Helicase domino

Overview
NameHelicase domino
Smed IDSMED30026756
Length (bp)6722
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Helicase domino (SMED30026756) t-SNE clustered cells

Violin plots show distribution of expression levels for Helicase domino (SMED30026756) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Helicase domino (SMED30026756) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Helicase domino (SMED30026756) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026756

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30026756SMESG000031692.1 dd_Smed_v4_922_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026756SMESG000031692.1 dd_Smed_v4_922_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026756SMESG000031692.1 dd_Smed_v4_922_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Helicase domino vs. Ensembl Human
Match: EP400 (E1A binding protein p400 [Source:HGNC Symbol;Acc:HGNC:11958])

HSP 1 Score: 66.2402 bits (160), Expect = 1.100e-9
Identity = 27/70 (38.57%), Postives = 44/70 (62.86%), Query Frame = 2
Query:  275 DALQEATVLE-----KISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAAR 469
            D L E   LE     +I+ ++K G+W++  LPK+ E  R K++WD++LEE +W+A D      WK++AA+
Sbjct:  733 DTLTEQITLENQVHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKVAAAK 802          
BLAST of Helicase domino vs. Ensembl Human
Match: EP400 (E1A binding protein p400 [Source:HGNC Symbol;Acc:HGNC:11958])

HSP 1 Score: 64.6994 bits (156), Expect = 2.015e-9
Identity = 23/58 (39.66%), Postives = 41/58 (70.69%), Query Frame = 2
Query:  296 VLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAAR 469
            V ++I+ ++K G+W++  LPK+ E  R K++WD++LEE +W+A D      WK++AA+
Sbjct:  708 VHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKVAAAK 765          
BLAST of Helicase domino vs. Ensembl Human
Match: EP400 (E1A binding protein p400 [Source:HGNC Symbol;Acc:HGNC:11958])

HSP 1 Score: 64.6994 bits (156), Expect = 2.323e-9
Identity = 23/58 (39.66%), Postives = 41/58 (70.69%), Query Frame = 2
Query:  296 VLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAAR 469
            V ++I+ ++K G+W++  LPK+ E  R K++WD++LEE +W+A D      WK++AA+
Sbjct:  781 VHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKVAAAK 838          
BLAST of Helicase domino vs. Ensembl Human
Match: AC106886.6 (novel transcript)

HSP 1 Score: 63.5438 bits (153), Expect = 7.196e-9
Identity = 26/64 (40.62%), Postives = 38/64 (59.38%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAAR 469
            A  EA +  +I+ ++K G W+ + LPKV EP R K +WD++ EE +WL+ D      WK   AR
Sbjct:   81 AKHEAEIETRIAELRKEGFWSLKRLPKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVAR 144          
BLAST of Helicase domino vs. Ensembl Human
Match: SRCAP (Snf2 related CREBBP activator protein [Source:HGNC Symbol;Acc:HGNC:16974])

HSP 1 Score: 63.5438 bits (153), Expect = 7.233e-9
Identity = 26/64 (40.62%), Postives = 38/64 (59.38%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAAR 469
            A  EA +  +I+ ++K G W+ + LPKV EP R K +WD++ EE +WL+ D      WK   AR
Sbjct:  100 AKHEAEIETRIAELRKEGFWSLKRLPKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVAR 163          
BLAST of Helicase domino vs. Ensembl Celegans
Match: ssl-1 (Helicase ssl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9NEL2])

HSP 1 Score: 78.9518 bits (193), Expect = 5.193e-14
Identity = 44/124 (35.48%), Postives = 75/124 (60.48%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAEN-AKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFS--EKQTDCRLGSIFE 640
            A +EA VL +I+ ++KNG+W+   LPK +EP RNK +WD++LEE +W+A+D     + K   A++IA   AK +   + EI+     +++ E R  C+ I+ M++ ++S  +K  D R   + E
Sbjct:  203 AKREAHVLARIAELRKNGLWSNSRLPKCVEPERNKTHWDYLLEEVKWMAVDFRTETNTKRKIAKVIAHAIAKQHRDKQIEIERAAEREIK-EKRKMCAGIAKMVRDFWSSTDKVVDIRAKEVLE 325          
BLAST of Helicase domino vs. Ensembl Celegans
Match: ssl-1 (Helicase ssl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9NEL2])

HSP 1 Score: 78.9518 bits (193), Expect = 5.270e-14
Identity = 44/124 (35.48%), Postives = 75/124 (60.48%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAEN-AKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFS--EKQTDCRLGSIFE 640
            A +EA VL +I+ ++KNG+W+   LPK +EP RNK +WD++LEE +W+A+D     + K   A++IA   AK +   + EI+     +++ E R  C+ I+ M++ ++S  +K  D R   + E
Sbjct:   57 AKREAHVLARIAELRKNGLWSNSRLPKCVEPERNKTHWDYLLEEVKWMAVDFRTETNTKRKIAKVIAHAIAKQHRDKQIEIERAAEREIK-EKRKMCAGIAKMVRDFWSSTDKVVDIRAKEVLE 179          
BLAST of Helicase domino vs. Ensembl Celegans
Match: ssl-1 (Helicase ssl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9NEL2])

HSP 1 Score: 78.5666 bits (192), Expect = 5.678e-14
Identity = 44/124 (35.48%), Postives = 75/124 (60.48%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAEN-AKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFS--EKQTDCRLGSIFE 640
            A +EA VL +I+ ++KNG+W+   LPK +EP RNK +WD++LEE +W+A+D     + K   A++IA   AK +   + EI+     +++ E R  C+ I+ M++ ++S  +K  D R   + E
Sbjct:  203 AKREAHVLARIAELRKNGLWSNSRLPKCVEPERNKTHWDYLLEEVKWMAVDFRTETNTKRKIAKVIAHAIAKQHRDKQIEIERAAEREIK-EKRKMCAGIAKMVRDFWSSTDKVVDIRAKEVLE 325          
BLAST of Helicase domino vs. Ensembl Fly
Match: dom (gene:FBgn0020306 transcript:FBtr0342890)

HSP 1 Score: 66.2402 bits (160), Expect = 4.943e-10
Identity = 26/51 (50.98%), Postives = 38/51 (74.51%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAID 430
            A QE  V+++IS +++ G+WT   LPK+ EP+R KA+WD++LEE  WLA D
Sbjct:  518 AKQEVYVMQRISELQREGLWTERRLPKLQEPSRPKAHWDYLLEEMVWLAAD 568          
BLAST of Helicase domino vs. Ensembl Fly
Match: dom (gene:FBgn0020306 transcript:FBtr0071602)

