Steroid 17-alpha-hydroxylase/17,20 lyase

Overview
NameSteroid 17-alpha-hydroxylase/17,20 lyase
Smed IDSMED30026757
Length (bp)1689
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Steroid 17-alpha-hydroxylase/17,20 lyase (SMED30026757) t-SNE clustered cells

Violin plots show distribution of expression levels for Steroid 17-alpha-hydroxylase/17,20 lyase (SMED30026757) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Steroid 17-alpha-hydroxylase/17,20 lyase (SMED30026757) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Steroid 17-alpha-hydroxylase/17,20 lyase (SMED30026757) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026757

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30026757h1SMcG0013816 SmedASXL_017056SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30026757h1SMcG0013816 SmedASXL_017056SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30026757h1SMcG0013816 dd_Smed_v4_10722_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026757h1SMcG0013816 dd_Smed_v4_10722_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026757h1SMcG0013816 dd_Smed_v4_10722_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30026757h1SMcG0013816 dd_Smed_v4_10722_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026757h1SMcG0013816 dd_Smed_v4_10722_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026757h1SMcG0013816 dd_Smed_v4_10722_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30026757h1SMcG0013818 SMED30003449smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30026757h1SMcG0013818 SMED30003449smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026757h1SMcG0013818 SMED30003449smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30026757h1SMcG0013816 SMED30003449smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30026757h1SMcG0013816 SMED30003449smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026757h1SMcG0013816 SMED30003449smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30026757h1SMcG0013818 SMED30003449smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30026757h1SMcG0013818 SMED30003449smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026757h1SMcG0013818 SMED30003449smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30026757h1SMcG0013816 SMED30003449smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30026757h1SMcG0013816 SMED30003449smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026757h1SMcG0013816 SMED30003449smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Human
Match: CYP2A6 (cytochrome P450 family 2 subfamily A member 6 [Source:HGNC Symbol;Acc:HGNC:2610])

HSP 1 Score: 139.428 bits (350), Expect = 5.272e-35
Identity = 113/472 (23.94%), Postives = 212/472 (44.92%), Query Frame = 2
Query:   98 FIWLSVCFILMIII-FYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKV-SMLHKYIKLKVQRKLKYLTEDPN------EECLIKYYINKQMENSEIFI-----CCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLS 1471
             + L VC  +M+++  +     K   PPGP  +PF+G        + L            ++ + YG +   ++G +R+V+L   D + EA V     F+GR      D +   + G++ S  +  K+ R  ++ +  D GVG++   +        + + +R   G   D    L +T   +++S++FG   +  +     +   +  + Q  FT T     Y  FS+V K  P  ++ A ++   L  +I  KV+   + L  DPN      +  LI+    ++  N+E ++       ++L++ G +TVS+ +    LLL KH   + K+  EI+ +        +E +   P+ +A I E  R+  V+P ++ RR  ++   + + +     +     S+  D + + NP +FNP  F+ E+ G F+ +   +PF IG R C GE + R E F     ++  F +  S
Sbjct:    8 LVALLVCLTVMVLMSVWQQRKSKGKLPPGPTPLPFIG--------NYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGY-GVVFSNGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDALRGTGGANIDPTFFLSRTVSNVISSIVFGDRFDYKDKEFLSLLRMMLGIFQ--FTSTSTGQLYEMFSSVMKHLPGPQQQAFQLLQGLEDFIAKKVEHNQRTL--DPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFIGGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRDPSFFSNPQDFNPQHFLNEK-GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSS 465          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Human
Match: CYP2A7 (cytochrome P450 family 2 subfamily A member 7 [Source:HGNC Symbol;Acc:HGNC:2611])

HSP 1 Score: 134.035 bits (336), Expect = 3.650e-33
Identity = 108/461 (23.43%), Postives = 206/461 (44.69%), Query Frame = 2
Query:  122 ILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKV-SMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQME----NSEIFI-----CCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLS 1471
            +++++  +     +   PPGP  +PF+G        + L     +      +  + YG +   ++G +R+V+L   D + EA V     F+GR      D +   + G+  S  +  K+     + +  D GVG++   +        + E IR   G   D    L +T   +++S++FG   +  +     +   +  + Q  FT T     Y  FS+V K  P  ++ A K+   L  +I  KV+   + L  +  ++ +  + I+ Q E    N+E ++       ++L++AG +TVS+ +    LLL KH   + K+  EI+ +        +E +   P+ +A I E  R+  V+P ++ RR  ++   + + +     +     S+  D + + NP +FNP  F+ ++ G F+ +   +PF IG R C GE + R E F     ++  F +  S
Sbjct:   17 VMVLMSVWQQRKSRGKLPPGPTPLPFIG--------NYLQLNTEHICDSIMKFSECYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGY-GVAFSNGERAKQLLRFAIATLRDFGVGKRGIEERIQEESGFLIEAIRSTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLSMMLGIFQ--FTSTSTGQLYEMFSSVMKHLPGPQQQAFKLLQGLEDFIAKKVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFIAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRTKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFL-DDKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSS 465          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Human
Match: CYP2J2 (cytochrome P450 family 2 subfamily J member 2 [Source:HGNC Symbol;Acc:HGNC:2634])

HSP 1 Score: 132.109 bits (331), Expect = 1.943e-32
Identity = 133/506 (26.28%), Postives = 214/506 (42.29%), Query Frame = 2
Query:  107 LSVCFILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFK--GLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEK--YANKVSMLHKYIKLKVQRKLKYLTEDPN---EECLIKYYINKQMENS---------EIFIC-CVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPA-IERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTLVFTENV 1570
            L     L+   F     PK N PPGP  +PFLG        +  L       L  Q   K YG +    +GD   VL++   +I EA +     F  RP      +    FK  GL++S  + WKE R  T+ +  + G+G+K   +      + + E I+E  G+ FD +  +      I+ S+ FG   E  +S    + + +  +   + ++T  L  Y  F  + K  P   +  ++N      K +KL V   +    +D N       I  Y+ +  +++         E  IC  +DL+ AG +T S+ +   LL +  +   QEK++ EI+ +       +   +   P+T A I E  R   ++P  + R    +  L GY +    +I+    ++  D T W  P+ FNP  F+  ENG F+     +PF IG R CLGE + R E F    +++ KF          N +K+      GI  SP+ H L     V
Sbjct:   23 LGTVAFLLAADFLKRRRPK-NYPPGPWRLPFLG--------NFFLVDFEQSHLEVQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVT---PMREHIFKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQL--YNVFPWIMKFLPGPHQTLFSN-----WKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLKEMSKHTGNPTSSFHEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDTFNPDHFL--ENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFR-----PPNNEKLSLKFRMGITISPVSHRLCAVPQV 502          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Human
Match: CYP2S1 (cytochrome P450 family 2 subfamily S member 1 [Source:HGNC Symbol;Acc:HGNC:15654])

HSP 1 Score: 131.339 bits (329), Expect = 4.219e-32
Identity = 104/408 (25.49%), Postives = 184/408 (45.10%), Query Frame = 2
Query:  290 YGEISKFYIGDQR-IVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFG----HEPEETESNIYDIYETICFL-AQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQME----------NSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNV 1462
            YG +   Y+G  R +V+L   + + EA       F+GR  +  L+   D   G+  S  + W++ R  T+ +  DLG+G++E  +L  A    + E  +  +G+ FD + +L +    ++ SL+FG    +E +E ++ +     T+  + +Q   T     W  R      K      +  + VS L  +   +VQ+    L        L+  ++ K  +          N  + +  + L  AG  TVS+ V   LLLL K+ H Q+ ++ E+          +   +   P+T A + E  R  A+VP  I R  M     +GY +     +     SI +D  ++++P EFNP RF+ + +G F+ +   +PF +G R CLGE + + E F     I+  F++
Sbjct:   64 YGPVFTIYLGPWRPVVVLVGQEAVREALGGQAEEFSGRGTVAMLEGTFDG-HGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLLFGLRFSYEDKEFQAVVRAAGGTLLGVSSQGGQTYEMFSWFLRPLPGPHK------QLLHHVSTLAAFTVRQVQQHQGNLDASGPARDLVDAFLLKMAQEEQNPGTEFTNKNMLMTVIYLLFAGTMTVSTTVGYTLLLLMKYPHVQKWVREELNRELGAGQAPSLGDRTRLPYTDAVLHEAQRLLALVPMGIPRTLMRTTRFRGYTLPQGTEVFPLLGSILHDPNIFKHPEEFNPDRFL-DADGRFRKHEAFLPFSLGKRVCLGEGLAKAELFLFFTTILQAFSL 463          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Human
Match: CYP2A13 (cytochrome P450 family 2 subfamily A member 13 [Source:HGNC Symbol;Acc:HGNC:2608])

HSP 1 Score: 130.183 bits (326), Expect = 9.232e-32
Identity = 108/458 (23.58%), Postives = 201/458 (43.89%), Query Frame = 2
Query:  122 ILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANK-VSMLHKYIKLKVQRKLKYLTEDPN------EECLIKYYINKQMENSEIFI-----CCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKF 1456
            +++++  +     +   PPGP  +PF+G        + L            ++ + YG +   ++G +R+V+L   D + EA V     F+GR      D L   + G+  S  +  K+ R  ++ +    GVG++   +        + + +R   G   D    L +T   +++S++FG   +  +     +   +  L    FT T     Y  FS+V K  P  ++ A K +  L  +I  KV+   + L  DPN      +  LI+    ++  N+E ++       ++L+ AG +TVS+ +    LLL KH   + K+  EI+ +        +E +   P+T+A I E  R+  ++P  +  R  ++   + + +     +     S+  D   + NP +FNP  F+ ++ G F+ +   +PF IG R C GE + R E F     I+  F
Sbjct:   17 VMVLMSVWRQRKSRGKLPPGPTPLPFIG--------NYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGY-GVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMM--LGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNQRTL--DPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFL-DKKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNF 460          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Celegans
Match: cyp-33C4 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O16362])

HSP 1 Score: 133.65 bits (335), Expect = 2.037e-33
Identity = 117/487 (24.02%), Postives = 222/487 (45.59%), Query Frame = 2
Query:  101 IWLSVCFILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGR-PRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQI-----LWKYRSFSAVKKLFPMLEKYAN--------KVSMLHKYIKLKVQRKL----KYLTEDPNEECLIKY--YINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPA-IERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDK 1498
            I L V    +  +F+  Y  + N PPGPI +PF+G         + +         F+   K YG++  F++G    V++SS+D++ + +V++   +  + P+     I   ++ G++ S   +W  +R   + +  D G+G+    +  +  +E + +      G E DV+ ++      ++N  IFG+  E  +   +     +    +T F   ++     + K  +    + L  +LE++ +        ++    K I    Q  L     YL E   +E L ++  + NKQ+ N+     C+DL+LAG+ T ++ V+  +  +  H    +K+  E + +  +   +T   K   P+  A + E  R   +VP  +     ++ ++ GY +K    +IAQ  ++  D  ++ +P +FNP RFI +ENG       LIPF IG R C GE + R E F  +    +++ +S S +   N DK
Sbjct:    2 IILLVFTAFLAFLFHELYWKRRNLPPGPIPLPFMG-------NILTMLLNKPGYECFRNCTKKYGDVYTFWMGKTPFVMISSYDLLKDTFVRDGDTYKDKYPQPLNQKIRGGNY-GIVESNGHLWSTHRRFALTTLRDFGLGKDLMQEKILIEVEDIFKKFDAQLGLEQDVSVVMNNAIANVINQNIFGYRFEGDKEEDFKKLRELMEYQETAFATFKVYVEAFIPKVGALLPGRSLNELLEEWRDNFYTFFDTQIENHRKKIDFDSQESLDYAEAYLKEQRKQEALGEFELFSNKQLSNT-----CLDLWLAGLSTTNTTVNWTICYVLNHPDVLQKMNEEFDQVVGSDRLVTMGDKNNLPYFNAVLNESQRCANIVPINLFHATTKDTVINGYPVKKGTGVIAQISTVMLDEKIFPDPYKFNPDRFI-DENGKPIKIEQLIPFSIGKRQCPGEGLARMEMFLFLANFFNRYKISPSSKGFPNLDK 474          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Celegans
Match: cyp-33C2 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O44706])

HSP 1 Score: 129.798 bits (325), Expect = 5.109e-32
Identity = 116/484 (23.97%), Postives = 220/484 (45.45%), Query Frame = 2
Query:  152 YAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHE---PEETE-SNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFP--MLEK-----YANKVSMLHKYIKLKVQR-KLKYLTEDPNE--ECLIKYYINKQME-NSEIFI------CCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPA-IERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSP 1537
            Y  + N PPGP  +P  G         + +         F++  K YG+I  F+IG+   ++++++D I E Y+++   +  + R+  LD+      G++ S    W+E+R   + +  D G+G+    +  +  ++ +   +    G E D+  +       ++N L+FG+    P+E+E   +  I E     A TD      ++   +   + KL P  M E           +  +K I+   Q   L  L  +  +  E  +K    ++ E +SE F        C+DL+ AG++T ++ ++  +  +  H   Q+K+  E++ +  +   IT   K   P+  AFI E  R   +VP  ++     + ++ G+ I     ++AQ  ++  +  ++ +P+ FNP RFI +E+G  +    L PF +G R+C GE + R E F  I   ++++ +  S E   + DK     S G L +P
Sbjct:   19 YWKRRNFPPGPCPLPVFG-------NLLSIANPPPGYEAFERWTKKYGDIYTFWIGNTPHIMINTWDKIKETYIRDAETYTNKVRLPALDLFRGGEYGIIDSNGATWREHRRFALSTMRDFGLGKNLMQENILMEVQDVFARLDAKLGSETDIPEVFDHAVANVVNQLLFGYRFVGPKESEYQELKRIIE-----APTDLFGKPHMFLAMNIPVIAKLMPEFMYEGPFKDFRDTAFAFFNKQIEAHRQEVDLNDLNSESTDFVETFLKEQKRRESEGDSETFSNVQLSNVCMDLWFAGLNTTTNTITWAISYILHHPEVQDKVHEEMDKVIGSDRLITTADKNDLPYFNAFINEAQRGINIVPLNLQHATTRDTVINGFKIPKGTGVVAQISTVMNNEEVFPDPHTFNPDRFI-DEHGKLKRVEELAPFSVGKRSCPGEGLARMELFLFIANFLNRYKIYPSKEGPPSMDK-----SNGALIAP 484          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Celegans
Match: cyp-33C3 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O16670])

HSP 1 Score: 129.028 bits (323), Expect = 8.521e-32
Identity = 117/487 (24.02%), Postives = 221/487 (45.38%), Query Frame = 2
Query:  101 IWLSVCFILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGR-PRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQI-----LWKYRSFSAVKKLFPMLEKYAN--------KVSMLHKYIKLKVQRKL----KYLTEDPNEECLIKY--YINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPA-IERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDK 1498
            I L V    +  +F+  Y  + N PPGPI +P++G         + +         F+   K YG++  F++G    V++SS+D++ + +V++   +  + P+ F   I   ++ G++ S   +W  +R   + +  D G+G+   ++  +  +E++ +      G E DV+ ++      ++N  IFG+  E  +   +     +    +T F   ++     + K  +    + L  +LE++ +        ++    K I    Q  L     YL E   +E L ++  + NKQ+ N+     C+DL+ AG+ T  + V+  L  +       EK++ E++ +      +T   K   P+  A I E  R   ++P  +      + ++ GY IK    +IAQ  ++  D  ++ +P +FNP RFI +E+G       LIPF IG R C GE + R E F  +    + + +S S E   + DK
Sbjct:    2 ILLLVFTAFLAFLFHELYWKRRNLPPGPIPLPYMG-------NILTMLMNKPGYECFRNWTKKYGDVYTFWMGKTPYVMISSYDLLKDTFVRDGDTYKDKYPQPFNQKIRGGNY-GIVESNGHLWNTHRRFALTTLRDFGLGKDLMHEKILIEVENIFKKFDAQLGLEQDVSVVMNNAIANVINQNIFGYRFEGDKEEDFKKLRELMEYQETAFATFKVYVEAFIPKVGALLPGRSLDVLLEEWRDNFYSFFDTQIENHRKKIDFDSQESLDYAEAYLKEQRKQEALGEFELFSNKQLSNT-----CLDLWSAGLSTTYTTVTWALAYVLNSPEVLEKMRSELDEVVGKDRFVTTADKNDLPYMNAAINEVQRCANLLPVNVAHATTRDTVINGYAIKKGTGVIAQISTVMLDEKVFPDPYKFNPDRFI-DEHGKLIKVEQLIPFSIGRRQCPGEGLARMEIFLFVANFFNHYQISPSSEGFPSIDK 474          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Celegans
Match: cyp-33C5 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O16671])

