTRQTYTLSDGSSNTFLCPGDDKAAAKSMKPSMILCSLIIAFKL
MDSSGVFE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0008237metallopeptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
GO:0004222metalloendopeptidase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000136whole organism
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001577Peptidase_M8
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0007155cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001577Peptidase M8, leishmanolysinPFAMPF01457Peptidase_M8coord: 28..276
e-value: 8.3E-29
score: 100.7
IPR001577Peptidase M8, leishmanolysinPANTHERPTHR10942LEISHMANOLYSIN-LIKE PEPTIDASEcoord: 24..321
NoneNo IPR availableGENE3DG3DSA:3.90.132.10coord: 3..126
e-value: 1.8E-28
score: 101.2
NoneNo IPR availablePANTHERPTHR10942:SF0LEISHMANOLYSIN-LIKE PEPTIDASEcoord: 24..321
NoneNo IPR availableSUPERFAMILYSSF55486Metalloproteases ("zincins"), catalytic domaincoord: 21..285