HSP 1 Score: 65.855 bits (159), Expect = 5.552e-10
Identity = 26/51 (50.98%), Postives = 38/51 (74.51%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAID 430
            A QE  V+++IS +++ G+WT   LPK+ EP+R KA+WD++LEE  WLA D
Sbjct:  483 AKQEVYVMQRISELQREGLWTERRLPKLQEPSRPKAHWDYLLEEMVWLAAD 533          
BLAST of Helicase domino vs. Ensembl Fly
Match: dom (gene:FBgn0020306 transcript:FBtr0071603)

HSP 1 Score: 65.855 bits (159), Expect = 5.601e-10
Identity = 26/51 (50.98%), Postives = 38/51 (74.51%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAID 430
            A QE  V+++IS +++ G+WT   LPK+ EP+R KA+WD++LEE  WLA D
Sbjct:  483 AKQEVYVMQRISELQREGLWTERRLPKLQEPSRPKAHWDYLLEEMVWLAAD 533          
BLAST of Helicase domino vs. Ensembl Fly
Match: dom (gene:FBgn0020306 transcript:FBtr0071604)

HSP 1 Score: 64.3142 bits (155), Expect = 1.939e-9
Identity = 26/51 (50.98%), Postives = 38/51 (74.51%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAID 430
            A QE  V+++IS +++ G+WT   LPK+ EP+R KA+WD++LEE  WLA D
Sbjct:  483 AKQEVYVMQRISELQREGLWTERRLPKLQEPSRPKAHWDYLLEEMVWLAAD 533          
BLAST of Helicase domino vs. Ensembl Zebrafish
Match: ep400 (E1A binding protein p400 [Source:ZFIN;Acc:ZDB-GENE-081104-186])

HSP 1 Score: 65.0846 bits (157), Expect = 1.406e-9
Identity = 29/81 (35.80%), Postives = 47/81 (58.02%), Query Frame = 2
Query:  254 QDEQCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTY 496
            QD+Q    A  E+ V ++I+ ++K G W+   LPK+ E  R K+ WD++LEE +W+A D      WK++AA+ +      Y
Sbjct:  759 QDKQ-AEQAKLESHVHQRIAELRKEGQWSASRLPKLQESCRPKSQWDYLLEEMQWMAADFAQERRWKMAAAKKLVRTCARY 838          
BLAST of Helicase domino vs. Ensembl Zebrafish
Match: ep400 (E1A binding protein p400 [Source:ZFIN;Acc:ZDB-GENE-081104-186])

HSP 1 Score: 65.0846 bits (157), Expect = 1.536e-9
Identity = 29/81 (35.80%), Postives = 47/81 (58.02%), Query Frame = 2
Query:  254 QDEQCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTY 496
            QD+Q    A  E+ V ++I+ ++K G W+   LPK+ E  R K+ WD++LEE +W+A D      WK++AA+ +      Y
Sbjct:  759 QDKQ-AEQAKLESHVHQRIAELRKEGQWSASRLPKLQESCRPKSQWDYLLEEMQWMAADFAQERRWKMAAAKKLVRTCARY 838          
BLAST of Helicase domino vs. Ensembl Zebrafish
Match: srcap (Snf2-related CREBBP activator protein [Source:ZFIN;Acc:ZDB-GENE-041008-127])

HSP 1 Score: 53.9138 bits (128), Expect = 2.481e-6
Identity = 30/111 (27.03%), Postives = 59/111 (53.15%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSL-EFLQLQDEARLH--CSRISNMIKAWFS 601
            A  EA +  +   +K+ G W+ + L ++ EP R K +WD++ EE +WL+ D      WK   AR +    +  +   +E++   E  + +++A+L    S I+  ++A++S
Sbjct:   30 AKHEAEIEHRTLALKREGFWSLKRLSRITEPVRPKDHWDYLCEEMQWLSADFAQERRWKRGVARKV---VRMVMRHHEELRQKEERAKREEQAKLRRVASSIAKEVRAFWS 137          
BLAST of Helicase domino vs. Ensembl Zebrafish
Match: srcap (Snf2-related CREBBP activator protein [Source:ZFIN;Acc:ZDB-GENE-041008-127])

HSP 1 Score: 53.1434 bits (126), Expect = 5.237e-6
Identity = 30/111 (27.03%), Postives = 59/111 (53.15%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSL-EFLQLQDEARLH--CSRISNMIKAWFS 601
            A  EA +  +   +K+ G W+ + L ++ EP R K +WD++ EE +WL+ D      WK   AR +    +  +   +E++   E  + +++A+L    S I+  ++A++S
Sbjct:  869 AKHEAEIEHRTLALKREGFWSLKRLSRITEPVRPKDHWDYLCEEMQWLSADFAQERRWKRGVARKV---VRMVMRHHEELRQKEERAKREEQAKLRRVASSIAKEVRAFWS 976          
BLAST of Helicase domino vs. Ensembl Xenopus
Match: mlnr (motilin receptor [Source:Xenbase;Acc:XB-GENE-940650])

HSP 1 Score: 75.8702 bits (185), Expect = 1.001e-12
Identity = 38/122 (31.15%), Postives = 68/122 (55.74%), Query Frame = 2
Query:  221 QLNYFKRLKKVQDEQCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMI 586
            Q+   ++   +Q  + ++  LQE  V ++I+ ++K G+W+   LPK+ EP+R K++WD++LEE +W+A D      WK ++A+ +   A  Y    DE K + F + + E      RI+  I
Sbjct:  592 QMQTSQQQAAIQQFRVLTFTLQENHVHQRIAELRKEGLWSLRRLPKIQEPSRAKSHWDYLLEEMQWMAADFAQERMWKQASAKKLVRKAARY---HDE-KKMHFERAKKEEENKLKRIAASI 709          
BLAST of Helicase domino vs. Ensembl Xenopus
Match: mlnr (motilin receptor [Source:Xenbase;Acc:XB-GENE-940650])

HSP 1 Score: 71.2478 bits (173), Expect = 2.937e-11
Identity = 34/100 (34.00%), Postives = 57/100 (57.00%), Query Frame = 2
Query:  287 EATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMI 586
            E  V ++I+ ++K G+W+   LPK+ EP+R K++WD++LEE +W+A D      WK ++A+ +   A  Y    DE K + F + + E      RI+  I
Sbjct:  760 ENHVHQRIAELRKEGLWSLRRLPKIQEPSRAKSHWDYLLEEMQWMAADFAQERMWKQASAKKLVRKAARY---HDE-KKMHFERAKKEEENKLKRIAASI 855          
BLAST of Helicase domino vs. Ensembl Xenopus
Match: mlnr (motilin receptor [Source:Xenbase;Acc:XB-GENE-940650])