HSP 1 Score: 128.642 bits (322), Expect = 1.012e-31
Identity = 116/492 (23.58%), Postives = 219/492 (44.51%), Query Frame = 2
Query:   86 MLFYFIWLSVCFILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGR-PRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQI-----LWKYRSFSAVKKLFPMLEKYAN--------KVSMLHKYIKLKVQRKL----KYLTEDPNEECLIKY--YINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDK 1498
            M+   +  +VC  L    F+  Y  + + PPGP  +PF+G        ++ +  +      F++  K +G +  F++G+   V++ S+D++ E +V++   +  + P+ F  + L     G++ S   +W  +R   + +  D G+G+    +  +  +E +        GKE D+  +L      ++N  IFG+  +ET    ++    +    +  F   ++     +     F   K L  +L+ + N        ++    K I    +        YL E   +E L ++  + N Q  N+     C+DL+LAGV T ++ V+  +  +  H    +K+  E + +  +   +T   K   P+  A + E  R   +VP  +     ++ ++ GY +K    +IAQ  ++  D  ++  P +FNP RFI +ENG       LIPF IG R C GE + R E F  +    +++ +S S +   N DK
Sbjct:    1 MILLLLSAAVCLFL----FHELYWKRRSLPPGPTPLPFMG-------NTLAMLLEKPGYECFRRWTKQFGGVYTFWMGNIPYVIIGSYDLLKETFVRDGDTYKDKYPQPFN-EKLRGGMYGIVESNGHMWSTHRRFALSTLRDFGLGKDLMQEKILIEVEDIFRKYDAQLGKEQDIQVVLNNAIANVINQTIFGYRFDETNQEEFERMRHLVEYQEKQFATVKVYVEAFVPTIGKFLPGKSLDQLLDDWRNSFYTFFDTQIENHRKKIDFDSEESQDYAEAYLKEQKKQEALGEFELFSNTQFSNT-----CLDLWLAGVSTTNTTVNWTICYVLNHPDVLQKMNEEFDQVVGSDRLVTMGDKNNLPYFNAVLNESQRCANIVPINLFHATTKDTVINGYPVKKGTGVIAQISTVMLDEKIFPEPYKFNPDRFI-DENGKPIKIEQLIPFSIGKRQCPGEGLARMEIFLFLANFFNRYKISPSSKVFPNLDK 474          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Celegans
Match: cyp-23A1 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27465])

HSP 1 Score: 128.642 bits (322), Expect = 1.618e-31
Identity = 108/448 (24.11%), Postives = 216/448 (48.21%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWI-REC--QGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKV----SMLHKYIKLKVQ-RKLKY---LTEDPNEECLIKYYIN--KQMENSE---------IFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPA-IERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTLVFTE 1564
            YG I   +IG   +V++S    I + ++++   F+ R R F  D + +   G++  +   W+E R   + +  D GVG+     +    + S+   + + C   GKE  +   +      I+N+++FG    +  S ++ +++ +    Q+      I+  Y +F    K+ P++    N++    + L ++++ +++  ++ +   + E   E+    Y I   K+  N E         + +  +DL+ AG++T  + +    LL+ K+Q  Q+ ++ E++++   +  I  +H+   P+ QA I E  R   ++P  + R   E++ + GY  K  DLII Q   +  D  ++ENP EFNP RF+ E+N N +     +PF IG R CLGE + R E +     ++  FN  ++ + T   +++L     G+  SP++++   T 
Sbjct:   89 YGGIFTVWIGPIPLVMVSDLPTIKKYFIQHADSFSNRWRNFVTDSIMEGSNGIVQIDGNKWREQRRFALHTLRDFGVGKPLMEQMITLEVTSLMNHMEKSCGLDGKELHLCPSIAVCVGNIINNMLFGLRFNQDNSYMHRLHQLLD--DQSHTVMQPIMGAYIAFPVTSKI-PIINGEWNRLMGIKNELLEFLETQIEGHRMNWKDEMIEQEPEDLTYAYMIEVEKRKRNGEDVGFFDDQQLKMLLLDLFFAGMETTVTTLKWAFLLMAKNQKVQKNVQAELDSIGQPM--IEIQHRTRLPYVQATINEIQRIANILPINLLRTVAEDIEIDGYNFKKGDLIIPQISILMNDPEIFENPEEFNPSRFLDEDN-NVKKIDEFLPFSIGRRQCLGESLARAELYLVFANLIQNFNFEVADDVTT--ERVL-----GLTVSPVEYSCKITR 523          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Fly
Match: Cyp305a1 (gene:FBgn0036910 transcript:FBtr0074925)

HSP 1 Score: 105.531 bits (262), Expect = 7.637e-24
Identity = 94/417 (22.54%), Postives = 180/417 (43.17%), Query Frame = 2
Query:  314 IGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILS-DDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETE--------------SNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPN--EECLIKYYINKQMENS-----------EIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEH---KRFFPFTQAFIEECHRYFAVVPAI-ERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSL 1468
            +G + +V+    +++ E  ++   +F GRP  F L + +    KG+  ++ ++W E+R   +K   ++G GR +         E +   +   + +  +    L ++ L ++  LI G      E              S ++DI   +           Q  W  R  +  +  + ++++   +   L+ +    ++   + L +DP+  E  LI  Y+ +  + S           ++ +  +D ++AG  T S+ ++  L++L      QEK+  ++       +   + H   +  F +  AFI E  R+F + P    RR +    L GY I     I+    S+  D   W++P EF P RFI      F+ + Y +PFG+G R CLG+ + R   F+ +V IV  F+V L
Sbjct:   75 LGREYVVVALGHEMVKEVQLQE--VFEGRPDNFFLRLRTMGTRKGITCTDGQLWYEHRHFAMKQMRNVGYGRSQMEHHIELEAEELLGQLERTEEQPIEPVTWLAQSVLNVLWCLIAGKRIARQEDGTLRRLLDLMNRRSKLFDICGGLL---------AQFPW-LRHVAPDRTGYNLIQQLNTE---LYGFFMDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGESSTFNETQLVMTILDFFIAGSQTTSNTINLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSRREAFDYMDAFIMEVQRFFHITPITGPRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFIDSAGKCFK-DEYFMPFGMGRRRCLGDALARACIFSFLVRIVQHFSVVL 475          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074610)

HSP 1 Score: 88.9669 bits (219), Expect = 2.542e-18
Identity = 92/398 (23.12%), Postives = 169/398 (42.46%), Query Frame = 2
Query:  389 FNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHD---------LGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDI-YETICFLAQTD---FTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTED------PNE-ECLIKYYI------NKQMENSEIF----------ICCVDLYLAGVDTV-SSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSL 1468
            F GRP    +  L+    G++ S  K+WK+ R    +  HD         +G G+++     +  +      +    G+  D++ ++      ++ SL+       T  +I D  +    FL +     F E   +     +    + FP +    NK++      + ++QR  + + +D      PN    L+ +Y+        +  ++E+F             +DL+ AG++T+ ++ +   + +L   +  +       + +     P T E  ++ P T++ I E  R  ++VP A    P  +V L GY I     +I    S+  D  LWE P EF P RFI  E G  +   Y IPFG+G R CLG+++ R E F    + +  F+++L
Sbjct:  115 FTGRPDTPFMQTLNG--YGIINSTGKLWKDQR----RFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMM-----STRFSIDDPKFRRFNFLIEEGMRLFGEIHTV----DYIPTMQCFPSISTAKNKIAQ----NRAEMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLP-TIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTE-GKVRKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIAL 491          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074609)

HSP 1 Score: 88.9669 bits (219), Expect = 2.542e-18
Identity = 92/398 (23.12%), Postives = 169/398 (42.46%), Query Frame = 2
Query:  389 FNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHD---------LGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDI-YETICFLAQTD---FTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTED------PNE-ECLIKYYI------NKQMENSEIF----------ICCVDLYLAGVDTV-SSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSL 1468
            F GRP    +  L+    G++ S  K+WK+ R    +  HD         +G G+++     +  +      +    G+  D++ ++      ++ SL+       T  +I D  +    FL +     F E   +     +    + FP +    NK++      + ++QR  + + +D      PN    L+ +Y+        +  ++E+F             +DL+ AG++T+ ++ +   + +L   +  +       + +     P T E  ++ P T++ I E  R  ++VP A    P  +V L GY I     +I    S+  D  LWE P EF P RFI  E G  +   Y IPFG+G R CLG+++ R E F    + +  F+++L
Sbjct:  115 FTGRPDTPFMQTLNG--YGIINSTGKLWKDQR----RFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMM-----STRFSIDDPKFRRFNFLIEEGMRLFGEIHTV----DYIPTMQCFPSISTAKNKIAQ----NRAEMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLP-TIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTE-GKVRKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIAL 491          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Fly
Match: Cyp6a2 (gene:FBgn0000473 transcript:FBtr0086133)

HSP 1 Score: 82.8037 bits (203), Expect = 2.280e-16
Identity = 64/207 (30.92%), Postives = 106/207 (51.21%), Query Frame = 2
Query:  932 MENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXN-LENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPAIERRPMEEVILKGY---LIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTE---NYD--KILEGTSGGI 1525
            M+  E+       Y+AG +T SS +S CL  L ++Q  Q++++ EI+  LE     +TYE  +   +    I E  R + +VP +ER+ + + ++ G+   +I+    +I    +   D  L+ NP  F+P RF  E+    +   +L PFG G R C+G   G+ +    +  I+S+F VS+  +TTE    Y    I+ GT GGI
Sbjct:  295 MDIGELAAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYESIKAMTYLNQVISETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLYPNPETFDPERFSPEKVAARESVEWL-PFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVC-DTTEIPLKYSPMSIVLGTVGGI 499          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Fly
Match: phm (gene:FBgn0004959 transcript:FBtr0074603)

HSP 1 Score: 80.4925 bits (197), Expect = 1.131e-15
Identity = 104/491 (21.18%), Postives = 196/491 (39.92%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQ-----------GKEFDVNRILFKTFLKIMNSLIFGHEPEETESN---IYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIK---------------LKVQRKLKYLTE----------DPNE--------------------ECLIKYYINKQMENSEIFI------CCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTLVFTE 1564
            YG I +  +G    V+LS   ++ + + ++  +  GR  ++    +   F G++ +++ IW+  R  T+     LG+ R+   +L       +   + EC              E +    L  +   I+N L+FG   +  + +   +  + E    L         + W     + V+ +  +LE  A   ++  + ++               L+ Q++L+   E          DP++                    EC++++++  +  +S+++          DL+ AGVDT  + +   LL L + Q  Q ++   +  L  +    T E      + +A I E  R  +VVP  I     E  ++  Y IK   +I+  +++I  D   +  P EF P RF+   +G +Q     IPF  G R C GE + R         I+ +F++ L   T  +    + G S GI  +P  H L FT+
Sbjct:   80 YGGIFELKMGRVPTVVLSDAALVRDFFRRD--VMTGRAPLYLTHGIMGGF-GIICAQEDIWRHARRETIDWLKALGMTRRP-GELRARLERRIARGVDECVRLFDTEAKKSCASEVNPLPALHHSLGNIINDLVFGITYKRDDPDWLYLQRLQEEGVKLIGVSGVVNFLPWLRHLPANVRNIRFLLEGKAKTHAIYDRIVEACGQRLKEKQKVFKELQEQKRLQRQLEKEQLRQSKEADPSQEQSEADEDDEESDEEDTYEPECILEHFLAVRDTDSQLYCDDQLRHLLADLFGAGVDTSLATLRWFLLYLAREQRCQRRLHELLLPLGPSP---TLEELEPLAYLRACISETMRIRSVVPLGIPHGCKENFVVGDYFIKGGSMIVCSEWAIHMDPVAFPEPEEFRPERFLT-ADGAYQAPPQFIPFSSGYRMCPGEEMARMILTLFTGRILRRFHLELPSGTEVD----MAGES-GITLTPTPHMLRFTK 557          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Zebrafish
Match: cyp2y3 (cytochrome P450, family 2, subfamily Y, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-050522-490])

HSP 1 Score: 151.369 bits (381), Expect = 2.043e-39
Identity = 111/403 (27.54%), Postives = 192/403 (47.64%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANK-VSMLHKYIKLKVQRKLKYLT-EDPNE--ECLI------KYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVS 1465
            YG +   ++G QR+V+L  ++ + EA V     F  R  I  ++ +   + GL +S  + W++ R  T+ +  D G+GRK            + +   E + K  D      +T   ++ SL+FG   +  + N   + + I  L +  F  +     Y  F  V + F        K V  +  +I+ KV+   + L   DP++  +C +      K  ++ +     +    ++L++AG +T S+ +   L+LL KH   QE+++ EI+ +       T E ++  PFT A I E  RY  +VP ++    M+++  +GY I    +II   +S+  D   WE P  FNP  F+ + NGNF+ N   +PF  G R C+GE + R E F  IV+++ KF+ S
Sbjct:   62 YGSVMTVHLGPQRMVVLVGYETVKEALVDQADDFAPRAPIPFMNRIVKGY-GLAISNGERWRQLRRFTLTTLRDFGMGRKRMEQWIQEESRYLLKSFEETKSKPVDPTFFFSRTVSNVICSLVFGQRFDYEDKNFLQLLQIISKLLR--FLSSPWGQLYNIFPQVMESFSSRHHAILKDVENIRTFIRNKVKEHEQRLDFSDPSDFIDCFLIRLTQEKDKLDTEFHKDNLMATVLNLFVAGTETTSTTLRYALMLLIKHPQIQEQMQREIDRVIGQNRIPTMEDRKSLPFTDAVIHEVQRYMDIVPLSLPHYAMKDITFRGYKIPKDTVIIPMLHSVLRDEGHWETPWTFNPEHFL-DSNGNFKKNPAFMPFSAGKRVCVGESLARMEIFLFIVSLLQKFSFS 460          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Zebrafish
Match: cyp2y3 (cytochrome P450, family 2, subfamily Y, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-050522-490])

HSP 1 Score: 147.902 bits (372), Expect = 4.007e-38
Identity = 109/403 (27.05%), Postives = 190/403 (47.15%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANK-VSMLHKYIKLKVQRKLKYLT-EDPNE--ECLI------KYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVS 1465
            YG +   ++G QR+V+L  ++ + EA V     F  R  I  ++ +   + GL +S  + W++ R  T+ +  D G+GRK            + +   E + K  D      +T   ++ SL+FG   +  + N   + + I  L +  F  +     Y  F  V + F        K V  +  +I+ KV+   + L   DP++  +C +      K  ++ +     +    ++L++AG +T S+ +   L+LL KH   QE+++ EI+ +       T E ++  PFT A I E  RY  +VP ++    M+++  +GY I    +II   +S+  D   WE P  FNP  F+ + NGNF+ N   +PF  G R+C+GE +   E F   V+++ KF  S
Sbjct:   62 YGSVMTVHLGPQRMVVLVGYETVKEALVDQADDFAPRAPIPFMNRIVKGY-GLAISNGERWRQLRRFTLTTLRDFGMGRKRMEQWIQEESRYLLKSFEETKSKPVDPTFFFSRTVSNVICSLVFGQRFDYEDKNFLQLLQIISKLLR--FLSSPWGQLYNIFPQVMESFSSRHHAILKDVENIRTFIRNKVKEHEQRLDFSDPSDFIDCFLIRLTQEKDKLDTEFHKDNLMATVLNLFVAGTETTSTTLRYALMLLIKHPQIQEQMQREIDRVIGQNRIPTMEDRKSLPFTDAVIHEVQRYMDIVPLSLPHYAMKDITFRGYKIPKDTVIIPMLHSVLRDEGQWETPWTFNPEHFL-DSNGNFKKNPAFMPFSAGKRSCVGESLASMELFLFTVSLLQKFTFS 460          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Zebrafish
Match: CU179648.3 (cytochrome P450, family 2, subfamily X, polypeptide 12 [Source:NCBI gene;Acc:325939])

HSP 1 Score: 144.436 bits (363), Expect = 7.030e-37
Identity = 123/481 (25.57%), Postives = 213/481 (44.28%), Query Frame = 2
Query:  113 VCFILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPM-----------LEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPA-IERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTE-NYDKILEGTS 1516
            +C   +++   V      + PPGP  VPF G        ++L   ++N      +  + YG I   YIG +  V+L+   +I EA +     F GRP    +  ++     +M    + W+E+R   + +  + G+G+K      +  ++ +C  + E  GK  D   +  +    I+ S+IFG      +     + +T+  L +       +L++    + V ++FP+           + +Y+ KV   HK  K  V  + K L +   EE   +       + +++     DL+LAG +T S+ +    L L  H H QE+ + EI+ +    + +TYE +    F QA I E  R   +VP  +      +  L+GY I    +II    S   + + W+ P+EFNP  F+ E+ G F  N   +PF  G R CLGE + R E F  +V ++ KF +    +  E ++  I  GT 
Sbjct:    8 LCLGAILLYLQVRIRRPKDFPPGPAPVPFFG--------NLLQLNRINPIKDLDKFAQHYGSIYGIYIGSKPAVVLTGQKMIKEALITQAAEFAGRPNHMMISHITRSKGVIMADYGESWREHRRFALTTLRNFGLGKKSMEQRILEEVKHICLLLEESAGKSIDPQHLYHQAASNIIASVIFGSRFNYKDEYFQTLIQTMEKLTKIAIGTWAMLYE---IAPVLRIFPLPFWKAFHYFEKITRYSLKVVEEHK--KSFVAGEPKDLIDCYLEEMKKRADQRTTFDEAQMVTLLFDLFLAGTETTSNTLRTLTLYLMTHTHIQEQCQREIDEVLGARDHVTYEDRNDMHFVQAVIHEGQRVADIVPLNVFHTARTDTQLRGYSIPKGTIIIPYLSSSLREESQWKFPHEFNPQNFLNEK-GEFVKNEAFMPFSAGPRVCLGENLARMELFLILVTVLRKFRLVWPKDAGEPDFTYIYGGTQ 474          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Zebrafish
Match: cyp2x12 (cytochrome P450, family 2, subfamily X, polypeptide 12 [Source:ZFIN;Acc:ZDB-GENE-030131-4664])