HSP 1 Score: 70.8626 bits (172), Expect = 3.350e-11
Identity = 34/100 (34.00%), Postives = 57/100 (57.00%), Query Frame = 2
Query:  287 EATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMI 586
            E  V ++I+ ++K G+W+   LPK+ EP+R K++WD++LEE +W+A D      WK ++A+ +   A  Y    DE K + F + + E      RI+  I
Sbjct:  699 ENHVHQRIAELRKEGLWSLRRLPKIQEPSRAKSHWDYLLEEMQWMAADFAQERMWKQASAKKLVRKAARY---HDE-KKMHFERAKKEEENKLKRIAASI 794          
BLAST of Helicase domino vs. Ensembl Xenopus
Match: mlnr (motilin receptor [Source:Xenbase;Acc:XB-GENE-940650])

HSP 1 Score: 70.8626 bits (172), Expect = 3.565e-11
Identity = 34/100 (34.00%), Postives = 57/100 (57.00%), Query Frame = 2
Query:  287 EATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMI 586
            E  V ++I+ ++K G+W+   LPK+ EP+R K++WD++LEE +W+A D      WK ++A+ +   A  Y    DE K + F + + E      RI+  I
Sbjct:  736 ENHVHQRIAELRKEGLWSLRRLPKIQEPSRAKSHWDYLLEEMQWMAADFAQERMWKQASAKKLVRKAARY---HDE-KKMHFERAKKEEENKLKRIAASI 831          
BLAST of Helicase domino vs. Ensembl Xenopus
Match: mlnr (motilin receptor [Source:Xenbase;Acc:XB-GENE-940650])

HSP 1 Score: 70.8626 bits (172), Expect = 3.676e-11
Identity = 34/100 (34.00%), Postives = 57/100 (57.00%), Query Frame = 2
Query:  287 EATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMI 586
            E  V ++I+ ++K G+W+   LPK+ EP+R K++WD++LEE +W+A D      WK ++A+ +   A  Y    DE K + F + + E      RI+  I
Sbjct:  699 ENHVHQRIAELRKEGLWSLRRLPKIQEPSRAKSHWDYLLEEMQWMAADFAQERMWKQASAKKLVRKAARY---HDE-KKMHFERAKKEEENKLKRIAASI 794          
BLAST of Helicase domino vs. Ensembl Mouse
Match: Srcap (Snf2-related CREBBP activator protein [Source:MGI Symbol;Acc:MGI:2444036])

HSP 1 Score: 61.2326 bits (147), Expect = 1.857e-9
Identity = 29/84 (34.52%), Postives = 46/84 (54.76%), Query Frame = 2
Query:  224 LNYFKRLKKVQDEQCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARII 475
            +N  ++ +K   E     A  EA +  +I+ ++K G W+ + LPKV EP R K +WD++ EE +WL+ D      WK   AR +
Sbjct:   83 VNRGQKWEKSHAE-IAEQAKHEAEIETRIAELRKEGFWSLKRLPKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKV 165          
BLAST of Helicase domino vs. Ensembl Mouse
Match: Srcap (Snf2-related CREBBP activator protein [Source:MGI Symbol;Acc:MGI:2444036])

HSP 1 Score: 63.5438 bits (153), Expect = 2.186e-9
Identity = 26/66 (39.39%), Postives = 39/66 (59.09%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARII 475
            A  EA +  +I+ ++K G W+ + LPKV EP R K +WD++ EE +WL+ D      WK   AR +
Sbjct:  100 AKHEAEIETRIAELRKEGFWSLKRLPKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVARKV 165          
BLAST of Helicase domino vs. Ensembl Mouse
Match: Ep400 (E1A binding protein p400 [Source:MGI Symbol;Acc:MGI:1276124])

HSP 1 Score: 64.3142 bits (155), Expect = 2.349e-9
Identity = 27/70 (38.57%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  275 DALQEATVLE-----KISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAAR 469
            D L E   LE     +I+ ++K G+W+   LPK+ E  R K++WD++LEE +W+A D      WK++AA+
Sbjct:  768 DKLAEQITLENQIHQRIADLRKEGLWSLRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKLAAAK 837          
BLAST of Helicase domino vs. Ensembl Mouse
Match: Ep400 (E1A binding protein p400 [Source:MGI Symbol;Acc:MGI:1276124])

HSP 1 Score: 64.3142 bits (155), Expect = 2.356e-9
Identity = 27/70 (38.57%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  275 DALQEATVLE-----KISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAAR 469
            D L E   LE     +I+ ++K G+W+   LPK+ E  R K++WD++LEE +W+A D      WK++AA+
Sbjct:  695 DKLAEQITLENQIHQRIADLRKEGLWSLRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKLAAAK 764          
BLAST of Helicase domino vs. Ensembl Mouse
Match: Ep400 (E1A binding protein p400 [Source:MGI Symbol;Acc:MGI:1276124])

HSP 1 Score: 64.3142 bits (155), Expect = 2.359e-9
Identity = 27/70 (38.57%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  275 DALQEATVLE-----KISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAAR 469
            D L E   LE     +I+ ++K G+W+   LPK+ E  R K++WD++LEE +W+A D      WK++AA+
Sbjct:  731 DKLAEQITLENQIHQRIADLRKEGLWSLRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKLAAAK 800          
BLAST of Helicase domino vs. UniProt/SwissProt
Match: sp|Q9NEL2|SSL1_CAEEL (Helicase ssl-1 OS=Caenorhabditis elegans OX=6239 GN=ssl-1 PE=2 SV=4)

HSP 1 Score: 78.9518 bits (193), Expect = 6.606e-13
Identity = 44/124 (35.48%), Postives = 75/124 (60.48%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAEN-AKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFS--EKQTDCRLGSIFE 640
            A +EA VL +I+ ++KNG+W+   LPK +EP RNK +WD++LEE +W+A+D     + K   A++IA   AK +   + EI+     +++ E R  C+ I+ M++ ++S  +K  D R   + E
Sbjct:  203 AKREAHVLARIAELRKNGLWSNSRLPKCVEPERNKTHWDYLLEEVKWMAVDFRTETNTKRKIAKVIAHAIAKQHRDKQIEIERAAEREIK-EKRKMCAGIAKMVRDFWSSTDKVVDIRAKEVLE 325          
BLAST of Helicase domino vs. UniProt/SwissProt
Match: sp|Q96L91|EP400_HUMAN (E1A-binding protein p400 OS=Homo sapiens OX=9606 GN=EP400 PE=1 SV=4)

HSP 1 Score: 66.2402 bits (160), Expect = 5.288e-9
Identity = 27/70 (38.57%), Postives = 44/70 (62.86%), Query Frame = 2
Query:  275 DALQEATVLE-----KISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAAR 469
            D L E   LE     +I+ ++K G+W++  LPK+ E  R K++WD++LEE +W+A D      WK++AA+
Sbjct:  769 DTLTEQITLENQVHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKVAAAK 838          
BLAST of Helicase domino vs. UniProt/SwissProt
Match: sp|Q9NDJ2|DOM_DROME (Helicase domino OS=Drosophila melanogaster OX=7227 GN=dom PE=1 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 5.615e-9
Identity = 26/51 (50.98%), Postives = 38/51 (74.51%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAID 430
            A QE  V+++IS +++ G+WT   LPK+ EP+R KA+WD++LEE  WLA D
Sbjct:  483 AKQEVYVMQRISELQREGLWTERRLPKLQEPSRPKAHWDYLLEEMVWLAAD 533          
BLAST of Helicase domino vs. UniProt/SwissProt
Match: sp|Q8CHI8|EP400_MOUSE (E1A-binding protein p400 OS=Mus musculus OX=10090 GN=Ep400 PE=1 SV=3)

HSP 1 Score: 64.3142 bits (155), Expect = 1.652e-8
Identity = 27/70 (38.57%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  275 DALQEATVLE-----KISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAAR 469
            D L E   LE     +I+ ++K G+W+   LPK+ E  R K++WD++LEE +W+A D      WK++AA+
Sbjct:  768 DKLAEQITLENQIHQRIADLRKEGLWSLRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKLAAAK 837          
BLAST of Helicase domino vs. UniProt/SwissProt
Match: sp|Q6ZRS2|SRCAP_HUMAN (Helicase SRCAP OS=Homo sapiens OX=9606 GN=SRCAP PE=1 SV=3)

HSP 1 Score: 63.5438 bits (153), Expect = 3.473e-8
Identity = 26/64 (40.62%), Postives = 38/64 (59.38%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAAR 469
            A  EA +  +I+ ++K G W+ + LPKV EP R K +WD++ EE +WL+ D      WK   AR
Sbjct:  100 AKHEAEIETRIAELRKEGFWSLKRLPKVPEPPRPKGHWDYLCEEMQWLSADFAQERRWKRGVAR 163          
BLAST of Helicase domino vs. TrEMBL
Match: A0A0X3PN17 (HSA domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR144042 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.282e-15
Identity = 41/112 (36.61%), Postives = 69/112 (61.61%), Query Frame = 2
Query:  263 QCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWF 598
            +   +A +EA+VL++IS + K G+W+   LPKVMEP+R + +WDF+L+E  W+A D      WK   AR +A +A+ + LMK E++  +   +  E R   + I+ M++ W+
Sbjct:  146 EIAQEAKREASVLQQISKLAKQGLWSATRLPKVMEPHRGRVHWDFLLDEARWMATDFSEERKWKKQTARKLAYSARAFCLMKQELQRRDDEAIDRERRKGATVIARMVRQWW 257          
BLAST of Helicase domino vs. TrEMBL
Match: A0A5K3F9V6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.745e-14
Identity = 41/113 (36.28%), Postives = 68/113 (60.18%), Query Frame = 2
Query:  263 QCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFS 601
            +   +A +EA+VL++I+ + K G+W+   LPKV+EP R  ++WD++L+E  W+A+D      WK   AR +A  A+ Y L+K EI   E   L +  R   + I+ M++ W+S
Sbjct:  144 EIAQEAKREASVLQQINKLAKQGLWSASRLPKVLEPERGVSHWDYLLDEVRWMAVDFREERKWKRDVARKLAYAARMYCLLKAEISRQEAEALDEMRRKGAALIAAMVRDWWS 256          
BLAST of Helicase domino vs. TrEMBL
Match: A0A0R3U4K8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1590 PE=4 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 1.861e-14
Identity = 41/113 (36.28%), Postives = 68/113 (60.18%), Query Frame = 2
Query:  263 QCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFS 601
            +   +A +EA+VL++I+ + K G+W+   LPKV+EP R  ++WD++L+E  W+A+D      WK   AR +A  A+ Y L+K EI   E   L +  R   + I+ M++ W+S
Sbjct:  165 EIAQEAKREASVLQQINKLAKQGLWSASRLPKVLEPERGVSHWDYLLDEVRWMAVDFREERKWKRDVARKLAYAARMYCLLKAEISRQEAEALDEMRRKGAALIAAMVRDWWS 277          
BLAST of Helicase domino vs. TrEMBL
Match: A0A5K3F9K7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.865e-14
Identity = 41/113 (36.28%), Postives = 68/113 (60.18%), Query Frame = 2
Query:  263 QCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFS 601
            +   +A +EA+VL++I+ + K G+W+   LPKV+EP R  ++WD++L+E  W+A+D      WK   AR +A  A+ Y L+K EI   E   L +  R   + I+ M++ W+S
Sbjct:  144 EIAQEAKREASVLQQINKLAKQGLWSASRLPKVLEPERGVSHWDYLLDEVRWMAVDFREERKWKRDVARKLAYAARMYCLLKAEISRQEAEALDEMRRKGAALIAAMVRDWWS 256          
BLAST of Helicase domino vs. TrEMBL
Match: R7UBK6 (HSA domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_103252 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.222e-13
Identity = 35/76 (46.05%), Postives = 52/76 (68.42%), Query Frame = 2
Query:  251 VQDEQCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIA 478
            V++E  V  A QEA V+++++  +K G+W+ + LPKV EP R+KA+WD++LEE +WLA D      WK + AR IA
Sbjct:    6 VREEAIVERAKQEAQVMQRVTEFRKEGMWSAKRLPKVQEPPRSKAHWDYLLEEMQWLAADFAQERKWKKAGARKIA 81          
BLAST of Helicase domino vs. Ensembl Cavefish
Match: ep400 (E1A binding protein p400 [Source:ZFIN;Acc:ZDB-GENE-081104-186])

HSP 1 Score: 72.0182 bits (175), Expect = 8.922e-12
Identity = 48/161 (29.81%), Postives = 83/161 (51.55%), Query Frame = 2
Query:  188 KLRKRSISSGRQLNYFKRLKKVQDEQCVSDALQ------EATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEI-KSLEFLQLQDEARLH--CSRISNMIKAWFSEKQTDCRLGSIFEL 643
            KL   S S+G +L+   +    Q+ Q  S   Q      E+ V ++I+ ++K G W+   LPK+ E +R K++WD++LEE +W+A D      WK++AA+ +      Y    DE+ K+ E  + ++E RL    S I+  +  ++S  Q    +   FE+
Sbjct:  739 KLAAPSSSTGLKLSGLSQGSANQNAQESSQDKQAEQAKLESQVHQRIAELRKEGQWSASRLPKLQEASRPKSHWDYLLEEMQWMAADFAQERRWKMAAAKKLVRTCARY---HDEVRKTAEREKNEEELRLRSIASAIAREVDYFWSNIQQVVEIKLRFEI 896          
BLAST of Helicase domino vs. Ensembl Cavefish
Match: srcap (Snf2-related CREBBP activator protein [Source:ZFIN;Acc:ZDB-GENE-041008-127])