HSP 1 Score: 142.51 bits (358), Expect = 3.143e-36
Identity = 120/483 (24.84%), Postives = 214/483 (44.31%), Query Frame = 2
Query:  113 VCFILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPM----LEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQ---------MENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPA-IERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTE-NYDKILEGTS 1516
            +C    ++   V      + PPGP  VPF G        ++L   ++N      +  + YG I   YIG +  V+L+   +I EA +     F GRP    +  ++     +M    + W+E+R   + +  + G+G+K      +  ++ +C  + E  GK  D   +  +    I+ S+IFG      +     + +T+  L +       +L++    + V ++FP+       Y  K++     +K+  + K  ++  +P +  LI  Y+ +           + +++     DL+LAG +T S+ +    L L  H H QE+ + EI+ +    + +TYE +    F QA I E  R   +VP  +      +  L+GY I    +II    S   + + W+ P+EFNP  F+ E+ G F  N   +PF  G R CLGE + R E F  +V ++ KF +    +  E ++  I  GT 
Sbjct:    8 LCLGAFLLYLQVRIRRPKDFPPGPAPVPFFG--------NLLQLNRINPIKDLDKFAQHYGSIYGIYIGSKPAVVLTGQKMIKEALITQAAEFAGRPNHMMISHITRSKGVIMADYGESWREHRRFALTTLRNFGLGKKSMEQRILEEVKHICLLLEESAGKSIDPQHLYHQAASNIIASVIFGSRFNYKDEYFQTLIQTMEKLTKIAIGTWAMLYE---IAPVLRIFPLPFWKAFHYFEKIT--RHSLKVVEEHKKSFVAGEPKD--LIDCYLEEMKKRADQRTTFDEAQMVTLLFDLFLAGTETTSNTLRTLTLYLMTHTHIQEQCQREIDEVLGARDHVTYEDRNDMHFVQAVIHEGQRVADIVPLNVFHTARTDTQLRGYSIPKGTIIIPYLSSSLREESQWKFPHEFNPQNFLNEK-GEFVKNEAFMPFSAGPRVCLGENLARMELFLILVTVLRKFRLVWPKDAGEPDFTYIYGGTQ 474          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Zebrafish
Match: cyp2p10 (cytochrome P450, family 2, subfamily P, polypeptide 10 [Source:ZFIN;Acc:ZDB-GENE-040120-1])

HSP 1 Score: 140.198 bits (352), Expect = 1.860e-35
Identity = 125/490 (25.51%), Postives = 225/490 (45.92%), Query Frame = 2
Query:   86 MLFYFIWLSV-------CFILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIES--MCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNE------ECLIKYYIN---KQMENSE-----------IFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPA-IERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVS 1465
            M +++ W+ +       C  L++  +  N APK N PPGP S+PF+G         +         L F +  + YG+I  F +   RIV+L+ ++++ E Y +       RP +     +  D +GL+ S    WK  R   + +  + G+G+K   +LS+ N E   + E I   QG+ F+   +L      ++  L+FG+  E ++ +  ++   I    ++ + E  I      F  +  +FP L +    +   HK +    QR   ++ E  NE      +  ++ YI+    +ME  +           + +C +DL++AG +T S+ +   LL + K+   Q K++ EI+ +  +    +   +   P+T A I E  R   ++P  + R   E+  ++ Y I    L+I    S+ +D + WE P+ FNP  F+  E G F+     +PF +G R CLGE + R E F    +++ +F  S
Sbjct:    3 MFYFYEWVDIKSILIFLCVFLLLSDYIKNKAPK-NFPPGPWSLPFIG--------DLHHIDPNKIHLQFTEFAEKYGKIFSFRLFGSRIVVLNGYNLVKEVYTQQGDNLADRPTLPITSAIIGDNRGLVASSGYKWKHQRRFALTTLRNFGLGKKNL-ELSI-NFECGFLNEAISNEQGRPFNPRLLLNNAVSNVICVLVFGNRFEYSDHHFQNLLNKI---NESVYLEGSI------FVHLYNMFPWLMQL---LPGPHKKLITLWQRVTDFVREKVNEHRADYDQSSLRDYIDCFLAEMEKHKDDTAAGFDVENLCMCTLDLFVAGTETTSTTLYWGLLYMIKYPEIQAKVQQEIDAVVGSSRQPSGSDRDNMPYTNAVIHEIQRMGNIIPLNVVRTTSEDTRIEKYSIPKGTLVIGSLTSVLFDESEWETPHSFNPGHFLDAE-GKFRRRDAFLPFSLGKRVCLGEQLARMELFLFFTSVLQRFTFS 468          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Xenopus
Match: ENSXETT00000043140.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:50332469:50402725:-1 gene:ENSXETG00000002382.1 transcript:ENSXETT00000043140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.525 bits (384), Expect = 1.053e-39
Identity = 122/443 (27.54%), Postives = 207/443 (46.73%), Query Frame = 2
Query:  173 PPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSE-KKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKE--------FDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWK--YRSFSAVKKLFPMLEKYANKVSMLHKYI-KLKVQRKLKYLTEDPNE--ECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKF 1456
            PPGP ++P LG I  + + + L   +   ++        YG +   Y+G    V++     I E  V     F GRP+    D++S   KGL+++   + WKE+R  T+ +    G+G+K   D      E++C  I E   ++        FD + +L      I+ S++FG   +  +++    ++ I  L   +       W   Y +F  ++ L    +K    V ++  ++ K+  + K   L  +P +  +C ++       +   +F C  DL++AG +T +S +  CLL + K    QEK   EI+ +    N + YE +   P+TQA ++E  R+ +VVP  +   P+ +V L G+ I    +II    S+ YD T W+ P+EFNP  F+  ENG        +PF  G R CLGE + R E F    A++  F
Sbjct:   28 PPGPAAMPVLGNILQMDFSNPLKDLQKFSEV--------YGPVYSIYLGFTPAVVVRGLKSIKEVLVNKGTDFAGRPQNRITDVISKS-KGLVVAPYGQAWKEHRRFTLSTLRSFGLGKKSMEDR--IQEENICALIEESTRRKIQSEHNVLFDPHFVLENAVSNIICSIVFGRRYDYNDTS----FQNILNLVHENMKLATGFWAQLYNAFGFIQFLPLPHKKIFQNVDVVFAFLGKVVEEHKETLLPGEPRDYIDCYLEELKKMTFDEENLFSCVADLFVAGTETTTSSLEWCLLYMLKFPEIQEKCHEEIDRVFGNKNCLEYEDRERMPYTQAVLQEVQRHASVVPLGVSHSPIRDVHLNGFFIPKGTVIITDLSSVHYDKTHWKYPHEFNPENFLN-ENGELIKTEAFLPFSAGPRVCLGENLARMEIFLFFTAMLQHF 454          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Xenopus
Match: ENSXETT00000043247.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:50332572:50402725:-1 gene:ENSXETG00000002382.1 transcript:ENSXETT00000043247.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.747 bits (369), Expect = 1.090e-37
Identity = 116/435 (26.67%), Postives = 201/435 (46.21%), Query Frame = 2
Query:  173 PPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSE-KKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWK--YRSFSAVKKLFPMLEKYANKVSMLHKYI-KLKVQRKLKYLTEDPNE--ECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKF 1456
            PPGP ++P LG I  + + + L   +   ++        YG +   Y+G    V++     I E  V     F GRP+    D++S   KGL+++   + WKE+R  T+ +    G+G+K   D        + +  +  +G+  +           I+ S++FG   +  +++    ++ I  L   +       W   Y +F  ++ L    +K    V ++  ++ K+  + K   L  +P +  +C ++       +   +F C  DL++AG +T +S +  CLL + K    QEK   EI+ +    N + YE +   P+TQA ++E  R+ +VVP  +   P+ +V L G+ I    +II    S+ YD T W+ P+EFNP  F+  ENG        +PF  G R CLGE + R E F    A++  F
Sbjct:   28 PPGPAAMPVLGNILQMDFSNPLKDLQKFSEV--------YGPVYSIYLGFTPAVVVRGLKSIKEVLVNKGTDFAGRPQNRITDVISKS-KGLVVAPYGQAWKEHRRFTLSTLRSFGLGKKSMEDRIQEENMHLIQAFKNSKGRPIN-------AVSNIICSIVFGRRYDYNDTS----FQNILNLVHENMKLATGFWAQLYNAFGFIQFLPLPHKKIFQNVDVVFAFLGKVVEEHKETLLPGEPRDYIDCYLEELKKMTFDEENLFSCVADLFVAGTETTTSSLEWCLLYMLKFPEIQEKCHEEIDRVFGNKNCLEYEDRERMPYTQAVLQEVQRHASVVPLGVSHSPIRDVHLNGFFIPKGTVIITDLSSVHYDKTHWKYPHEFNPENFLN-ENGELIKTEAFLPFSAGPRVCLGENLARMEIFLFFTAMLQHF 441          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Xenopus
Match: slc35b2 (solute carrier family 35 member B2 [Source:Xenbase;Acc:XB-GENE-1009913])

HSP 1 Score: 145.976 bits (367), Expect = 2.192e-37
Identity = 125/496 (25.20%), Postives = 222/496 (44.76%), Query Frame = 2
Query:   98 FIWLSVCFILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRI-FGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQME---------NSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPA-IERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTL 1552
             + +++C I+ I ++        N PPGP  +P +G        +I         L + +L K YG I +  IG Q++V+L  ++ + +A V     F+ RP +   LD++ +   G++ S  + WK  R  T+ +  D G+GR+   D      + + E  +  +GK FD   I+      I+ S++ GH  +  +     +   I        T +  +  Y  F +V +  P   +   K +  ++    +   K K   +  ++  L+  ++ KQ E         +  + +   +L++AG++T S+ V   LLL+ K+   Q+ ++ EIE +     P T EH++  P+T A I E  R+  ++P  +     ++V  +GY +     +I    S+ YD T +E P EF P  F+  E GNF  N   +PF  G R+C GE + R E F    +++  F  +      E  D      + GI   PL H +
Sbjct:   10 LLAVALCLIVAITLYRQKRDSSKNFPPGPKPLPIIG--------NIHNINLKRPYLTYLELWKKYGPIFRVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVVPIFLDVVKE--YGIIFSHGENWKVMRRFTLSTLRDFGMGRRTIEDRINEECDFLVEQFKSFKGKPFDNTMIMNAAVANIIVSIVLGHRFDYQDPKFLRLMSLIN--ENLRLTGSPTVMLYNVFPSVMRWLPGNHQTVGKNAAENQRFIRETFIKHKEKLDVNDQRNLVDAFLVKQQEKKGNAVYFHDDNLTMLVSNLFVAGMETTSTSVRWGLLLMMKYPEIQKNVQNEIEKVIGQSRPQT-EHRKSMPYTDAVIHEIQRFGNIIPMNLPHATAQDVTFRGYFLPKGTFVIPLLTSVLYDQTRFEKPKEFYPQHFLDSE-GNFVKNEAFLPFSAGKRSCAGENLARMELFLFFTSLLQNF--TFQAPPGEELDLT---PAIGITTPPLPHNI 486          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Xenopus
Match: slc35b2 (solute carrier family 35 member B2 [Source:Xenbase;Acc:XB-GENE-1009913])

HSP 1 Score: 145.976 bits (367), Expect = 2.192e-37
Identity = 125/496 (25.20%), Postives = 222/496 (44.76%), Query Frame = 2
Query:   98 FIWLSVCFILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRI-FGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQME---------NSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPA-IERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTL 1552
             + +++C I+ I ++        N PPGP  +P +G        +I         L + +L K YG I +  IG Q++V+L  ++ + +A V     F+ RP +   LD++ +   G++ S  + WK  R  T+ +  D G+GR+   D      + + E  +  +GK FD   I+      I+ S++ GH  +  +     +   I        T +  +  Y  F +V +  P   +   K +  ++    +   K K   +  ++  L+  ++ KQ E         +  + +   +L++AG++T S+ V   LLL+ K+   Q+ ++ EIE +     P T EH++  P+T A I E  R+  ++P  +     ++V  +GY +     +I    S+ YD T +E P EF P  F+  E GNF  N   +PF  G R+C GE + R E F    +++  F  +      E  D      + GI   PL H +
Sbjct:   10 LLAVALCLIVAITLYRQKRDSSKNFPPGPKPLPIIG--------NIHNINLKRPYLTYLELWKKYGPIFRVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVVPIFLDVVKE--YGIIFSHGENWKVMRRFTLSTLRDFGMGRRTIEDRINEECDFLVEQFKSFKGKPFDNTMIMNAAVANIIVSIVLGHRFDYQDPKFLRLMSLIN--ENLRLTGSPTVMLYNVFPSVMRWLPGNHQTVGKNAAENQRFIRETFIKHKEKLDVNDQRNLVDAFLVKQQEKKGNAVYFHDDNLTMLVSNLFVAGMETTSTSVRWGLLLMMKYPEIQKNVQNEIEKVIGQSRPQT-EHRKSMPYTDAVIHEIQRFGNIIPMNLPHATAQDVTFRGYFLPKGTFVIPLLTSVLYDQTRFEKPKEFYPQHFLDSE-GNFVKNEAFLPFSAGKRSCAGENLARMELFLFFTSLLQNF--TFQAPPGEELDLT---PAIGITTPPLPHNI 486          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Xenopus
Match: slc35b2 (solute carrier family 35 member B2 [Source:Xenbase;Acc:XB-GENE-1009913])

HSP 1 Score: 145.591 bits (366), Expect = 3.537e-37
Identity = 126/497 (25.35%), Postives = 222/497 (44.67%), Query Frame = 2
Query:   98 FIWLSVCFILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRI-FGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANK-VSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQME---------NSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPA-IERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTL 1552
             + +++C I+ I ++        N PPGP  +P +G        +I         L + +L K YG I +  IG Q++V+L  ++ + +A V     F+ RP +   LD++ +   G++ S  + WK  R  T+ +  D G+GR+   D      + + E  +  +GK FD   I+      I+ S++ GH  +  +     +   I        T +     Y  F +V +  P   +   K  +  H++I+    +    L  + ++  L+  ++ KQ E         +  + +   +L++AG++T S+ V   LLL+ K    Q+ ++ EIE +     P T EH++  P+T A I E  R+  ++P  +     ++V  +GY +     +I    S+ YD T +E P EF P  F+  E GNF  N   +PF  G R+C GE + R E F    +++  F  +      E  D      + GI   PL H +
Sbjct:   10 LLAVALCLIVAITLYRQKRDSSKNFPPGPKPLPIIG--------NIHNINLKRPYLTYLELWKKYGPIFRVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVVPIFLDVVKE--YGIIFSHGENWKVMRRFTLSTLRDFGMGRRTIEDRINEECDFLVEQFKSFKGKPFDNTMIMNAAVANIIVSIVLGHRFDYQDPIFLRLMSLIN--ENVRLTGSPKAMLYNVFPSVMRWLPGNHQTVGKNAAEYHRFIRETFTKYRDKLDIN-DQRNLVDAFLVKQQEKNGNAVYFHDDNLTVLVSNLFVAGMETTSTSVRWGLLLMMKFPEIQKNVQNEIEKVIGQSRPQT-EHRKSMPYTDAVIHEIQRFGNIIPMNLPHATAQDVTFRGYFLPKGTFVIPLLTSVLYDQTRFEKPKEFYPQHFLDSE-GNFVKNEAFLPFSAGKRSCAGENLARMELFLFFTSLLQNF--TFQAPPGEELDLT---PAIGITTPPLPHNI 486          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Mouse
Match: Cyp2a5 (cytochrome P450, family 2, subfamily a, polypeptide 5 [Source:MGI Symbol;Acc:MGI:88597])

HSP 1 Score: 141.354 bits (355), Expect = 7.463e-36
Identity = 119/465 (25.59%), Postives = 210/465 (45.16%), Query Frame = 2
Query:  110 SVCFILMIIIFYVNYAPK--SNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANK-VSMLHKYIKLKVQRKLKYLTEDPN------EECLIKYYINKQMENSEIF-----ICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFN 1459
            +V F+ ++++  V    K     PPGP  +PF+G        + L            ++ + YG +   Y+G +RIV+L   + + EA V     F+GR      D L   + G+  S  +  K+ R  ++ +  D GVG++   +        + +  R+  G   D    L +T   +++S++FG   +  +     +   +  L    FT T +   Y  FS+V K  P  ++ A K +  L  +I  KV+   + L  DPN      +  LI+    K+  N+E +     +  ++L+ AG +TVS+ +    LLL KH   + K+  EI+ +        YE +   P+T+A I E  R+  ++P  + RR  ++   + +L+     +     S+  D   + NP +FNP  F+ ++ G F+ N   +PF IG R C GE + R E F  +  I+  F+
Sbjct:   11 AVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFIG--------NFLQLNTEQMYNSLMKISQRYGPVFTIYLGPRRIVVLCGQEAVKEALVDQAEEFSGRGEQATFDWLFKGY-GVAFSSGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDSFRKTNGAFIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMM--LGSFQFTATSMGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEHNQRTL--DPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKHPDIEAKVHEEIDRVIGRNRQPKYEDRMKMPYTEAVIHEIQRFADMIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLKDPKFFSNPKDFNPKHFL-DDKGQFKKNDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFH 461          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Mouse
Match: Cyp2c40 (cytochrome P450, family 2, subfamily c, polypeptide 40 [Source:MGI Symbol;Acc:MGI:1306815])