HSP 1 Score: 55.0694 bits (131), Expect = 1.280e-6
Identity = 23/64 (35.94%), Postives = 35/64 (54.69%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAAR 469
            A  EA +  +   +K+ G W+ + L +V EP R K +WD++ EE +WL+ D      WK   AR
Sbjct:  928 AKHEADIEHRTLALKREGFWSLKRLSRVTEPVRPKVHWDYLCEEMQWLSADFAQERRWKRGVAR 991          
BLAST of Helicase domino vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000882.1 (pep scaffold:Pmarinus_7.0:GL478495:191085:195963:-1 gene:ENSPMAG00000000804.1 transcript:ENSPMAT00000000882.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 1.671e-9
Identity = 31/84 (36.90%), Postives = 50/84 (59.52%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLE 529
            A QEA + ++++ +KK G+W+ + L +V EP R K + D++LEE +WLA D      WK + A+ +   A+T V   +E K  E
Sbjct:   10 AKQEADIQQRVAHLKKAGLWSLKKLTRVTEPPRPKTHRDYLLEEMQWLAGDFAQERRWKRALAKKL---ARTVVRFHEEQKQKE 90          
BLAST of Helicase domino vs. Ensembl Medaka
Match: ep400 (E1A binding protein p400 [Source:NCBI gene;Acc:101167297])

HSP 1 Score: 69.707 bits (169), Expect = 4.120e-11
Identity = 64/281 (22.78%), Postives = 118/281 (41.99%), Query Frame = 2
Query:  254 QDEQCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLH--CSRISNMIKAWFSEKQTDCRLGSIFELPTEN-SSMDICQYWXXXXXXXXXXXXXXDYFYKSDSESLCSFNSTNS----HTSVMLSDDHFNFRDDLSIDFSDGNTPTDEL--------IDELNWLECDIKINETETNFSFEKEINELKILSQIPLEKIIDENYFNTDQYELKSESLS 1051
            QD+Q +  A  E+ V ++IS ++K G W    LPK++E +R K+ WD++LEE +W+A D      WK +AA+ +      Y   ++  KS E L  + E  L    S ++  ++ ++S       +   FE+  +   ++ + +       +         Y Y      L S +   S       +    DH     DL+    D   P D L         D   W +  +  ++ +      +E  E++ +S  P E ++ ++  + DQY    ++ S
Sbjct:  757 QDKQ-IEQAKLESQVHQRISELRKEGQWAASRLPKLVEASRPKSQWDYLLEEMQWMAADFAQERRWKEAAAKKLVRTCARY--HQEREKSEERLLQERETHLRHIASTVAREVEFFWSNIDQVVEIKLQFEIYEKKLKALSLQKATDGMLKVFFFLFFMYKYLYAQRRLCLSSVSDEESTIEEQEGIEKDADHKTELLDLA---KDAEMPLDSLRKQYAGAYADGFEWPQPGLNSDDDDV-----EETQEMECMSDSPHEAVLIDSLLSVDQYHGSEKATS 1026          
BLAST of Helicase domino vs. Ensembl Medaka
Match: srcap (Snf2 related CREBBP activator protein [Source:NCBI gene;Acc:101165011])

HSP 1 Score: 57.3806 bits (137), Expect = 2.573e-7
Identity = 31/111 (27.93%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  278 ALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDE---ARLHCSRISNMIKAWFS 601
            A  EA +  +   +K+ G W+ + L ++ EP R K +WD++ EE +WL+ D      WK   AR +    +  V   +E++  E    +DE    R   S I+  I+++++
Sbjct:  983 AKHEADIEHRTQALKREGFWSTKRLSRLTEPQRPKVHWDYLCEEMQWLSADFAQERRWKRGVARKV---VRMVVRHHEELRQKEEKAKRDEHAKIRKIASNIAKEIRSFWT 1090          
BLAST of Helicase domino vs. Planmine SMEST
Match: SMESG000031692.1 (SMESG000031692.1)

HSP 1 Score: 2489.92 bits (6452), Expect = 0.000e+0
Identity = 1271/1273 (99.84%), Postives = 1271/1273 (99.84%), Query Frame = 2
Query:   35 MNSLNLLNIFHFQNDFKYKFGPDSLNDIVLTKDKLCLPKPCNVLKNIYQYKKLRKRSISSGRQLNYFKRLKKVQDEQCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFSEKQTDCRLGSIFELPTENSSMDICQYWXXXXXXXXXXXXXXDYFYKSDSESLCSFNSTNSHTSVMLSDDHFNFRDDLSIDFSDGNTPTDELIDELNWLECDIKINETETNFSFEKEINELKILSQIPLEKIIDENYFNTDQYELKSESLSEIDLESVASENTDTVLSIKPSFIVSQSEKIQNVLNIPNTEMKNLGVFENIFKNESFNRNFQVIYELIKIKCSFSILSSMKCGDDRXXXXXXXXXXXXXXQYPSFELIVTNTSRIYEWKMLFSALSSPRQLIIFDSYVSLKDASEALKNVDXXXXXXXXXXYSVLPIFNLASVKWSNIIYDQIEKICEYSSNTIHLSTLDLYGARIGLISEHNDLFNQEGSSNIFLRLFYSSLQIEEFINEIQHSKILDKLTVLMNHCIPLEKIFDFEHVYKIVMCKLSPFQNSLHKYTLAKLRRSLETKSLLNSIEAICQDIQLSQHPFCFESYDNEETEMLKSLNKQHYLLKNSTYFLPNSDILSIYLPRKVFMTFLTLKDEKYSKSSNCILPHNNSAIFSYTKYERLQMKNLLISMSNIDNSMNELAFYLADVDDKHDQYFNKNINSNVNGNQGFLTSIEIDKLIDEYNIFNKNEVHNMIKNIDLESQLEPHNRERDSQLSSTLAARRSKTKFKSRLTSISKENEKYIILLDCSDINYLTSNLFMVDINYLSNELGCLDKLFSITKRYIEITWHKYIIIQPKVIARSPKITYSGKSKLQNQNENNLVNSISLVFQSYLNKLPTNTIKEYSYGQEELGLSGKLDTLNSILINLSKDLKLETCIIISHSFELLNLIEALIYINDNYGSFMRFRFSSYAGMNDRNTLNFISRFNKFQLRHKKTILLLHSRINYEFLIQLNIRSCAVVIADAHWQIDSDQSILNLINRLGLNCLLSQGNGISSIYKLCCLETLEQYFLRNDLSFLCENSYNNKDNISTTSAIICSNSIFKCFIDNVLSPIKEEFISVYCTEDLQKKDKLTKLSNQSVKDLLNSFVNPYDLLQLCHNQFTKNKFKNLSEYYVNKDKLNYRLVNLKEALQNWQNNLYKRQKKLKHLLNFFEDQGFFCF 3853
            MNSLNLLNIFHFQNDFKYKFGPDSLNDIVLTKDKLCLPKPCNVLKNIYQYKKLRKRSISSGRQLNYFKRLKKVQDEQCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFSEKQTDCRLGSIFELPTENSSMDICQYWISSNLISSENNENSDYFYKSDSESLCSFNSTNSHTSVMLSDDHFNFRDDLSIDFSDGNTPTDELIDELNWLECDIKINETETNFSFEKEINELKILSQIPLEKIIDENYFNTDQYELKSESLSEIDLESVASENTDTVLSIKPSFIVSQSEKIQNVLNIPNTEMKNLGVFENIFKNESFNRNFQVIYELIKIKCSFSILSSMKCGDDRLIISVLLSILPIELQYPSFELIVTNTSRIYEWKMLFSALSSPRQLIIFDSYVSLKDASEALKNVDCCESSICIISYSVLPIFNLASVKWSNIIYDQIEKICEYSSNTIHLSTLDLYGARIGLISEHNDLFNQEGSSNIFLRLFYSSLQIEEFINEIQHSKILDKLTVLMNHCIPLEKIFDFEHVYKIVMCKLSPFQNSLHKYTLAKLRRSLETKSLLNSIEAICQDIQLSQHPFCFESYDNEETEMLKSLNKQHYLLKNSTYFLPNSDILSIYLPRKVFMTFLTLKDEKYSKSSNCILPHNNSAIFSYTKYERLQMKNLLISMSNIDNSMNELAFYLADVDDKHDQYFNKNINSNVNGNQGFLTSIEIDKLIDEYNIFNKNEVHNMIKNIDLESQLEPHNRERDSQLSSTLAARRSKTKFKSRLTSISKENEKYIILLDCSDINYLTSNLFMVDINYLSNELGCLDKLFSITKRYIEITWHKYIIIQPKVIARSPKITYSGKSKLQNQNENNLVNSISLVFQSYLNKLPTNTIKEYSYGQEELGLSGKLDTLNSILINLSKDLKLETCIIISHSFELLNLIEALIYINDNYGSFMRFRFSSYAGMNDRNTLNFISRFNKFQLRHKKTILLLHSRINYEFLIQLNIRSCAVVIADAHWQIDSDQSILNLINRLGLNCLLSQGNGISSIYKLCCLETLEQYFLRNDLSFLCENSYNNKDNISTTSAIICSNSIFKCFIDNVLSPIKEEFISVYCTEDLQKKDKLTKLSNQSVKDLLNSFVNPYDLLQLCHNQFTKNKFKNLSEYYVNKDKLNYRLVNLKEALQNWQNNLYKRQKKLKHLLNFFEDQGF  F
Sbjct:    1 MNSLNLLNIFHFQNDFKYKFGPDSLNDIVLTKDKLCLPKPCNVLKNIYQYKKLRKRSISSGRQLNYFKRLKKVQDEQCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFSEKQTDCRLGSIFELPTENSSMDICQYWISSNLISSENNENSDYFYKSDSESLCSFNSTNSHTSVMLSDDHFNFRDDLSIDFSDGNTPTDELIDELNWLECDIKINETETNFSFEKEINELKILSQIPLEKIIDENYFNTDQYELKSESLSEIDLESVASENTDTVLSIKPSFIVSQSEKIQNVLNIPNTEMKNLGVFENIFKNESFNRNFQVIYELIKIKCSFSILSSMKCGDDRLIISVLLSILPIELQYPSFELIVTNTSRIYEWKMLFSALSSPRQLIIFDSYVSLKDASEALKNVDCCESSICIISYSVLPIFNLASVKWSNIIYDQIEKICEYSSNTIHLSTLDLYGARIGLISEHNDLFNQEGSSNIFLRLFYSSLQIEEFINEIQHSKILDKLTVLMNHCIPLEKIFDFEHVYKIVMCKLSPFQNSLHKYTLAKLRRSLETKSLLNSIEAICQDIQLSQHPFCFESYDNEETEMLKSLNKQHYLLKNSTYFLPNSDILSIYLPRKVFMTFLTLKDEKYSKSSNCILPHNNSAIFSYTKYERLQMKNLLISMSNIDNSMNELAFYLADVDDKHDQYFNKNINSNVNGNQGFLTSIEIDKLIDEYNIFNKNEVHNMIKNIDLESQLEPHNRERDSQLSSTLAARRSKTKFKSRLTSISKENEKYIILLDCSDINYLTSNLFMVDINYLSNELGCLDKLFSITKRYIEITWHKYIIIQPKVIARSPKITYSGKSKLQNQNENNLVNSISLVFQSYLNKLPTNTIKEYSYGQEELGLSGKLDTLNSILINLSKDLKLETCIIISHSFELLNLIEALIYINDNYGSFMRFRFSSYAGMNDRNTLNFISRFNKFQLRHKKTILLLHSRINYEFLIQLNIRSCAVVIADAHWQIDSDQSILNLINRLGLNCLLSQGNGISSIYKLCCLETLEQYFLRNDLSFLCENSYNNKDNISTTSAIICSNSIFKCFIDNVLSPIKEEFISVYCTEDLQKKDKLTKLSNQSVKDLLNSFVNPYDLLQLCHNQFTKNKFKNLSEYYVNKDKLNYRLVNLKEALQNWQNNLYKRQKKLKHLLNFFEDQGFLLF 1273          