HSP 1 Score: 140.969 bits (354), Expect = 1.067e-35
Identity = 118/470 (25.11%), Postives = 207/470 (44.04%), Query Frame = 2
Query:   98 FIWLSVCF-ILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTED---PNEECLIKYY-INKQMENS---------EIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNV 1462
            F+ L +C   L+++  +   + + N PPGP  +P +G        +  L    +         K YG +   Y G Q IV+L  ++ I EA + +   F+GR RI   D +S   KG+  S   +WK  R  TV +  +LG+G++   +      + + + +++  G   D   I+      ++ S++F +  +  + +   +   +      + TE       + F+AV  L        NK+   H +IK  +  K+K   E     N    I Y+ I ++ +N           +     DL   G +T+SS +   LLLL KH H   K++ EI+N+         + +   P+T A + E  RY  + P  +      +   + Y I     ++    S+ +DST + NP  F+P  F+ ++NGNF+ + Y +PF  G R C+GE + R E F  +  I+  F +
Sbjct:    4 FVVLVLCLSFLLVLSLWRQRSARGNLPPGPTPLPIIG--------NYHLIDMKDIGQCLTNFSKTYGPVFTLYFGSQPIVVLHGYEAIKEALIDHGEEFSGRGRIPVFDKVSTG-KGIGFSHGNVWKATRVFTVNTLRNLGMGKRTIENKVQEEAQWLMKELKKTNGSPCDPQFIIGCAPCNVICSIVFQNRFDYKDKDFLSLIGKV-----NECTEILSSPGCQIFNAVPILIDYCPGSHNKLFKNHTWIKSYLLGKIKEHEESLDVTNPRDFIDYFLIQRRQKNGIEHMDYTIEHLATLVTDLVFGGTETLSSTMRFALLLLMKHTHITAKVQEEIDNVIGRHRSPCMQDRNHMPYTNAMVHEVQRYIDLGPNGVVHEVTCDTKFRNYFIPKGTQVMTSLTSVLHDSTEFPNPEVFDPGHFL-DDNGNFKKSDYFVPFSAGKRICVGESLARMELFLFLTTILQNFKL 458          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Mouse
Match: Cyp2c40 (cytochrome P450, family 2, subfamily c, polypeptide 40 [Source:MGI Symbol;Acc:MGI:1306815])

HSP 1 Score: 140.584 bits (353), Expect = 1.889e-35
Identity = 118/470 (25.11%), Postives = 207/470 (44.04%), Query Frame = 2
Query:   98 FIWLSVCF-ILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTED---PNEECLIKYY-INKQMENS---------EIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNV 1462
            F+ L +C   L+++  +   + + N PPGP  +P +G        +  L    +         K YG +   Y G Q IV+L  ++ I EA + +   F+GR RI   D +S   KG+  S   +WK  R  TV +  +LG+G++   +      + + + +++  G   D   I+      ++ S++F +  +  + +   +   +      + TE       + F+AV  L        NK+   H +IK  +  K+K   E     N    I Y+ I ++ +N           +     DL   G +T+SS +   LLLL KH H   K++ EI+N+         + +   P+T A + E  RY  + P  +      +   + Y I     ++    S+ +DST + NP  F+P  F+ ++NGNF+ + Y +PF  G R C+GE + R E F  +  I+  F +
Sbjct:   33 FVVLVLCLSFLLVLSLWRQRSARGNLPPGPTPLPIIG--------NYHLIDMKDIGQCLTNFSKTYGPVFTLYFGSQPIVVLHGYEAIKEALIDHGEEFSGRGRIPVFDKVSTG-KGIGFSHGNVWKATRVFTVNTLRNLGMGKRTIENKVQEEAQWLMKELKKTNGSPCDPQFIIGCAPCNVICSIVFQNRFDYKDKDFLSLIGKV-----NECTEILSSPGCQIFNAVPILIDYCPGSHNKLFKNHTWIKSYLLGKIKEHEESLDVTNPRDFIDYFLIQRRQKNGIEHMDYTIEHLATLVTDLVFGGTETLSSTMRFALLLLMKHTHITAKVQEEIDNVIGRHRSPCMQDRNHMPYTNAMVHEVQRYIDLGPNGVVHEVTCDTKFRNYFIPKGTQVMTSLTSVLHDSTEFPNPEVFDPGHFL-DDNGNFKKSDYFVPFSAGKRICVGESLARMELFLFLTTILQNFKL 487          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Mouse
Match: Cyp2c69 (cytochrome P450, family 2, subfamily c, polypeptide 69 [Source:MGI Symbol;Acc:MGI:3721049])

HSP 1 Score: 137.887 bits (346), Expect = 1.068e-34
Identity = 117/470 (24.89%), Postives = 208/470 (44.26%), Query Frame = 2
Query:   98 FIWLSVCFILMIII-FYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTED---PNEECLIKYYI-----NKQMENSEIFI-----CCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNV 1462
            F+ L +C   M+++  +   + + N PPGP  +P +G        +  L    +         K YG +   Y G Q IV+L  ++ I EA + +  +F+GR      D +S   KG+  S   +WK  R  TV +  +L +G++   +      + + + +++  G   D   I+      ++ S++F +  +  + +   +   +      + TE       + F+AV  L        NK    H +IK  +  K+K   E     N    I Y++     +K +E+ E  I        DL   G +T+SS +   LLLL KH H   K++ EI+N+         + ++  P+T A + E  RY  + P ++      +   + Y I     ++    S+ +DST + NP  F+P  F+ ++NGNF+ + Y +PF  G R C+GE + R E F  +  I+  F +
Sbjct:    4 FVVLVLCLSFMLLLSLWRQRSARRNLPPGPTPLPIIG--------NYHLIDMKDIGQCLTNFSKTYGPVFTLYFGSQPIVVLHGYEAIKEALIDHGEVFSGRGSFPFFDKVSKG-KGIGFSHGNVWKATRVFTVNTLRNLAMGKRTIENKVQEEAQWLMKELKKTNGSPCDPQFIIGCAPCNVICSIVFQNRFDYKDKDFLSLIGKV-----NECTEILSSPGCQIFNAVPILIDYCPGRHNKFFKNHTWIKSYLLEKIKEHEESLDVTNPRDFIDYFLIQRRQDKGIEHMEYTIEHLATLVTDLVFGGTETLSSTMRFALLLLMKHTHITAKVQEEIDNVIGRHRSPCMQDRKHMPYTNAMVHEVQRYVDLGPTSLVHEVTCDTKFRNYFIPKGTQVMTSLSSVLHDSTEFPNPEVFDPGHFL-DDNGNFKKSDYFVPFSAGKRICVGESLARMELFLFLTTILQNFKL 458          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Mouse
Match: Cyp2a4 (cytochrome P450, family 2, subfamily a, polypeptide 4 [Source:MGI Symbol;Acc:MGI:88596])

HSP 1 Score: 137.887 bits (346), Expect = 1.121e-34
Identity = 118/471 (25.05%), Postives = 212/471 (45.01%), Query Frame = 2
Query:  110 SVCFILMIIIFYVNYAPK--SNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANK-VSMLHKYIKLKVQRKLKYLTEDPN------EECLIKYYINKQMENSEIF-----ICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSME 1477
            +V F+ ++++  V    K     PPGP  +PF+G        + L            ++ + YG +   Y+G +RIV+L   + + EA V     F+GR      D L   + G+  S  +  K+ R  ++ +  D GVG++   +        + +  R+  G   D    L +T   +++S++FG   +  +     +   +  L    FT T +   Y  FS+V K  P  ++ A K +  L  +I  KV+   + L  DPN      +  LI+    K+  N+E +     +  ++L+ AG +TVS+ +    LLL K+   + K+  EI+ +        YE +   P+T+A I E  R+  ++P  + RR  ++   + +L+     +     S+  D   + NP +FNP  F+ ++ G F+ +   +PF IG R C GE + R E F  +  I+  F+   + E
Sbjct:   11 AVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFVG--------NFLQLNTEQMYNSLMKISQRYGPVFTIYLGSRRIVVLCGQETVKEALVDQAEEFSGRGEQATFDWLFKGY-GIAFSSGERAKQLRRFSITTLRDFGVGKRGIEERIQEEAGFLIDSFRKTNGAFIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMM--LGSLQFTATSMGQVYEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEHNQRTL--DPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKYPDIEAKVHEEIDRVIGRNRQPKYEDRMKMPYTEAVIHEIQRFADLIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLKDPKFFSNPKDFNPKHFL-DDKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFHFKSTQE 467          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. UniProt/SwissProt
Match: sp|P20812|CP2A3_RAT (Cytochrome P450 2A3 OS=Rattus norvegicus OX=10116 GN=Cyp2a3 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 4.217e-35
Identity = 119/464 (25.65%), Postives = 210/464 (45.26%), Query Frame = 2
Query:  110 SVCFILMIIIFYVNYAPK--SNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANK-VSMLHKYIKLKVQRKLKYLTEDPN------EECLIKYYINKQMENSEIF-----ICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKF 1456
            SV F+ ++++  V    K     PPGP  +PF+G        + L            ++ + YG +   ++G +R+V+L   + + EA V     F+GR      D L   + G+  S  +  K+ R  ++ +  D GVG++   +        + E  R+  G   D    L +T   +++S++FG   +  +     +   +  L    FT T     Y  FS+V K  P  ++ A K +  L  +I  KV++  + L  DPN      +  LI+    K+  N+E +     +  ++L+ AG +TVS+ +    LLL KH   + K+  EI+ +        YE +   P+T+A I E  R+  ++P  + RR  ++   + +L+     +     S+  D   + NPN+FNP  F+ ++ G F+ +   +PF IG R C GE + R E F  +  I+  F
Sbjct:   11 SVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFIG--------NYLQLNTEKMYSSLMKISQRYGPVFTIHLGPRRVVVLCGQEAVKEALVDQAEEFSGRGEQATFDWLFKGY-GVAFSSGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIESFRKTNGALIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMM--LGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEQNQRTL--DPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKHPDIEAKVHEEIDRVIGRNRQAKYEDRMKMPYTEAVIHEIQRFADMIPMGLARRVTKDTKFREFLLPKGTEVFPMLGSVLKDPKFFSNPNDFNPKHFL-DDKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNF 460          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. UniProt/SwissProt
Match: sp|P20852|CP2A5_MOUSE (Cytochrome P450 2A5 OS=Mus musculus OX=10090 GN=Cyp2a5 PE=2 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 4.877e-35
Identity = 119/465 (25.59%), Postives = 211/465 (45.38%), Query Frame = 2
Query:  110 SVCFILMIIIFYVNYAPK--SNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANK-VSMLHKYIKLKVQRKLKYLTEDPN------EECLIKYYINKQMENSEIF-----ICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFN 1459
            +V F+ ++++  V    K     PPGP  +PF+G        + L            ++ + YG +   Y+G +RIV+L   + + EA V     F+GR      D L   + G++ S  +  K+ R  ++ +  D GVG++   +        + +  R+  G   D    L +T   +++S++FG   +  +     +   +  L    FT T +   Y  FS+V K  P  ++ A K +  L  +I  KV+   + L  DPN      +  LI+    K+  N+E +     +  ++L+ AG +TVS+ +    LLL KH   + K+  EI+ +        YE +   P+T+A I E  R+  ++P  + RR  ++   + +L+     +     S+  D   + NP +FNP  F+ ++ G F+ N   +PF IG R C GE + R E F  +  I+  F+
Sbjct:   11 AVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFIG--------NFLQLNTEQMYNSLMKISQRYGPVFTIYLGPRRIVVLCGQEAVKEALVDQAEEFSGRGEQATFDWLFKGY-GVVFSSGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDSFRKTNGAFIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMM--LGSFQFTATSMGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEHNQRTL--DPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKHPDIEAKVHEEIDRVIGRNRQPKYEDRMKMPYTEAVIHEIQRFADMIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLKDPKFFSNPKDFNPKHFL-DDKGQFKKNDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFH 461          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. UniProt/SwissProt
Match: sp|P56657|CP240_MOUSE (Cytochrome P450 2C40 OS=Mus musculus OX=10090 GN=Cyp2c40 PE=1 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 7.463e-35
Identity = 118/470 (25.11%), Postives = 207/470 (44.04%), Query Frame = 2
Query:   98 FIWLSVCF-ILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTED---PNEECLIKYY-INKQMENS---------EIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNV 1462
            F+ L +C   L+++  +   + + N PPGP  +P +G        +  L    +         K YG +   Y G Q IV+L  ++ I EA + +   F+GR RI   D +S   KG+  S   +WK  R  TV +  +LG+G++   +      + + + +++  G   D   I+      ++ S++F +  +  + +   +   +      + TE       + F+AV  L        NK+   H +IK  +  K+K   E     N    I Y+ I ++ +N           +     DL   G +T+SS +   LLLL KH H   K++ EI+N+         + +   P+T A + E  RY  + P  +      +   + Y I     ++    S+ +DST + NP  F+P  F+ ++NGNF+ + Y +PF  G R C+GE + R E F  +  I+  F +
Sbjct:    4 FVVLVLCLSFLLVLSLWRQRSARGNLPPGPTPLPIIG--------NYHLIDMKDIGQCLTNFSKTYGPVFTLYFGSQPIVVLHGYEAIKEALIDHGEEFSGRGRIPVFDKVSTG-KGIGFSHGNVWKATRVFTVNTLRNLGMGKRTIENKVQEEAQWLMKELKKTNGSPCDPQFIIGCAPCNVICSIVFQNRFDYKDKDFLSLIGKV-----NECTEILSSPGCQIFNAVPILIDYCPGSHNKLFKNHTWIKSYLLGKIKEHEESLDVTNPRDFIDYFLIQRRQKNGIEHMDYTIEHLATLVTDLVFGGTETLSSTMRFALLLLMKHTHITAKVQEEIDNVIGRHRSPCMQDRNHMPYTNAMVHEVQRYIDLGPNGVVHEVTCDTKFRNYFIPKGTQVMTSLTSVLHDSTEFPNPEVFDPGHFL-DDNGNFKKSDYFVPFSAGKRICVGESLARMELFLFLTTILQNFKL 458          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. UniProt/SwissProt
Match: sp|P11509|CP2A6_HUMAN (Cytochrome P450 2A6 OS=Homo sapiens OX=9606 GN=CYP2A6 PE=1 SV=4)

HSP 1 Score: 139.428 bits (350), Expect = 2.532e-34
Identity = 113/472 (23.94%), Postives = 212/472 (44.92%), Query Frame = 2
Query:   98 FIWLSVCFILMIII-FYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKV-SMLHKYIKLKVQRKLKYLTEDPN------EECLIKYYINKQMENSEIFI-----CCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLS 1471
             + L VC  +M+++  +     K   PPGP  +PF+G        + L            ++ + YG +   ++G +R+V+L   D + EA V     F+GR      D +   + G++ S  +  K+ R  ++ +  D GVG++   +        + + +R   G   D    L +T   +++S++FG   +  +     +   +  + Q  FT T     Y  FS+V K  P  ++ A ++   L  +I  KV+   + L  DPN      +  LI+    ++  N+E ++       ++L++ G +TVS+ +    LLL KH   + K+  EI+ +        +E +   P+ +A I E  R+  V+P ++ RR  ++   + + +     +     S+  D + + NP +FNP  F+ E+ G F+ +   +PF IG R C GE + R E F     ++  F +  S
Sbjct:    8 LVALLVCLTVMVLMSVWQQRKSKGKLPPGPTPLPFIG--------NYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGY-GVVFSNGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDALRGTGGANIDPTFFLSRTVSNVISSIVFGDRFDYKDKEFLSLLRMMLGIFQ--FTSTSTGQLYEMFSSVMKHLPGPQQQAFQLLQGLEDFIAKKVEHNQRTL--DPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFIGGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRDPSFFSNPQDFNPQHFLNEK-GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSS 465          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. UniProt/SwissProt
Match: sp|P05179|CP2C7_RAT (Cytochrome P450 2C7 OS=Rattus norvegicus OX=10116 GN=Cyp2c7 PE=1 SV=2)