HSP 2 Score: 1102.43 bits (2850), Expect = 0.000e+0
Identity = 544/544 (100.00%), Postives = 544/544 (100.00%), Query Frame = 1
Query: 3853 YDSKFVNSQNNVVWSPPHMDNSLKIMHSELANMYILKPLENTGLSECVIPTKNYQTKTIFKKWDEKNYIVKDELILPSTDHADMNRIKKRKLSNDFQMDFPTYPNSHQKKRKILSNRRYFTENEIESDQHNIKMRLKNEKGNDSELQAVEQKDILDIKKLSPVLGEVFHSETHTSNQNIPNNAGILADNKCHFVILYSNDGTIKINLHRPFYCKEGLKTLKIKRQHIGIGTLNNLSTKPNLVAGSNIPNYSLQQKALQNQRGQLFISAKIDSCSDSTVQTNGENEYEKLPEWNIHEEAVLYQNISHYQDHQFSINITENSNSLPNFKICEHYLNFYSITNTHRSNEICKIHFNKLQMGFQSHNKGEXXXXXXXXXXXXATSTGVLKVRTVNESRPVIGGVTGRKLKIKMKNSIGTYGTSIFGSTQAMTNKIKMFQNFLYDRKVNLTKTNQIVNSCLNSFDSKTTMTFKMLDEVVNTSKLPSLLPSHSQTIKKNATHISALEEHNIHPDKIFTPAMLIQRREDMDKESEQTNRQSSLTPISYRNF 5484
            YDSKFVNSQNNVVWSPPHMDNSLKIMHSELANMYILKPLENTGLSECVIPTKNYQTKTIFKKWDEKNYIVKDELILPSTDHADMNRIKKRKLSNDFQMDFPTYPNSHQKKRKILSNRRYFTENEIESDQHNIKMRLKNEKGNDSELQAVEQKDILDIKKLSPVLGEVFHSETHTSNQNIPNNAGILADNKCHFVILYSNDGTIKINLHRPFYCKEGLKTLKIKRQHIGIGTLNNLSTKPNLVAGSNIPNYSLQQKALQNQRGQLFISAKIDSCSDSTVQTNGENEYEKLPEWNIHEEAVLYQNISHYQDHQFSINITENSNSLPNFKICEHYLNFYSITNTHRSNEICKIHFNKLQMGFQSHNKGENSLSRINRNSNLATSTGVLKVRTVNESRPVIGGVTGRKLKIKMKNSIGTYGTSIFGSTQAMTNKIKMFQNFLYDRKVNLTKTNQIVNSCLNSFDSKTTMTFKMLDEVVNTSKLPSLLPSHSQTIKKNATHISALEEHNIHPDKIFTPAMLIQRREDMDKESEQTNRQSSLTPISYRNF
Sbjct: 1274 YDSKFVNSQNNVVWSPPHMDNSLKIMHSELANMYILKPLENTGLSECVIPTKNYQTKTIFKKWDEKNYIVKDELILPSTDHADMNRIKKRKLSNDFQMDFPTYPNSHQKKRKILSNRRYFTENEIESDQHNIKMRLKNEKGNDSELQAVEQKDILDIKKLSPVLGEVFHSETHTSNQNIPNNAGILADNKCHFVILYSNDGTIKINLHRPFYCKEGLKTLKIKRQHIGIGTLNNLSTKPNLVAGSNIPNYSLQQKALQNQRGQLFISAKIDSCSDSTVQTNGENEYEKLPEWNIHEEAVLYQNISHYQDHQFSINITENSNSLPNFKICEHYLNFYSITNTHRSNEICKIHFNKLQMGFQSHNKGENSLSRINRNSNLATSTGVLKVRTVNESRPVIGGVTGRKLKIKMKNSIGTYGTSIFGSTQAMTNKIKMFQNFLYDRKVNLTKTNQIVNSCLNSFDSKTTMTFKMLDEVVNTSKLPSLLPSHSQTIKKNATHISALEEHNIHPDKIFTPAMLIQRREDMDKESEQTNRQSSLTPISYRNF 1817          

HSP 3 Score: 262.692 bits (670), Expect = 5.656e-70
Identity = 186/228 (81.58%), Postives = 197/228 (86.40%), Query Frame = 3
Query: 5526 ESNTINTSSHSLNHIRRNSSNITSGQNLYSLQSTANNQIIARARYNVPINRQLSGSTAIHQPXXXXXXXXXXXXXXXXXMGCRSQALQFQIQHTRNTLPRKTPSQLFRDFILEMCIISHHFVTII**TEVQLRLSDLLFRLYVFINFLKKLIFKXXXXXXXXXXXXXXXXXXXFPNSHDQNSTAITRTVERNSNFNLSCQIRAPSVRTNVTTVASTNRANQIPRMLHV 6209
            ESNTINTSSHSLNHIRRNSSNITSGQNLYSLQSTANNQIIARARYNVPINRQLSGSTAIHQPNQNSVIASSSNSSQNHNMGCRSQALQFQIQHTRNTLPRKTPSQ     +    +  H+F +        LR ++++ R      F++ +I  VVNQSNNQNTSTNNSIITVFPNSHDQNSTAITRTVERNSNFNLSCQIRAPSVRTNVTTVASTNRANQIPRMLHV
Sbjct: 1818 ESNTINTSSHSLNHIRRNSSNITSGQNLYSLQSTANNQIIARARYNVPINRQLSGSTAIHQPNQNSVIASSSNSSQNHNMGCRSQALQFQIQHTRNTLPRKTPSQPVIQRLYPGNV--HNFSS--------LRHNNIINRSAA--AFVRPIIPTVVNQSNNQNTSTNNSIITVFPNSHDQNSTAITRTVERNSNFNLSCQIRAPSVRTNVTTVASTNRANQIPRMLHV 2033          

HSP 4 Score: 76.2554 bits (186), Expect = 2.945e-13
Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 2
Query: 5840 IIQRLYPGNVHNFSSLRHNNIINRSAAAFVRPIIPTV 5950
            +IQRLYPGNVHNFSSLRHNNIINRSAAAFVRPIIPTV
Sbjct: 1924 VIQRLYPGNVHNFSSLRHNNIINRSAAAFVRPIIPTV 1960          
BLAST of Helicase domino vs. Planmine SMEST
Match: SMESG000031692.1 (SMESG000031692.1)