HSP 1 Score: 139.043 bits (349), Expect = 3.712e-34
Identity = 115/446 (25.78%), Postives = 204/446 (45.74%), Query Frame = 2
Query:  173 PPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTD----FTETQILWKYRSFSAVKKLFP-MLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSEI---------FICCV-DLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPA-IERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNV 1462
            PPGP  +P +G        + L     N      +  K YG +   Y+G Q  V+L  ++ I EA + N   F+GR      + ++  F G++ S    WKE R  T+ +F +LG+G++   D      + + E +R+ +G   D + IL      ++ S+ F +  +      Y   E + F+ + +       +  +    SF ++   FP    K A  ++ +  Y+  K++   + L +  N    + YY+ KQ + + I           C + DL  AG +T+S+ +   LLLL K+ H   K++ EI+ +         + ++  P+T A I E  R+   VP  +      ++  + YLI     ++    S+ +DS  + NP  F+P  F+ +ENGNF+ + Y +PF  G R C+GE + R + F  +  I+  FN+
Sbjct:   30 PPGPTPLPIIG--------NFLQIDVKNISQSLTKFSKTYGPVFTLYLGSQPTVILHGYEAIKEALIDNGEKFSGRGSYPMNENVTKGF-GIVFSNGNRWKEMRRFTIMNFRNLGIGKRNIEDRVQEEAQCLVEELRKTKGSPCDPSLILNCAPCNVICSITFQNHFD------YKDKEMLTFMEKVNENLKIMSSPWMQVCNSFPSLIDYFPGTHHKIAKNINYMKSYLLKKIEEHQESL-DVTNPRDFVDYYLIKQKQANNIEQSEYSHENLTCSIMDLIGAGTETMSTTLRYALLLLMKYPHVTAKVQEEIDRVIGRHRSPCMQDRKHMPYTDAMIHEVQRFINFVPTNLPHAVTCDIKFRNYLIPKGTKVLTSLTSVLHDSKEFPNPEMFDPGHFL-DENGNFKKSDYFLPFSAGKRACVGEGLARMQLFLFLTTILQNFNL 458          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. TrEMBL
Match: A0A1I8I7N1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006662g1 PE=3 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.867e-45
Identity = 119/435 (27.36%), Postives = 204/435 (46.90%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSA-VKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQ-----------MENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTLV 1555
            YG++    +G Q  +L+S +  I  A V     F+ RP      +++   +GL+LSE  +W E+R  T++   D G+GR           + +   + +  G+E D+N  + K  + ++ SL+F       +  + +       L Q    +T++++ +    A +  L P   +Y      +  + + K+Q   +   E     C ++ Y+ +Q            +N ++    +DLYLAG +T ++ +   LL    H  +QE    EI      +  ++ + KR     QAF++E  R   +VP ++E R  E V L G  I P  L++   YS+  D  L+  P+EF P RFI  E G ++ + YLIPF +G R CLGE + R E F   V ++ KF    + +     D+IL G   G++ +P DH+LV
Sbjct:   64 YGDVISVVLGTQEFILISGYQQIKAALVGRADQFSQRPNQPLYQVMAQG-RGLLLSEGALWLEHRRFTLRVLRDFGLGRSLSEQQIQTEAQELAAKLSDLSGQETDLNVHITKAIVNVIGSLVFAQRSGYEDPKLDNFLHHTKALTQAGL-DTELMFFFPQLPAWLTALAPSTGRYLQSEKWIMDHCREKIQAIDRNYDESSEPSCFVEAYLQEQRLRQASGGVGSFDNLQLVRTVLDLYLAGSETTATTLRWALLYCSFHPEYQEACHAEIAA-SIGLREVSMKDKRGLHKVQAFLDETQRIANLVPMSVEHRVSEAVELDGLPISPDSLVLPNLYSVHMDPELFPEPHEFKPDRFIDPETGTYKASEYLIPFSLGKRACLGETLARMELFIFFVTLLQKFRFEPTEDCRLRRDEILLGPD-GVVRAPGDHSLV 494          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. TrEMBL
Match: A0A267G5D7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004420g4 PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 9.447e-44
Identity = 115/436 (26.38%), Postives = 199/436 (45.64%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQ-------------MENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTLV 1555
            YGE+    IG Q  V++S ++ I  A+V    +F+ RP      I+++  +GL+ SE  +W++ R   ++   D G+GR           + +   + +  G+E DV   + K  + ++  L+F       +  + +  E    L Q       +++  +   ++  L P   +       +  Y   K+Q   +   E     C ++ Y+ +Q              +N ++     DLY+AG DT ++ +   LL    H   QE    EI  +      ++ + KR     QAF++E  R   +VP ++E R  +EV   G  + P  +++   YS+  D  L+  P+EFNP RF+  E G ++P+ YLIPF +G R+CLGE + R E F   V ++ KF    + +     + IL G   GI+ +P DH LV
Sbjct:   64 YGEVISLVIGTQEFVVISGYNKIKAAFVDRADVFSQRPNHPFYQIVAEG-RGLLFSEGPLWQDQRRFALRVLRDFGLGRSLSEQQIQTEAQELARHLSDYNGQETDVKSHITKAVVNVIAGLVFAQRSGYEDPKLEEFLEHTKALTQAGLDTVLMVFFPQMPISLTSLSPSSNRILQSERWVMDYCWDKIQDISRNYDESSEPICFVEAYLREQRMRQASGEGDVGSFDNRQLIRTVSDLYVAGSDTTATTLRWALLYCCFHPELQEACHTEISTVIGD-REVSMKDKRSLHKVQAFLDETQRMANLVPMSVEHRAAKEVDFDGLPVSPDSIVLPNLYSVHMDQELFPEPHEFNPNRFLDLETGTYKPSEYLIPFSVGKRSCLGETLARMELFLFFVTLLQKFRFEPNEDCKLKREDILLGHD-GIVRAPADHRLV 496          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. TrEMBL
Match: W5KR37 (Uncharacterized protein OS=Astyanax mexicanus OX=7994 PE=3 SV=2)

HSP 1 Score: 165.236 bits (417), Expect = 4.325e-41
Identity = 121/415 (29.16%), Postives = 204/415 (49.16%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGR-PRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLE-KYANKVSMLHKYIKLKVQRKLKYLTED-PNE--EC-LIKYYINKQMENSE-----IFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPA-IERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSL-----SMETT 1483
            YG +   Y+G QR V+L  +D + EA + N   F GR P  F +  L     GL++S  + W++ R  T+ +  D G+GRK          + + E +RE +   FD    L +    ++ +L+FG      ++N   + + I  + +  F  +     Y  F  + +L P  +  + + +  L ++  LKVQ+  + L  D P +  +C LI+    K M N+E     +    ++L+LAG +T S+ +   L+LL KH   QE+++ EI+++         E ++  PFT A I E  RY  +VP  +    + ++  +GY I    +I+   +S+  D   WE+P  FNP  F+ + NGNF+ N   +PF  G R C+GE + R E F  IV+++  F  S      SM+T+
Sbjct:   61 YGPVMTAYLGPQRTVVLVGYDAVKEALIDNADDFVGRAPIPFVMRALKG--YGLVISNGERWRQLRRFTLTTLRDFGMGRKTMEGWIQEESKHLLEAVRETKSVPFDPTFPLSRAVSNVICALVFGQRFSYEDNNFLRLLQIIGGVLR--FGSSSWGQLYNLFPRLVELLPGKQLHFIDDIDELRRFAMLKVQKHQETLDPDNPRDFIDCFLIRLNQEKDMPNTEFHYDNMTATVMNLFLAGTETTSTTIRYALMLLIKHPEIQERMQKEIDSVIGQERSPMMEDRKSLPFTDAVIHEVQRYVDLVPLNVPHYAVRDITFRGYTIPKDTVILPMLHSVLRDKDHWESPWTFNPKHFL-DNNGNFKKNPAFMPFSAGKRACVGESLARMELFMFIVSLLQNFTFSCPGGPDSMDTS 470          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. TrEMBL
Match: A0A1I8FVM3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004420g1 PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 8.079e-41
Identity = 114/436 (26.15%), Postives = 199/436 (45.64%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQ-------------MENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTLV 1555
            YGE+    IG Q  V++S ++ I  A+V    +F+ RP      I+++  +GL+ SE  +W++ R   ++   D G+GR           + +   + +  G+E DV   + K  + ++  L+F       +  + +  E    L Q       +++  +   ++  L P   +       +  Y   K+Q   +   +     C ++ Y+ +Q              +N ++     DLY+AG DT ++ +   LL    H   QE   IEI  +      ++ + KR     QAF++E  R   +VP ++E R  +EV   G  + P  +++   YS+  D  L+  P+EFN  RF+  E G ++P+ YLIPF +G R+CLGE + R E F   V ++ KF    + +     + IL G   GI+ +P DH LV
Sbjct:   64 YGEVISLVIGTQEFVVISGYNKIKAAFVDRADMFSQRPNHPFYQIVAEG-RGLLFSEGPLWQDQRRFALRVLRDFGLGRSLSEQQIQTEAQELARHLSDYNGQETDVKSHITKAVVNVIAGLVFAERSGYEDPKLEEFLEHTKALTQAGLDTVLMVFFPQLPISLTSLSPSSNRILQSERWVMDYCWDKIQDISRNYDKSSEPICFVEAYLREQRMRQASGEGDVGSFDNRQLIRTVSDLYVAGSDTTATTLRWALLYCCFHPELQEACHIEISTVIGD-REVSMKDKRSLHKVQAFLDETQRMANLVPMSVEHRAAKEVDFDGLPVSPDSIVLPNLYSVHMDPELFPEPHEFNINRFLDLETGTYKPSEYLIPFSVGKRSCLGETLARMELFLFFVPLLQKFRFEPNEDCKLKREDILLGHD-GIVRAPADHRLV 496          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. TrEMBL
Match: A0A3Q2TRL4 (Cytochrome P450, family 2, subfamily Y, polypeptide 3 OS=Fundulus heteroclitus OX=8078 PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.021e-40
Identity = 134/473 (28.33%), Postives = 225/473 (47.57%), Query Frame = 2
Query:   86 MLFYFIWLSVCFILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFS-AVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNE-----EC-LIKYYINKQMENSE-----IFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVS 1465
            M FY   L    I ++  F V    K   PPGP   P +G +P I   +         KL        YG +   Y+  QR+V+L  +D + EA V     F GR  +  L  +++ F GL +S  + W++ R  ++ +  D G+GRK   +        +   I + +G+ FD + +L +T   I+  L+FG      +    ++   I  + +  F  + +   Y  F  A+++L         +V  +  ++K+K+Q   + L  DPN      +C LI+ +  K   ++E     +F   ++L+LAG +T SS +   L +L KHQ+ QEK++ EI+ +         E ++  PF+ A I E  R+  +VP +I    +E++  +GY I    +II   +S+  D   W  P+ FNP  F+ ++NGNF+ N   +PF  G R C+GE + R E F  +VA++  F  S
Sbjct:   31 MEFYTTLLLAALIGLVWFFSVKSHQKYRLPPGPNPFPLIGNLPQIDKNAPFKSFLEFSKL--------YGPVMTLYLSWQRVVVLVGYDAVKEALVDQADDFTGRAPVPFLYKVTNGF-GLGISNGERWRQLRRFSLTTLRDFGMGRKGMEEWIQEESRHLRASIHKFKGEPFDPSILLSRTVSNIICCLVFGQRFSYEDKQFVNLLSLISKMIR--FNSSPMGMMYNIFPWAMERLPGQHHTVFARVDEIKNFVKIKIQEHKETL--DPNSPRDYIDCFLIRAHQEKDNPSTEFHYDNLFATVMNLFLAGTETTSSTIRYALNVLIKHQNIQEKMQEEIDTVIGRERCPRMEERKSLPFSDAVIHEVQRFLDLVPFSIPHYALEDISFRGYTIPKGAVIIPLLHSVLKDEKQWSAPSSFNPQHFL-DQNGNFKKNPAFLPFSAGKRACVGESLARMELFIFLVALLQDFTFS 489          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Cavefish
Match: ENSAMXT00000010049.2 (cytochrome P450 2G1-like [Source:NCBI gene;Acc:103025252])

HSP 1 Score: 165.236 bits (417), Expect = 1.638e-44
Identity = 121/415 (29.16%), Postives = 204/415 (49.16%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGR-PRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLE-KYANKVSMLHKYIKLKVQRKLKYLTED-PNE--EC-LIKYYINKQMENSE-----IFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPA-IERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSL-----SMETT 1483
            YG +   Y+G QR V+L  +D + EA + N   F GR P  F +  L     GL++S  + W++ R  T+ +  D G+GRK          + + E +RE +   FD    L +    ++ +L+FG      ++N   + + I  + +  F  +     Y  F  + +L P  +  + + +  L ++  LKVQ+  + L  D P +  +C LI+    K M N+E     +    ++L+LAG +T S+ +   L+LL KH   QE+++ EI+++         E ++  PFT A I E  RY  +VP  +    + ++  +GY I    +I+   +S+  D   WE+P  FNP  F+ + NGNF+ N   +PF  G R C+GE + R E F  IV+++  F  S      SM+T+
Sbjct:   61 YGPVMTAYLGPQRTVVLVGYDAVKEALIDNADDFVGRAPIPFVMRALKG--YGLVISNGERWRQLRRFTLTTLRDFGMGRKTMEGWIQEESKHLLEAVRETKSVPFDPTFPLSRAVSNVICALVFGQRFSYEDNNFLRLLQIIGGVLR--FGSSSWGQLYNLFPRLVELLPGKQLHFIDDIDELRRFAMLKVQKHQETLDPDNPRDFIDCFLIRLNQEKDMPNTEFHYDNMTATVMNLFLAGTETTSTTIRYALMLLIKHPEIQERMQKEIDSVIGQERSPMMEDRKSLPFTDAVIHEVQRYVDLVPLNVPHYAVRDITFRGYTIPKDTVILPMLHSVLRDKDHWESPWTFNPKHFL-DNNGNFKKNPAFMPFSAGKRACVGESLARMELFMFIVSLLQNFTFSCPGGPDSMDTS 470          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Cavefish
Match: ENSAMXT00000057410.1 (cytochrome P450 2C15-like [Source:NCBI gene;Acc:103027356])

HSP 1 Score: 149.058 bits (375), Expect = 1.073e-38
Identity = 109/404 (26.98%), Postives = 195/404 (48.27%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFP-MLEKYANKVSMLHKYIKLKVQRKLKYLTED-PNE--ECLIKYYINKQMENSE-------IFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVS 1465
            YG +   Y+G QR V+L  +D + EA V     F GR +I  L  +   + GL++   + W++ R  T+ +  D G+GRK   +     I+ +   +RE +   FD   I+ +    ++ +L+FG      ++N+  + + I  L +  F  +     Y  F  + +  P   +    +V  +  +   K++   + L  D P +  +C +   +N++ +N E       +    ++L+LAG +T S+ +   L++L K+ H Q++++ EIE +         + ++  PFT A I E  RY  +VP  +      +   +GY I    +II   +S+  D  +WE+P  FNP  F+ + NGNF+ N   +PF  G R C+GE + R E F  IV+++  F  S
Sbjct:   63 YGPVMTVYLGPQRAVVLVGYDTVKEALVDQPDDFAGRAQIAFLHRVVRGY-GLVIGNGERWRQLRRFTLTTLRDFGMGRKRIENWIQEEIKHLHNSLRETKSAPFDPTFIVSRAVSNVICALVFGQRFRYEDNNLLRLLQIINKLVR--FGSSPWGQAYNIFPWLMEQLPGRHQSLLREVDEMMDFFMEKIKEHEESLDLDNPRDFIDCFL-IRMNQEKDNPETEFHYNNMLSVVLNLFLAGTETTSTTIRYALMILIKYTHIQDQMQKEIETVIGGDRCPLMQDRKSLPFTDAVIHEVQRYLDLVPFNLPHCATHDFSFRGYAIPNGTIIIPLLHSVLKDEGMWESPWTFNPNNFL-DTNGNFKTNPAFMPFSAGKRACVGESLARMELFMFIVSLLQHFTFS 461          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Cavefish
Match: ENSAMXT00000046195.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:534198:541641:1 gene:ENSAMXG00000034559.1 transcript:ENSAMXT00000046195.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.132 bits (370), Expect = 6.589e-38
Identity = 118/472 (25.00%), Postives = 215/472 (45.55%), Query Frame = 2
Query:   86 MLFYFIWLSVC--FILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKL-FPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINK--------QMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVS 1465
            +L+  IW   C  F+L+   FY N  PK N PPGP ++   G        ++L     N      +L + YG++   YIG +  V+L     + EA V     F GRP+   L+ ++++   +M +   +WKE+R   + S  + G+GR+   +  +   + +C+ ++   G   D   ++      I++S++FG   E      YD  E + F+  T  T       Y SF  ++ L  P  + + N  ++     ++    K    + +P +  +I  Y+++         ++   + +  +DL+ AG DT S+ V   LL L  ++  Q   + EI+ +      +++E ++  PF QA I E  R   + P  +         L GY +    L+I    S+ ++ + W  PN FNP  F+ +     +P ++L  F  G R CLGE + R E F  +V ++ +F+++
Sbjct:    3 ILYKLIWFCCCLDFLLLFCCFYSNPRPK-NFPPGPAALALFG--------NVLQLSMKNPLEDLDRLARRYGDVFSLYIGRKPAVVLYGLRAVKEALVVRGVDFAGRPQGLMLNHVTENKGLIMANYGSVWKEHRRFALMSLKNFGLGRQFMEERILQETKHICQHLQNRSGNLVDPQPVIHSAASNIISSILFGTRYE------YDD-EVLAFIINTINTIN----IYDSFPFLRHLPLPFRKVFENYEALKSHTRRIIADHKKSRTSGEPRD--IIDCYLDEMEKADEDTSLDEDRLVMFLLDLHFAGTDTTSNTVLTALLYLAVYRDIQALCQQEIDAVLQDKEQVSFEDRQQMPFVQATIHELQRLANIAPLGVFHSTTRNTQLMGYDVPEGTLVITNLTSVLFERSQWAQPNHFNPSHFLNQRGEFMKPEAFLA-FSAGPRVCLGEALARMELFLILVTLLRRFHLA 451          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Cavefish
Match: ENSAMXT00000035094.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:531210:545696:1 gene:ENSAMXG00000034559.1 transcript:ENSAMXT00000035094.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 1.541e-37
Identity = 116/473 (24.52%), Postives = 215/473 (45.45%), Query Frame = 2
Query:  101 IWLSVC---FILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQT---DFTETQILWK--YRSFSAVKKL-FPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINK--------QMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVS 1465
            +WL  C   F+L+   FY N  PK N PPGP ++   G        ++L     N      +L + YG++   YIG +  V+L     + EA V     F GRP+   L+ ++++   +M +   +WKE+R   + S  + G+GR+   +  +   + +C+ ++   G   D   ++      I++S++FG   E      YD  E + F+  +   +  +    W   Y SF  ++ L  P  + + N  ++     ++    K    + +P +  +I  Y+++         ++   + +  +DL+ AG DT S+ V   LL L  ++  Q   + EI+ +      +++E ++  PF QA I E  R   + P  +         L GY +    L+I    S+ ++ + W  PN FNP  F+ +     +P ++L  F  G R CLGE + R E F  +V ++ +F+++
Sbjct:    8 LWLFCCCLDFLLLFCCFYSNPRPK-NFPPGPAALALFG--------NVLQLSMKNPLEDLDRLARRYGDVFSLYIGRKPAVVLYGLRAVKEALVVRGVDFAGRPQGLMLNHVTENKGLIMANYGSVWKEHRRFALMSLKNFGLGRQFMEERILQETKHICQHLQNRSGNLVDPQPVIHSAASNIISSILFGTRYE------YD-DEVLAFIINSFKENARKANSAWAVIYDSFPFLRHLPLPFRKVFENYEALKSHTRRIIADHKKSRTSGEPRD--IIDCYLDEMEKADEDTSLDEDRLVMFLLDLHFAGTDTTSNTVLTALLYLAVYRDIQALCQQEIDAVLQDKEQVSFEDRQQMPFVQATIHELQRLANIAPLGVFHSTTRNTQLMGYDVPEGTLVITNLTSVLFERSQWAQPNHFNPSHFLNQRGEFMKPEAFL-AFSAGPRVCLGEALARMELFLILVTLLRRFHLA 461          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Cavefish
Match: ENSAMXT00000045090.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:533213:545887:1 gene:ENSAMXG00000034559.1 transcript:ENSAMXT00000045090.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 7.012e-37
Identity = 115/462 (24.89%), Postives = 214/462 (46.32%), Query Frame = 2
Query:  119 FILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSE-KKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQT---DFTETQILWK--YRSFSAVKKL-FPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINK-----QMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVS 1465
            F+L+   FY N  PK N PPGP ++   G        ++L     N      +L + YG++   YIG +  V+L     + EA V     F GRP+   L+ ++++ KGL+++    +WKE+R   + S  + G+GR+   +  +   + +C+ ++   G   D   ++      I++S++FG   E      YD  E + F+  +   +  +    W   Y SF  ++ L  P  + + N  ++     ++    K    + +P +  +I  Y+++      ++   + +  +DL+ AG DT S+ V   LL L  ++  Q   + EI+ +      +++E ++  PF QA I E  R   + P  +         L GY +    L+I    S+ ++ + W  PN FNP  F+ +     +P ++L  F  G R CLGE + R E F  +V ++ +F+++
Sbjct:   22 FLLLFCCFYSNPRPK-NFPPGPAALALFG--------NVLQLSMKNPLEDLDRLARRYGDVFSLYIGRKPAVVLYGLRAVKEALVVRGVDFAGRPQGLMLNHVTEN-KGLIMANYGSVWKEHRRFALMSLKNFGLGRQFMEERILQETKHICQHLQNRSGNLVDPQPVIHSAASNIISSILFGTRYE------YD-DEVLAFIINSFKENARKANSAWAVIYDSFPFLRHLPLPFRKVFENYEALKSHTRRIIADHKKSRTSGEPRD--IIDCYLDEMEKDTSLDEDRLVMFLLDLHFAGTDTTSNTVLTALLYLAVYRDIQALCQQEIDAVLQDKEQVSFEDRQQMPFVQATIHELQRLANIAPLGVFHSTTRNTQLMGYDVPEGTLVITNLTSVLFERSQWAQPNHFNPSHFLNQRGEFMKPEAFLA-FSAGPRVCLGEALARMELFLILVTLLRRFHLA 463          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001876.1 (pep scaffold:Pmarinus_7.0:GL477372:10316:22460:-1 gene:ENSPMAG00000001674.1 transcript:ENSPMAT00000001876.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.627 bits (296), Expect = 8.680e-29
Identity = 111/475 (23.37%), Postives = 212/475 (44.63%), Query Frame = 2
Query:   83 KMLFYFIWLSVCFILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPE---ETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSM-LHKYIKLKVQ-RKLKYLTEDPNEECLIKYYINKQMENS----------EIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFN 1459
            KM  + +   V  + + + F+     +   PPGP  +P +G        ++             +L + YG I    +G  R+V+L   +II EA V    +F  RP I        +++GL+LS    W+  R  T+    + G+G K   +      E +   I   Q K FD +  + K+   ++ S+ FG   +   +T   + DI      L+  D+++      + SF  V K FP   +  NK  + L+ +I+ +++   +  +  +P +   +  +I+K++E+S           +     +L++AG +T S+ +   +LL+  +   QE+++ EI+ +  +        +   P+T A + E  RY  ++P A       +  L+GY +     +IA  +S   + +LWE P +FNP  F+  +   +  N ++    +G R CLG+ + R E F    A++ +F+
Sbjct:   11 KMPTWVLLRVVAVLFLWLGFWWLRREQRGFPPGPRGLPLVG--------NLFQLDLKALPASLDKLSETYGPIYSVSLGQTRVVVLVGNEIIKEALVTQAEMFIDRPEIPVFKKSLGNYEGLLLSHGWQWRARRRFTLMMLRNFGMGTKSIEEKIAEEAEFLVRAIENKQEKPFDAHSEINKSAANVICSITFGDRYDWNNKTFVKLMDIITENVELSGNDWSQI-----FNSFP-VLKYFPGPHQRINKNKVVLNAFIQARIEEHDMARIQGEPRD--YLDAFIDKRIEDSMNPDTAFSDIALINTTANLFVAGSETTSATLKWGILLMLTYPKVQEQVQEEIDRVVGSNRRPACADRACMPYTNATVHEIQRYANILPMAFPHATTCDTKLRGYFLPKGTQVIALIHSALREKSLWEAPEQFNPGHFLDIDGNFYNRNDFMAFSAVGPRICLGKNLARMEVFLFFTALLQRFS 469          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Sea Lamprey
Match: cyp17a1 (cytochrome P450, family 17, subfamily A, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-040213-2])

HSP 1 Score: 114.775 bits (286), Expect = 2.032e-27
Identity = 92/403 (22.83%), Postives = 177/403 (43.92%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSE-KKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSA-----VKKLFP------MLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSE----------IFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXX-XXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETF 1426
            YG +    +G + IV+L++ + I E  +K    F GRP+ +    ++   K + L +   +W+  R   + + H +G  R E  ++     + + E + +  G+  D++  +      ++ S+ FG + ++ ++   DI+  +  L +        LW   +  A     V +LFP      ++     +  ++ + I L   +     + D  +  L     ++  E SE          + +  +D ++AGV+T ++ +   L  L  H   Q++I +   + L+  + P   +  +   +  A I+E  R   V P AI  R + +  + G+ I     +IA  ++   D   W+NP+ F P RF+ E      P S L+PFG G R CLGE + + E F
Sbjct:   75 YGAVYCLRVGGEDIVVLNNVESIKEMLIKKSADFAGRPQTYAGGKITGGGKDIALGDYSAVWRRQRRAALSALHCVGTARTE--EIVQGEAQRLVEDLTQYIGRPTDIHTDISMRVCNVICSVAFGTKYDKHDTEFLDIHCCLDSLVR--------LWGSPAIRALDCFPVLRLFPNPAWRDLMAAVRKRDEVVWRQILLHKAKPSSSPSSDMTDFLLKFTRHSRNEEESEARGGILTEERVHLSIMDTFIAGVETTATLIEWALAYLVLHPEVQDQIYEEMEQKLQPGLGPSLADRDKLL-YLDATIKEILRLCPVAPLAIPHRALRDSSVGGFFICKGSTVIANLWAAHRDHAHWDNPSVFQPGRFLGESLERRNPASLLLPFGAGKRVCLGESLAKAEIF 466          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011205.1 (pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1 gene:ENSPMAG00000010178.1 transcript:ENSPMAT00000011205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.235 bits (282), Expect = 5.260e-27
Identity = 99/444 (22.30%), Postives = 179/444 (40.32%), Query Frame = 2
Query:  173 PPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQ--RKL---KYLTEDP-NEECLIKYYI---------NKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKF 1456
            PPGP  +PFLG           +       +   ++ K YGE+    +G   +V +S +  + E  V     F  RP       ++     +     K W ++R  T+ +  + G+G+        A +  + E  ++ +G  FD +  L      I+ S++ G   E ++    D    +         E  +  +      +  +FP L  +     ++ K +    Q  R +   ++ T DP    CLI  Y+         N       + +  +DL++AG +T S+ +   LL +  H   Q +   EI+ +  +      E +   P+  A I E  R+  +VP         +V  + YLI    +I+    S+  D   W+ P EF+P  F+ E+    +P+++L PF  G R CLGE + + E F    +++  F
Sbjct:   54 PPGPKVIPFLG----------NVSLFKKPDVALDEVTKQYGEVCSVMVGKISMVFVSGYQAVKEVLVHQGHEFADRPNTPFNKKVNGGLGIIFAPYGKYWMQHRRFTLSTLRNFGLGKSSIEQTIQAEVGFLIEAFKQ-KGSAFDPHYDLNSAVGNIICSMVKGKRYEYSDKQFQDFLHLV---------ENNLQLQSGLLGTLCNIFPFLMDFPGPQQIIFKSMAKSKQFIRDIISERHATRDPIKPMCLIDAYLSQLEKEDNPNSSFSEQSLIMLALDLFIAGAETTSTTLRWGLLYMMMHPEIQAQCHEEIDKIVGSDRLPCMEDRHSLPYLDAVIHEIQRFSNIVPFGAPHATTADVKFRQYLIPKGTIIMVNMKSVLSDENHWKTPYEFSPENFLDEDGKFVKPDAFL-PFSAGPRVCLGENLAKMELFLFFASLLQHF 476          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011254.1 (pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 gene:ENSPMAG00000010227.1 transcript:ENSPMAT00000011254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.0485 bits (227), Expect = 4.780e-20
Identity = 87/406 (21.43%), Postives = 162/406 (39.90%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYA---NKVSMLHKYIKL---KVQRKLKYLTEDPNEECLIKYYI----------NKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKF 1456
            YGE+    +G   +VL+S ++ + E  V     F  RP       L+ +    +      WK+ R   + +  + G G+    D      + + E  ++ +   FD +  L      I+  L+          N YD Y+   F   T   E  +  +      +  +FP L K      KV  +H  ++     +  + +   +  N   LI  Y+          N    +  +    ++L++ G++T S+ +   LL +  +   Q +   EI+ +  +  P     +R  P+  A I E  R+  V+P  +     ++V    YL      ++    S  +D   W+ PN+FNP  F+ ++    Q +++L PF  G R CLGE + + E F    +++  F
Sbjct:   70 YGEVCTIMLGSTPVVLVSGYEAVKEVLVNRGHEFADRPITPIFTKLTQNIGIALAPYGDPWKQQRRFALSTLRNFGFGKATIADKISIEAKYLIETFKQ-ETSAFDPHLNLNNALGNIICCLL--------NRNRYD-YDNEQFQKLTHLLEYLVQLQAEPLVILCNVFPFLLKLPGPWQKVFHIHSKLQCLLNDIVSEHRATKDQHNPRDLIDSYLAQIDKEKDNPNSSFTHQSLIQILIELFIGGLETTSNTLRWGLLFMMMNPDIQARCHGEIDRVVGSERPPCMTDRRSLPYLDAVIHEIQRFGNVLPLGVLHATSKDVQFNDYLFPKGTHVMVNLMSALHDDIHWKTPNKFNPDHFLDKDGQCIQSDAFL-PFSAGPRVCLGESLAKMEIFLFFTSLLQHF 464          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Sea Lamprey
Match: cyp2u1 (cytochrome P450, family 2, subfamily U, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-070730-1])

HSP 1 Score: 87.8113 bits (216), Expect = 2.103e-19
Identity = 59/213 (27.70%), Postives = 107/213 (50.23%), Query Frame = 2
Query:  932 MENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVI--LKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTEN---YDKILEGTSGGILHSPLDHTL 1552
            ++  ++F    DL++AG DT ++ +  CLLL+  +   Q +++ E++ +      ++   +   P T A I E  R  +VVP AI       V   L+G+ I    +++   ++   D  +W  P  F+P RF+ + +G  +     +PFGIG R+CLGE + R E F    A++ +F  + S   + +      +L+GT  G+ ++P   TL
Sbjct:   95 LDADDLFYIVADLFIAGTDTTANTLLWCLLLMCTYPAVQARVQAELDAVVGRGRRVSLSDRPRLPLTVATIMEVQRLSSVVPLAIPHSATRSVRTELRGFTIPRGSVVLLNLWACHVDPRVWARPLLFDPERFL-DPHGRLRRRDAFMPFGIGRRSCLGESLARVELFLFFSALMQEFTFTSSAPHSPDSAPRSPVLQGTF-GLTYAPPPFTL 305          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Nematostella
Match: EDO46506 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ60])

HSP 1 Score: 124.79 bits (312), Expect = 1.338e-30
Identity = 108/428 (25.23%), Postives = 184/428 (42.99%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKG---------LMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICF----LAQTDFTETQILWKYRSFSAVKKLFPML--------EKYANKVSMLH-KYIKLKVQRKLKY-LTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSY--LIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYD 1495
            YG I    +G Q  V+L+S+DI  EA +K    F GRP  F     S D KG         L   +K I K     TVK F  L  G +   ++    ++ +C+ +     + FD    +      ++  + FG   +      + + E++      L  T F +     KY  FS VK++   +        +K+ + +  L    I     R L Y L ++ N+        +  +    + +   D+ +AG +T +  +   L  L K+   Q + + +++++   V P+ +E ++  P+ +AFI E  R   V+P AI+   M +  L GY I     +I   +++ +D  +W+ P EF P RF+ +  G F   S     P+G+G R+C GE + R E F   V ++  F    S    E  D
Sbjct:   60 YGPIYTLNMGSQLAVVLNSYDIAKEALMKRGNAFAGRPHHFVGSKFSRDGKGVGFQNYTPTLRRQQKTIMK-----TVKFFDTLKTG-ESLQEIITKEVDYLCKRLLIFGDQSFDPRHEVTFAAGNVVGRITFGERYKGGNKEFWQLMESLTIFVEGLTATSFIDAFPFLKYVPFSMVKRVEKAVKLRDDVLNDKFRDHLKNLQNSTISTTTNRDLTYALIDEANKTNCFANSQSDALTIDHVIMTMNDMIMAGSETPTMTLLWILYFLVKYPDVQVRAQEQVDDVSRNVQPLAWEGRKRLPYLEAFIAEVLRITGVMPLAIQHLAMADTALAGYHIPKGTTVIVNLWAMGHDPKVWDAPMEFRPERFL-DSRGGFSTASTEGFTPYGMGLRSCPGEQLARMELFLFTVRLLRMFEFRASEALPEMLD 480          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Nematostella
Match: EDO48774 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI92])

HSP 1 Score: 112.464 bits (280), Expect = 1.268e-26
Identity = 108/441 (24.49%), Postives = 191/441 (43.31%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKG---------LMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICF----LAQTDFTETQILWKYRSFSAVKKL---FPMLEKYANKVSMLHK------YIKLKVQRKLKY-LTEDPNEECLIKYYINKQ-----MENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSY--LIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSG 1519
            YG I    +G Q  V+L+S++I  EA +K    F GRP  F     S   KG         L   +K I K     TVK F  L  G +   ++    ++ +C+       ++FD  R +      ++  + FG          + + +++      L  T F +   L +Y  FS VK++     + +   NK    H+       + L   + L Y L E+ N++       + Q     + +  + +   D  +AG +T +  +   +    K+   Q +   +I+ + +   PIT+E ++  P+ +AFI E  R  +++P A+    M +++L GY I     +I   +++ +D  +W+ P EF P RF+ +  G F   S     P+G+G R+C GE + R E F   V ++  F    S    E   ++L+G  G
Sbjct:   30 YGPIYTLNMGSQLAVVLNSYEIAKEALMKRGNAFAGRPHHFVGSKFSRGGKGVGFQNYTPTLRRQQKTIMK-----TVKYFETLKTG-ENLQEIITNEVDYLCDLFVSHGCQDFDPRRDMTFAAGNVVGRITFGERFTVENEEFWQLMDSLKIFVEGLTATSFIDAFPLLRYFPFSLVKRVQTAVKLRDDVLNKRFREHQDRLRGDGMVLAKSKDLTYALIEEANQKT---SRTDSQSDTLILTDDHVMMTMNDTIMAGSETPTMLLLWNIYFFVKYPDVQARAFKQIDKVISPDQPITWEDRKRLPYLEAFIAEVMRIISIMPLAVPHLAMVDMVLAGYHISKGTTVIVNLWAMGHDPKVWDAPMEFRPERFL-DSRGGFSTASSEGFTPYGMGLRSCPGEQLARMELFLFTVRLLRMFEFRAS----EALPEMLDGEFG 456          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Nematostella
Match: EDO39192 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAR4])

HSP 1 Score: 110.538 bits (275), Expect = 6.324e-26
Identity = 115/479 (24.01%), Postives = 195/479 (40.71%), Query Frame = 2
Query:  107 LSVCFILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLG------VGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETES-------------------------------NIYDIYETICFLAQTDFTETQILW-KYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPN--SYLIPFGIGGRTCLGEIIGRNE 1420
            L++  IL I  F+  Y   +N PPGP + P +G          + +           L   YGE+ + Y+G   +V+L+    I EA       F GRP     D+        +  E+ +  E+    VK    +G        +K++  + +   E +C+ I +   + FDV +      + I+ + IFG   +                                   NI  IY     L +T     +ILW KY+           L+ +   VS +  Y    +  K +   E+  ++        K +EN  I      +++AG +T ++ +   +L L      Q++I   +  L         E ++  P  +AFI E  R   ++P  +  + + E IL+GY I     ++A  +S+ ++ +LWENP +FNP RF+ +E GNF  +    L+PFG G R C+GE + R E
Sbjct:    7 LALFLILTIYHFFFEYK-HNNLPPGPHAWPLIG---------NIPQIGKQLHRSLHSLSLIYGEVYRLYLGHTLVVVLTG-RAIKEALALQPVEFGGRPWTVSFDLA-------LRGERPLVFEDYGRHVKLHRKMGHRALKVYSQKKYQQVIIQEAEELCKRIADSSDRIFDVKKEFGLCIMNIICTKIFGSRYQVNNKEFLEILNIHDNLFRLTTVTGQSLVDIFPFLRNILPIYGHTKELQETHDEWQKILWRKYKQH---------LDSF--DVSNIRDYTDALLLAKQEAGVENTTDQ--------KYLENKYIVSAISTVFIAGSETTATSLCWAILYLIHFPKIQDQIYASVGKLNLQERQSFVEMRKMCPILEAFIAEVLRIITLLPLGVPHKTLCETILRGYTIPKGTTVLANLWSLHHNVSLWENPEDFNPERFLDKE-GNFSHSMTDNLLPFGAGPRICMGENLARTE 447          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Nematostella
Match: EDO48191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK60])

HSP 1 Score: 105.916 bits (263), Expect = 1.957e-24
Identity = 103/439 (23.46%), Postives = 187/439 (42.60%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSE-KKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKY-------------YINKQ---------MENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPAI-ERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPN--SYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGIL 1528
            YGE+ +  +G  RIV+++S +   EA V+    F GRP ++   ++S +   +   +   +WK+ R     +    G G K   +      + + + +   +G+  +    +    L I+ S +FG          YD+ +   F    D+TE Q +  +R+ S V   FP L    NK     + IK   Q +   + +   +E L+ Y               NK          M    I +   D++ AG++T ++ +   L+ L ++   QE++  +I+ +           +   P  +A I E  R  ++VP +       +  L+GY +    +++   +++ +D   W NP+EF+P RF+ ++     P   SYL PF  G R CL E +G+ + F  I  ++ KF  S+       +   LEG  G  L
Sbjct:   19 YGEVFRLKVGSHRIVVVNSIEAAREALVRRANDFAGRPMLYTASLISRNGTDIAFGDFGPLWKQQRKIAHSALRMFGSGLKPLEEKITVEADELIKRLSLVEGRAHNPKDDVNLAVLNIICSFVFGSR--------YDM-DDPEFHTVVDYTE-QFVQGFRAASLVD-YFPWLRHLPNKGL---RQIKEACQNR-DVVLQKKYQEHLVTYEHGVIRDLTDALLSANKASQEESAYLPMTEDHIIMTMNDIFSAGLETTATSILWSLVYLIRNPKVQEQLHQQIDEVVGRDRAPELSDRENLPLIEATIAEVLRSSSLVPLLFPHSTTTDTHLRGYEVPKDTIVLFNVWNMHHDPQRWSNPDEFDPTRFLDDKGKFICPATLSYL-PFSAGRRVCLAESLGKMQLFLFISRLLHKFRFSVP---PNGHPPSLEGVFGASL 438          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Nematostella
Match: EDO40930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T4])

HSP 1 Score: 105.145 bits (261), Expect = 4.995e-24
Identity = 111/451 (24.61%), Postives = 192/451 (42.57%), Query Frame = 2
Query:  140 FYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEK----KIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFG-----HEPE--ETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLH------KYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNL----ENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETF 1426
             +  Y   SN PPGP   P +G  P +I     L  KL +          YG +   Y+  QR V++ S     E  V+ K    GRP  F LD +++  K +  S+      + K    ++++ ++       +  D     +E +   I+   G  FD + +L    L ++ S+ FG      +PE       I D   +I  ++  D     +    R+   +K +   + +Y  K    H      K I+      +K LTE   E+  + + +N       I +   D+ + G +T S+ +   +  L  +   Q ++  +++++    +NTV  IT + +   P+ +A I E  R    VP AI  +   +  + GY I     +I   + +  D T W +P+ FNP RF+ +E+G F  +  L+PFG G R C GE I + + F
Sbjct:   18 LFHRYTEPSNLPPGPRPYPLIGNTPLLIGSFSSLHVKLTELAKI------YGSVYTLYLNGQRSVIVCSAKAAREGLVERKDAIAGRPYSFTLDYVTNGSKNITFSDFCPTFLLKKRIAQSSMRRYY------PQVEDKVNNQLEEVLARIKALDGTAFDPHHLLSLVTLNLVTSMTFGTNYTLDDPEFLLLVQMIDDSTRSIGSMSTLDMFPFLMHLPIRTSKLLKSITKTVNEYFMKQVQRHIDSNDGKSIRDLTDGYIKGLTEAEKEDASV-HEVNSI---EHIAMVMADMIVPGSETSSTTMGWMIAYLAVYPEVQARLHQQLDDVIGRDKNTV--ITLKDRDRLPYVEAVIAETMRISTAVPLAIPHKATCDTTINGYFIPKDTTVIFNLWGVHLDPTEWADPHVFNPARFL-DEDGKFIKSEKLLPFGAGRRVCPGEKIAKMQLF 449          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Medaka
Match: ENSORLT00000018818.2 (cytochrome P450 2J2 [Source:NCBI gene;Acc:101157767])

HSP 1 Score: 138.658 bits (348), Expect = 5.962e-35
Identity = 121/481 (25.16%), Postives = 213/481 (44.28%), Query Frame = 2
Query:  146 VNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSD--DFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPM-LEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSEIF--------ICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTL 1552
             N  PK N PPGP S+PF+G         +   +     L F++    YG +    I   + V+L+   ++ EA ++    F  RP+I    + SD  + KG++++    WK  R   + +  + G+G+K            + +   E QGK FD   +L      I+  L+FG   E ++     I + +  + +   + + +   Y  F  + K FP  L+K    V  +  ++K+K++   + L     ++ +  + I  +    E F         C +DL+ AG +T ++ +   LL +  +   QE++  EI+ +  +    +   K   P+T A I E  R   +VP  + R    + +L  Y I    +I+   +++ +D ++WE P+ FNP  F+  ++G F+      PFG G R CLGE + R E F    + + +F+ S    T       LEG  G I  SP  + L
Sbjct:   33 TNRKPK-NFPPGPRSLPFIG--------DLHRIRPTILHLQFKEFAAKYGNVFSLNIFGGKTVVLNGTKLLKEALIQKGDDFVDRPQI---PLFSDLIENKGIVMTNGIQWKHQRRFALHTLRNFGLGKKTMEKYIQEECHYITQAFAEHQGKPFDAQPLLNSAVSNIICCLVFGERFEYSDKEYQQILQDLTEVVKLQGSFSAL--AYNVFPWLMKRFPGPLQKLFTLVDKIMDFVKIKIEEHKENLDPACPKDYIDSFLIEMEKNQGEDFGFDIKNLCACTLDLFGAGSETTTTTLYWGLLFMIHYPDIQEEVHAEIDAVIGSSRQPSMADKENMPYTDAVIHEIQRMGDIVPIGVARMASRDTMLDNYTIPKGTMIMPALHTVLHDESVWETPHSFNPQHFLN-QDGTFKKREAFFPFGAGKRVCLGEQLARMELFLFFTSFLQRFSFS----TAGGEKPPLEGRMGTI-RSPKSYRL 493          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Medaka
Match: ENSORLT00000024770.2 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101169416])

HSP 1 Score: 132.88 bits (333), Expect = 5.543e-33
Identity = 112/465 (24.09%), Postives = 218/465 (46.88%), Query Frame = 2
Query:   95 YFIWLSVCFILMIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKL-FPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYIN------KQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVS 1465
            + +WL  CF  ++  F + + PK N PPGP+S+P LG        ++L     N  + F+++K+ YG +  F+IG +  V+++    + EA +     F+GRP+   +  L+     +++    +W+++R   + +  + G+G+    +     I+     + E  GK      +       I+  ++F    +  +  I +I +    + Q       ++  Y +F  ++    P  + + N  + L+   +L  + K+  +  +P +   +  Y++      K     ++     DLY+AG DT S+ + A  L L  + H QEK + EI+ +    + +++E +   P+ QA I E  R+  +VP ++     ++  L GY I    LII    S+  +   W+ P+EFNP  F+ ++    +P +++ PF  G R CLGE + R E F  +V ++ KF  +
Sbjct:    6 FLLWL--CFFFILFQFKL-WRPK-NFPPGPLSLPVLG--------NLLHLNLKNPLVDFEKMKESYGNVYSFFIGSRPAVVVNGLQAMKEAIMIKATDFSGRPQDMFVSDLTQRKGVILVDYGSVWRDHRRFALMTLRNFGLGKISMEERIHEEIQFTISKLEENIGKTLSPKFMFHNAASNIICKVLFNTRYDYEDGKISEIVQGFVEMLQIANGPWAMM--YDAFPWIRSFPLPFNKAFRNMENFLNLAKRLVNEHKMSRVAGEPRD--FVDSYLDELEKNKKDFSEQQLLRMTFDLYIAGTDTTSNTMLAGFLYLMVYPHIQEKCQREIDQMLERKDRVSFEDRHKMPYMQAVIHEVQRFANIVPLSVFHCTTKDSELSGYTIPKGTLIIQNMVSVLREEGQWKFPHEFNPENFLNDQGEFIKPEAFM-PFSAGPRMCLGEGLARMELFIIMVTLLRKFKFT 453          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Medaka
Match: ENSORLT00000017318.2 (pep primary_assembly:ASM223467v1:6:26173766:26186815:-1 gene:ENSORLG00000013811.2 transcript:ENSORLT00000017318.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.339 bits (329), Expect = 1.646e-32
Identity = 117/474 (24.68%), Postives = 209/474 (44.09%), Query Frame = 2
Query:   98 FIWLSVCFILMIIIFYVNYAPK--SNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSE-KKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKL-FPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNE--ECLI----KYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTE 1486
             +WL +C      I ++   P+   N PPGP  +P LG        ++L     N    F +L+  YG +   ++G +  V+++ F  + EA V     F GRP+   ++ +S   KG++L++  + W+++R   + +  + G+G+K   +     I+   + +    GK F    +       I+  ++FG   E  +  I  I +  CF   +          Y S   ++KL  P  E + N    +     L  + K   +   P +  +C +    K   +      ++ I  +DL+ AG DT S+ +      L  + H Q+K + EI+ +      +T+E +   P+ QA I E  R    VP ++     +E  L GY I    +II    S+  +   W+ P++FNP  F+ E+    +P +++ PF  G R CLGE + R E F  +V ++ KF  +   +  E
Sbjct:    7 LLWLCIC------ILFLQLKPRRPKNFPPGPPVLPMLG--------NLLHLSLDNPLKDFDRLRNSYGNVYSLFLGPKPAVIINGFKAMKEAMVIKATDFAGRPQDLFVNDVSKR-KGVILADYGESWRDHRRFALMTLRNFGLGKKSMEERISEEIQHTIKTLENNIGKLFSPQIMFHNAASNIICQVLFGKRFEYDDEIIKTIVQ--CFTRNSKIANGPWAMIYDSIPLIRKLPLPFREAFKNAEICVDVGTHLVNEHKETRIPGKPRDFVDCYLDEMEKRGDDSSFSEDQLIIYALDLHFAGTDTTSNTLLTGFFYLINYPHIQDKCQQEIDRVLEEKQQVTFEDRHNMPYMQAVIHEVQRIANTVPLSVFHSTTKETELMGYTIPKGTMIIQNMGSVLREDGQWKFPHDFNPENFLNEKGEFVKPEAFM-PFSAGPRMCLGEGLARMELFIIMVTLLRKFKFTWPEDAGE 462          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Medaka
Match: ENSORLT00000027885.1 (cytochrome P450 2F3-like [Source:NCBI gene;Acc:101156755])

HSP 1 Score: 130.954 bits (328), Expect = 2.271e-32
Identity = 108/410 (26.34%), Postives = 189/410 (46.10%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFP-MLEKYANK-------VSMLHKYIKLKVQ-RKLKYLTEDPNE--EC-LIKYYINKQMENSE-----IFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVS 1465
            +G +   Y+G QR V L  +D + EA V     F GR  +  L   +  + G+ +S  + W++ R   + +  D G+GRK            +   I   +GK FD   IL  T   ++  L++G      +    ++ + I  + + + +            A+  LFP ++E+   +       +  + K+ K K+Q  K K     P +  +C L++    K    SE     +    ++L+LAG +T SS +   L +L KH   QEK++ EI+++       + E ++  PFT A I E  R+  + P ++    ++++  +GY I    +I    +S+  +  LW +P  FNP  F+ ++NGNF+ N   +PF  G R C+GE + R E F  IV+ +  F  S
Sbjct:   62 HGPVMTIYMGWQRAVALVGYDAVKEALVDQADDFVGRAPLPFLYRATRGY-GIGISNGERWRQLRRFALTTLRDFGMGRKGMEQWIQEESRHIRAKINTFKGKPFDPTFILSCTVSNVICCLVYGERFNYDDKQFLELLQIISEVPRFNSS---------PMGAMYNLFPWLMERLPGRQHTIFGYIEDIRKFAKNKIQEHKDKLDPSSPRDFIDCFLLRMDQEKDNPTSEFHYENLVSTVLNLFLAGTETTSSTIRYALSVLIKHPKIQEKMQEEIDSVIGRERCPSMEERKSLPFTDAVIHEVQRFMDLTPFSLPHYSLKDISFRGYTIPKDTMIFPMLHSVLREDKLWSSPWSFNPQNFL-DQNGNFKKNPGFVPFSAGKRACVGESLARMELFLFIVSFLQDFTFS 460          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Medaka
Match: ENSORLT00000001518.2 (cytochrome P450 2F3-like [Source:NCBI gene;Acc:101156755])

HSP 1 Score: 130.954 bits (328), Expect = 2.418e-32
Identity = 108/410 (26.34%), Postives = 189/410 (46.10%), Query Frame = 2
Query:  290 YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFP-MLEKYANK-------VSMLHKYIKLKVQ-RKLKYLTEDPNE--EC-LIKYYINKQMENSE-----IFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVP-AIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVS 1465
            +G +   Y+G QR V L  +D + EA V     F GR  +  L   +  + G+ +S  + W++ R   + +  D G+GRK            +   I   +GK FD   IL  T   ++  L++G      +    ++ + I  + + + +            A+  LFP ++E+   +       +  + K+ K K+Q  K K     P +  +C L++    K    SE     +    ++L+LAG +T SS +   L +L KH   QEK++ EI+++       + E ++  PFT A I E  R+  + P ++    ++++  +GY I    +I    +S+  +  LW +P  FNP  F+ ++NGNF+ N   +PF  G R C+GE + R E F  IV+ +  F  S
Sbjct:   62 HGPVMTIYMGWQRAVALVGYDAVKEALVDQADDFVGRAPLPFLYRATRGY-GIGISNGERWRQLRRFALTTLRDFGMGRKGMEQWIQEESRHIRAKINTFKGKPFDPTFILSCTVSNVICCLVYGERFNYDDKQFLELLQIISEVPRFNSS---------PMGAMYNLFPWLMERLPGRQHTIFGYIEDIRKFAKNKIQEHKDKLDPSSPRDFIDCFLLRMDQEKDNPTSEFHYENLVSTVLNLFLAGTETTSSTIRYALSVLIKHPKIQEKMQEEIDSVIGRERCPSMEERKSLPFTDAVIHEVQRFMDLTPFSLPHYSLKDISFRGYTIPKDTMIFPMLHSVLREDKLWSSPWSFNPQNFL-DQNGNFKKNPGFVPFSAGKRACVGESLARMELFLFIVSFLQDFTFS 460          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Planmine SMEST
Match: SMESG000048655.1 (SMESG000048655.1)

HSP 1 Score: 901.738 bits (2329), Expect = 0.000e+0
Identity = 478/483 (98.96%), Postives = 480/483 (99.38%), Query Frame = 2
Query:  128 MIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPAIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTLVFTENVEK 1576
            MIIIFYVNYAPKSNEPPGPISVPFLGVIPYIIYKSILLKKKLNQKLIFQQLKKDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSD+FKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNI DIYETICFLAQTDFTETQILWKYRSFSAVKKLFPM EKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQEKIKIEIENLENTVN ITYEHKRFFPFTQAFIEECHRYFAVVPAIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGE+IGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTLVFTENVEK
Sbjct:    1 MIIIFYVNYAPKSNEPPGPISVPFLGVIPYIIYKSILLKKKLNQKLIFQQLKKDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDNFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNINDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMFEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQEKIKIEIENLENTVNRITYEHKRFFPFTQAFIEECHRYFAVVPAIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEVIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTLVFTENVEK 483          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Planmine SMEST
Match: SMESG000059367.1 (SMESG000059367.1)

HSP 1 Score: 899.812 bits (2324), Expect = 0.000e+0
Identity = 474/483 (98.14%), Postives = 480/483 (99.38%), Query Frame = 2
Query:  128 MIIIFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPAIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTLVFTENVEK 1576
            MIIIFYVNYAPKSNEPPGPISVPFLGVIPYIIYKSILLKKKLNQKLIFQQLKKDYGEISKFYIGDQRI+LLSSFDIISEAYVKNKFIFNGRPRIFG+DILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSV+NIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPM EKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQEKIKIEIENLENTVNPITYEHKRF PFTQAFIEECHRYFAV+PAIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGE+IGRNETFNSIVAIVSKFNVSLSMET+ NYDKILEGTSGGILHSPLDHTLVFTENVEK
Sbjct:    1 MIIIFYVNYAPKSNEPPGPISVPFLGVIPYIIYKSILLKKKLNQKLIFQQLKKDYGEISKFYIGDQRIILLSSFDIISEAYVKNKFIFNGRPRIFGIDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVSNIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMFEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQEKIKIEIENLENTVNPITYEHKRFLPFTQAFIEECHRYFAVIPAIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEVIGRNETFNSIVAIVSKFNVSLSMETSGNYDKILEGTSGGILHSPLDHTLVFTENVEK 483          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Planmine SMEST
Match: SMESG000059323.1 (SMESG000059323.1)

HSP 1 Score: 871.307 bits (2250), Expect = 0.000e+0
Identity = 461/480 (96.04%), Postives = 472/480 (98.33%), Query Frame = 2
Query:  137 IFYVNYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPAIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTLVFTENVEK 1576
            +FYVNYAPKSNEPPGPISVPFLGVIPYIIYKSILLKKKLNQKL+FQQLKK YGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSD+FKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPM EKYANKVSMLHKYI+LKVQRKLKYLTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQEKIKIEIENLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPAIERRPMEEVILKGYLIK TDLII +QYS++++ST+WENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGR ETFNSIVAIVSKFNVSLSMET+ N DKILEGTSGGI HSPLDHTLVFTENVEK
Sbjct:    1 MFYVNYAPKSNEPPGPISVPFLGVIPYIIYKSILLKKKLNQKLLFQQLKKHYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDNFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMFEKYANKVSMLHKYIELKVQRKLKYLTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQEKIKIEIENLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPAIERRPMEEVILKGYLIKSTDLIIGEQYSLNFNSTIWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRTETFNSIVAIVSKFNVSLSMETSGNCDKILEGTSGGIRHSPLDHTLVFTENVEK 480          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Planmine SMEST
Match: SMESG000059423.1 (SMESG000059423.1)

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 392/476 (82.35%), Postives = 430/476 (90.34%), Query Frame = 2
Query:  152 YAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPAIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTLVFTENVEKY 1579
            Y+ KSNEPPGPISVP  GV+PYIIYKSILLKKKLNQKLIFQQLKKDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPR+ GLDILSDDFKGL+L+E  +WK+NRSTTVKSFH+LGVGRKEFNDLSVANIESMCE++RE QGKE DV  IL KTFLKIMNS+IFGHE EET+SNI +IYE I FL QTDFT  QI W+YRSF  VKKLFP+LE YANKVS++H YIKLK Q KL+ LTEDPNEECL   Y N+Q+E SEI  CCVDLYLAGVDTVSS VSACLLLLGKHQHFQEKIKIEI+NLENTVNPITYEHKRF PFTQAFIEECHRYF  +P  + R ++EVILKGYLIKPTD+II +QYS++++ST+WENPNEFNPY+FIKEENGNFQPN YLI FGIGGRTCLGE+IG+ E FNSIV+IVSKFNVSLSMETTENYDKILEGTSGGI+HSPLDHTLVFTEN+EKY
Sbjct:   21 YSLKSNEPPGPISVPLFGVVPYIIYKSILLKKKLNQKLIFQQLKKDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRMVGLDILSDDFKGLLLNEGTMWKQNRSTTVKSFHNLGVGRKEFNDLSVANIESMCEYLREFQGKELDVKTILIKTFLKIMNSVIFGHETEETKSNILEIYEIIVFLTQTDFTVFQIFWQYRSFPGVKKLFPILENYANKVSIIHNYIKLKAQWKLRDLTEDPNEECLFNIYRNEQIEYSEILQCCVDLYLAGVDTVSSIVSACLLLLGKHQHFQEKIKIEIKNLENTVNPITYEHKRFLPFTQAFIEECHRYFITIPTFQHRVVKEVILKGYLIKPTDVIIGEQYSLNFNSTIWENPNEFNPYKFIKEENGNFQPNCYLIAFGIGGRTCLGEVIGKTEIFNSIVSIVSKFNVSLSMETTENYDKILEGTSGGIVHSPLDHTLVFTENLEKY 496          
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Planmine SMEST
Match: SMESG000059290.1 (SMESG000059290.1)

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 393/477 (82.39%), Postives = 430/477 (90.15%), Query Frame = 2
Query:  149 NYAPKSNEPPGPISVPFLGVXXXXXXXXXXXXXXXXXXXXXXXXXXDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEFNDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETESNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSMLHKYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGVDTVSSFVSACLLLLGKHQHFQXXXXXXXXNLENTVNPITYEHKRFFPFTQAFIEECHRYFAVVPAIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTLWENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSIVAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTLVFTENVEKY 1579
            +Y+ KSNEPPGPISVP  GVIPYIIYKSILLK+KLNQKLIFQQLKKDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPR+ GLDILSDDFKGL+L+E  +WK+NRSTTVKSFH+LGVGRKEFNDLSVANIESMCE+IRE QGKE DV  IL KTFLKIMNS+IFGHE EET+SNI +IYE I FL+QTDFT  Q+ W+YRSF  VKKLFP+LEKYANKVS++H YIKLK Q KL+ L EDPNEECL   Y N+Q+E SEI  CCVDLYLAG DTVSS VSACLLLLGKHQHFQEKIKIEIENLENTVNPITYEHKRF PFTQAFIEECHRYF  +P  + R ++EVILKGYLIKPTD+II +QYS++++ST+WENPNEFNPYRFIKEENGNFQPN YLI FGIGGRTCLGE+IG+ E FNSIV+IVSKFNVSLS ETTENYDKILEGTSGGI+HSPLDHTLVFTENVEKY
Sbjct:   20 SYSLKSNEPPGPISVPLFGVIPYIIYKSILLKRKLNQKLIFQQLKKDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKFIFNGRPRMVGLDILSDDFKGLILNEGTMWKQNRSTTVKSFHNLGVGRKEFNDLSVANIESMCEYIREFQGKELDVKTILIKTFLKIMNSVIFGHETEETKSNILEIYEIIVFLSQTDFTVFQVFWQYRSFPGVKKLFPILEKYANKVSIIHNYIKLKAQWKLRDLNEDPNEECLFNIYRNEQIEYSEILQCCVDLYLAGADTVSSIVSACLLLLGKHQHFQEKIKIEIENLENTVNPITYEHKRFLPFTQAFIEECHRYFITIPTFQHRVVKEVILKGYLIKPTDVIIGEQYSLNFNSTIWENPNEFNPYRFIKEENGNFQPNCYLIAFGIGGRTCLGEVIGKTEIFNSIVSIVSKFNVSLSTETTENYDKILEGTSGGIVHSPLDHTLVFTENVEKY 496          
The following BLAST results are available for this feature:
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYP2A65.272e-3523.94cytochrome P450 family 2 subfamily A member 6 [Sou... [more]
CYP2A73.650e-3323.43cytochrome P450 family 2 subfamily A member 7 [Sou... [more]
CYP2J21.943e-3226.28cytochrome P450 family 2 subfamily J member 2 [Sou... [more]
CYP2S14.219e-3225.49cytochrome P450 family 2 subfamily S member 1 [Sou... [more]
CYP2A139.232e-3223.58cytochrome P450 family 2 subfamily A member 13 [So... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp-33C42.037e-3324.02CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33C25.109e-3223.97CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33C38.521e-3224.02CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33C51.012e-3123.58CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-23A11.618e-3124.11CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp305a17.637e-2422.54gene:FBgn0036910 transcript:FBtr0074925[more]
Cyp18a12.542e-1823.12gene:FBgn0010383 transcript:FBtr0074610[more]
Cyp18a12.542e-1823.12gene:FBgn0010383 transcript:FBtr0074609[more]
Cyp6a22.280e-1630.92gene:FBgn0000473 transcript:FBtr0086133[more]
phm1.131e-1521.18gene:FBgn0004959 transcript:FBtr0074603[more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2y32.043e-3927.54cytochrome P450, family 2, subfamily Y, polypeptid... [more]
cyp2y34.007e-3827.05cytochrome P450, family 2, subfamily Y, polypeptid... [more]
CU179648.37.030e-3725.57cytochrome P450, family 2, subfamily X, polypeptid... [more]
cyp2x123.143e-3624.84cytochrome P450, family 2, subfamily X, polypeptid... [more]
cyp2p101.860e-3525.51cytochrome P450, family 2, subfamily P, polypeptid... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000043140.11.053e-3927.54pep primary_assembly:Xenopus_tropicalis_v9.1:4:503... [more]
ENSXETT00000043247.11.090e-3726.67pep primary_assembly:Xenopus_tropicalis_v9.1:4:503... [more]
slc35b22.192e-3725.20solute carrier family 35 member B2 [Source:Xenbase... [more]
slc35b22.192e-3725.20solute carrier family 35 member B2 [Source:Xenbase... [more]
slc35b23.537e-3725.35solute carrier family 35 member B2 [Source:Xenbase... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp2a57.463e-3625.59cytochrome P450, family 2, subfamily a, polypeptid... [more]
Cyp2c401.067e-3525.11cytochrome P450, family 2, subfamily c, polypeptid... [more]
Cyp2c401.889e-3525.11cytochrome P450, family 2, subfamily c, polypeptid... [more]
Cyp2c691.068e-3424.89cytochrome P450, family 2, subfamily c, polypeptid... [more]
Cyp2a41.121e-3425.05cytochrome P450, family 2, subfamily a, polypeptid... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20812|CP2A3_RAT4.217e-3525.65Cytochrome P450 2A3 OS=Rattus norvegicus OX=10116 ... [more]
sp|P20852|CP2A5_MOUSE4.877e-3525.59Cytochrome P450 2A5 OS=Mus musculus OX=10090 GN=Cy... [more]
sp|P56657|CP240_MOUSE7.463e-3525.11Cytochrome P450 2C40 OS=Mus musculus OX=10090 GN=C... [more]
sp|P11509|CP2A6_HUMAN2.532e-3423.94Cytochrome P450 2A6 OS=Homo sapiens OX=9606 GN=CYP... [more]
sp|P05179|CP2C7_RAT3.712e-3425.78Cytochrome P450 2C7 OS=Rattus norvegicus OX=10116 ... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8I7N11.867e-4527.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G5D79.447e-4426.38Uncharacterized protein OS=Macrostomum lignano OX=... [more]
W5KR374.325e-4129.16Uncharacterized protein OS=Astyanax mexicanus OX=7... [more]
A0A1I8FVM38.079e-4126.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3Q2TRL41.021e-4028.33Cytochrome P450, family 2, subfamily Y, polypeptid... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000010049.21.638e-4429.16cytochrome P450 2G1-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000057410.11.073e-3826.98cytochrome P450 2C15-like [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000046195.16.589e-3825.00pep primary_assembly:Astyanax_mexicanus-2.0:20:534... [more]
ENSAMXT00000035094.11.541e-3724.52pep primary_assembly:Astyanax_mexicanus-2.0:20:531... [more]
ENSAMXT00000045090.17.012e-3724.89pep primary_assembly:Astyanax_mexicanus-2.0:20:533... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001876.18.680e-2923.37pep scaffold:Pmarinus_7.0:GL477372:10316:22460:-1 ... [more]
cyp17a12.032e-2722.83cytochrome P450, family 17, subfamily A, polypepti... [more]
ENSPMAT00000011205.15.260e-2722.30pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1... [more]
ENSPMAT00000011254.14.780e-2021.43pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 ge... [more]
cyp2u12.103e-1927.70cytochrome P450, family 2, subfamily U, polypeptid... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO465061.338e-3025.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487741.268e-2624.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391926.324e-2624.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481911.957e-2423.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409304.995e-2424.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000018818.25.962e-3525.16cytochrome P450 2J2 [Source:NCBI gene;Acc:10115776... [more]
ENSORLT00000024770.25.543e-3324.09cytochrome P450 2J6 [Source:NCBI gene;Acc:10116941... [more]
ENSORLT00000017318.21.646e-3224.68pep primary_assembly:ASM223467v1:6:26173766:261868... [more]
ENSORLT00000027885.12.271e-3226.34cytochrome P450 2F3-like [Source:NCBI gene;Acc:101... [more]
ENSORLT00000001518.22.418e-3226.34cytochrome P450 2F3-like [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Steroid 17-alpha-hydroxylase/17,20 lyase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048655.10.000e+098.96SMESG000048655.1[more]
SMESG000059367.10.000e+098.14SMESG000059367.1[more]
SMESG000059323.10.000e+096.04SMESG000059323.1[more]
SMESG000059423.10.000e+082.35SMESG000059423.1[more]
SMESG000059290.10.000e+082.39SMESG000059290.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026757 ID=SMED30026757|Name=Steroid 17-alpha-hydroxylase/17,20 lyase|organism=Schmidtea mediterranea sexual|type=transcript|length=1689bp
GATGAGTTTATGCAGATTTTTTGTATCAAATGTGACCTTTCACCTGAACT
TTTGTAAGTTTAATTCAATTTTCAAAAAATAAAAAATGCTTTTTTATTTT
ATTTGGCTCTCTGTTTGCTTTATACTCATGATAATAATATTTTATGTTAA
TTATGCTCCCAAGTCAAATGAGCCCCCCGGTCCTATTTCTGTTCCCTTTT
TAGGAGTCATCCCATATATTATTTATAAGTCAATACTGCTCAAAAAGAAG
TTAAACCAAAAACTGATATTTCAACAATTGAAAAAGGATTATGGAGAAAT
ATCAAAGTTTTACATTGGAGATCAAAGAATCGTTCTCCTCTCTTCATTTG
ACATCATCTCTGAAGCATATGTGAAAAATAAATTTATATTTAACGGCAGA
CCACGAATATTTGGTTTAGATATTTTGTCAGATGATTTCAAAGGTTTGAT
GCTTTCAGAAAAGAAAATTTGGAAAGAAAATAGATCAACAACGGTGAAAT
CATTTCACGATCTTGGTGTTGGTAGAAAAGAGTTCAATGATCTATCTGTA
GCCAACATTGAGTCAATGTGCGAATGGATACGTGAATGTCAAGGTAAAGA
ATTTGACGTGAATCGGATTTTGTTTAAGACATTTCTAAAAATTATGAATT
CGCTTATATTTGGACACGAACCAGAAGAAACTGAATCAAACATTTACGAT
ATTTATGAAACGATTTGCTTTTTGGCTCAAACGGACTTTACAGAAACTCA
AATCCTTTGGAAATATCGCTCTTTCTCAGCAGTAAAAAAGTTATTTCCGA
TGTTAGAAAAGTATGCAAACAAAGTTTCAATGCTTCATAAATATATCAAA
TTGAAGGTCCAACGCAAACTGAAATATTTGACTGAGGATCCAAATGAAGA
ATGTTTGATTAAATACTATATCAATAAACAGATGGAGAATAGTGAAATAT
TTATTTGTTGTGTTGATTTATATTTAGCGGGTGTCGACACTGTTTCCTCC
TTTGTTAGCGCATGTCTTCTACTTTTAGGCAAACACCAACATTTTCAAGA
AAAAATAAAAATCGAAATTGAAAACCTTGAAAATACTGTAAATCCCATCA
CTTATGAACATAAACGTTTTTTTCCCTTCACTCAGGCGTTTATAGAAGAA
TGCCACCGATATTTCGCCGTGGTACCTGCCATTGAACGCAGACCAATGGA
AGAAGTAATTTTGAAGGGTTATTTAATCAAACCGACCGATCTTATTATTG
CTCAACAGTATTCTATAGACTATGATTCTACTTTATGGGAGAATCCTAAT
GAATTCAATCCGTATCGGTTTATTAAAGAGGAAAATGGCAACTTTCAACC
AAATAGTTATTTGATACCTTTCGGAATCGGAGGCCGAACCTGCCTTGGTG
AGATTATTGGGAGAAATGAAACCTTCAATTCTATAGTTGCAATAGTTAGC
AAATTCAATGTCTCCTTATCAATGGAAACAACAGAAAATTATGACAAAAT
ACTTGAAGGAACTAGTGGAGGAATTCTTCACTCTCCTTTAGATCATACTT
TAGTATTTACTGAAAATGTAGAAAAATATTAAGTTTATTTTTTGAATCAC
TTATTATCTATTACTATTTTCAAGGTTTTATCAGTTTTTGTTTTTATCTC
CCTTAAAAATAAATTGTTTATTTCTATAATAACAGAAAG
back to top

protein sequence of SMED30026757-orf-1

>SMED30026757-orf-1 ID=SMED30026757-orf-1|Name=SMED30026757-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MLFYFIWLSVCFILMIIIFYVNYAPKSNEPPGPISVPFLGVIPYIIYKSI
LLKKKLNQKLIFQQLKKDYGEISKFYIGDQRIVLLSSFDIISEAYVKNKF
IFNGRPRIFGLDILSDDFKGLMLSEKKIWKENRSTTVKSFHDLGVGRKEF
NDLSVANIESMCEWIRECQGKEFDVNRILFKTFLKIMNSLIFGHEPEETE
SNIYDIYETICFLAQTDFTETQILWKYRSFSAVKKLFPMLEKYANKVSML
HKYIKLKVQRKLKYLTEDPNEECLIKYYINKQMENSEIFICCVDLYLAGV
DTVSSFVSACLLLLGKHQHFQEKIKIEIENLENTVNPITYEHKRFFPFTQ
AFIEECHRYFAVVPAIERRPMEEVILKGYLIKPTDLIIAQQYSIDYDSTL
WENPNEFNPYRFIKEENGNFQPNSYLIPFGIGGRTCLGEIIGRNETFNSI
VAIVSKFNVSLSMETTENYDKILEGTSGGILHSPLDHTLVFTENVEKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004508steroid 17-alpha-monooxygenase activity
GO:0016829lyase activity
GO:004744217-alpha-hydroxyprogesterone aldolase activity
GO:0005506iron ion binding
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037heme binding
GO:0004497monooxygenase activity
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0031090organelle membrane
GO:0043231intracellular membrane-bounded organelle
Vocabulary: biological process
TermDefinition
GO:0006694steroid biosynthetic process
GO:0006704glucocorticoid biosynthetic process
GO:0008202steroid metabolic process
GO:0042446hormone biosynthetic process
GO:0042448progesterone metabolic process
GO:0055114oxidation-reduction process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000420parapharyngeal region
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR002401Cyt_P450_E_grp-I
IPR001128Cyt_P450
IPR017972Cyt_P450_CS