HSP 1 Score: 2484.14 bits (6437), Expect = 0.000e+0
Identity = 1271/1273 (99.84%), Postives = 1271/1273 (99.84%), Query Frame = 2
Query:   35 MNSLNLLNIFHFQNDFKYKFGPDSLNDIVLTKDKLCLPKPCNVLKNIYQYKKLRKRSISSGRQLNYFKRLKKVQDEQCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFSEKQTDCRLGSIFELPTENSSMDICQYWXXXXXXXXXXXXXXDYFYKSDSESLCSFNSTNSHTSVMLSDDHFNFRDDLSIDFSDGNTPTDELIDELNWLECDIKINETETNFSFEKEINELKILSQIPLEKIIDENYFNTDQYELKSESLSEIDLESVASENTDTVLSIKPSFIVSQSEKIQNVLNIPNTEMKNLGVFENIFKNESFNRNFQVIYELIKIKCSFSILSSMKCGDDRXXXXXXXXXXXXXXQYPSFELIVTNTSRIYEWKMLFSALSSPRQLIIFDSYVSLKDASEALKNVDXXXXXXXXXXYSVLPIFNLASVKWSNIIYDQIEKICEYSSNTIHLSTLDLYGARIGLISEHNDLFNQEGSSNIFLRLFYSSLQIEEFINEIQHSKILDKLTVLMNHCIPLEKIFDFEHVYKIVMCKLSPFQNSLHKYTLAKLRRSLETKSLLNSIEAICQDIQLSQHPFCFESYDNEETEMLKSLNKQHYLLKNSTYFLPNSDILSIYLPRKVFMTFLTLKDEKYSKSSNCILPHNNSAIFSYTKYERLQMKNLLISMSNIDNSMNELAFYLADVDDKHDQYFNKNINSNVNGNQGFLTSIEIDKLIDEYNIFNKNEVHNMIKNIDLESQLEPHNRERDSQLSSTLAARRSKTKFKSRLTSISKENEKYIILLDCSDINYLTSNLFMVDINYLSNELGCLDKLFSITKRYIEITWHKYIIIQPKVIARSPKITYSGKSKLQNQNENNLVNSISLVFQSYLNKLPTNTIKEYSYGQEELGLSGKLDTLNSILINLSKDLKLETCIIISHSFELLNLIEALIYINDNYGSFMRFRFSSYAGMNDRNTLNFISRFNKFQLRHKKTILLLHSRINYEFLIQLNIRSCAVVIADAHWQIDSDQSILNLINRLGLNCLLSQGNGISSIYKLCCLETLEQYFLRNDLSFLCENSYNNKDNISTTSAIICSNSIFKCFIDNVLSPIKEEFISVYCTEDLQKKDKLTKLSNQSVKDLLNSFVNPYDLLQLCHNQFTKNKFKNLSEYYVNKDKLNYRLVNLKEALQNWQNNLYKRQKKLKHLLNFFEDQGFFCF 3853
            MNSLNLLNIFHFQNDFKYKFGPDSLNDIVLTKDKLCLPKPCNVLKNIYQYKKLRKRSISSGRQLNYFKRLKKVQDEQCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFSEKQTDCRLGSIFELPTENSSMDICQYWISSNLISSENNENSDYFYKSDSESLCSFNSTNSHTSVMLSDDHFNFRDDLSIDFSDGNTPTDELIDELNWLECDIKINETETNFSFEKEINELKILSQIPLEKIIDENYFNTDQYELKSESLSEIDLESVASENTDTVLSIKPSFIVSQSEKIQNVLNIPNTEMKNLGVFENIFKNESFNRNFQVIYELIKIKCSFSILSSMKCGDDRLIISVLLSILPIELQYPSFELIVTNTSRIYEWKMLFSALSSPRQLIIFDSYVSLKDASEALKNVDCCESSICIISYSVLPIFNLASVKWSNIIYDQIEKICEYSSNTIHLSTLDLYGARIGLISEHNDLFNQEGSSNIFLRLFYSSLQIEEFINEIQHSKILDKLTVLMNHCIPLEKIFDFEHVYKIVMCKLSPFQNSLHKYTLAKLRRSLETKSLLNSIEAICQDIQLSQHPFCFESYDNEETEMLKSLNKQHYLLKNSTYFLPNSDILSIYLPRKVFMTFLTLKDEKYSKSSNCILPHNNSAIFSYTKYERLQMKNLLISMSNIDNSMNELAFYLADVDDKHDQYFNKNINSNVNGNQGFLTSIEIDKLIDEYNIFNKNEVHNMIKNIDLESQLEPHNRERDSQLSSTLAARRSKTKFKSRLTSISKENEKYIILLDCSDINYLTSNLFMVDINYLSNELGCLDKLFSITKRYIEITWHKYIIIQPKVIARSPKITYSGKSKLQNQNENNLVNSISLVFQSYLNKLPTNTIKEYSYGQEELGLSGKLDTLNSILINLSKDLKLETCIIISHSFELLNLIEALIYINDNYGSFMRFRFSSYAGMNDRNTLNFISRFNKFQLRHKKTILLLHSRINYEFLIQLNIRSCAVVIADAHWQIDSDQSILNLINRLGLNCLLSQGNGISSIYKLCCLETLEQYFLRNDLSFLCENSYNNKDNISTTSAIICSNSIFKCFIDNVLSPIKEEFISVYCTEDLQKKDKLTKLSNQSVKDLLNSFVNPYDLLQLCHNQFTKNKFKNLSEYYVNKDKLNYRLVNLKEALQNWQNNLYKRQKKLKHLLNFFEDQGF  F
Sbjct:    1 MNSLNLLNIFHFQNDFKYKFGPDSLNDIVLTKDKLCLPKPCNVLKNIYQYKKLRKRSISSGRQLNYFKRLKKVQDEQCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFSEKQTDCRLGSIFELPTENSSMDICQYWISSNLISSENNENSDYFYKSDSESLCSFNSTNSHTSVMLSDDHFNFRDDLSIDFSDGNTPTDELIDELNWLECDIKINETETNFSFEKEINELKILSQIPLEKIIDENYFNTDQYELKSESLSEIDLESVASENTDTVLSIKPSFIVSQSEKIQNVLNIPNTEMKNLGVFENIFKNESFNRNFQVIYELIKIKCSFSILSSMKCGDDRLIISVLLSILPIELQYPSFELIVTNTSRIYEWKMLFSALSSPRQLIIFDSYVSLKDASEALKNVDCCESSICIISYSVLPIFNLASVKWSNIIYDQIEKICEYSSNTIHLSTLDLYGARIGLISEHNDLFNQEGSSNIFLRLFYSSLQIEEFINEIQHSKILDKLTVLMNHCIPLEKIFDFEHVYKIVMCKLSPFQNSLHKYTLAKLRRSLETKSLLNSIEAICQDIQLSQHPFCFESYDNEETEMLKSLNKQHYLLKNSTYFLPNSDILSIYLPRKVFMTFLTLKDEKYSKSSNCILPHNNSAIFSYTKYERLQMKNLLISMSNIDNSMNELAFYLADVDDKHDQYFNKNINSNVNGNQGFLTSIEIDKLIDEYNIFNKNEVHNMIKNIDLESQLEPHNRERDSQLSSTLAARRSKTKFKSRLTSISKENEKYIILLDCSDINYLTSNLFMVDINYLSNELGCLDKLFSITKRYIEITWHKYIIIQPKVIARSPKITYSGKSKLQNQNENNLVNSISLVFQSYLNKLPTNTIKEYSYGQEELGLSGKLDTLNSILINLSKDLKLETCIIISHSFELLNLIEALIYINDNYGSFMRFRFSSYAGMNDRNTLNFISRFNKFQLRHKKTILLLHSRINYEFLIQLNIRSCAVVIADAHWQIDSDQSILNLINRLGLNCLLSQGNGISSIYKLCCLETLEQYFLRNDLSFLCENSYNNKDNISTTSAIICSNSIFKCFIDNVLSPIKEEFISVYCTEDLQKKDKLTKLSNQSVKDLLNSFVNPYDLLQLCHNQFTKNKFKNLSEYYVNKDKLNYRLVNLKEALQNWQNNLYKRQKKLKHLLNFFEDQGFLLF 1273          

HSP 2 Score: 1102.81 bits (2851), Expect = 0.000e+0
Identity = 544/544 (100.00%), Postives = 544/544 (100.00%), Query Frame = 1
Query: 3853 YDSKFVNSQNNVVWSPPHMDNSLKIMHSELANMYILKPLENTGLSECVIPTKNYQTKTIFKKWDEKNYIVKDELILPSTDHADMNRIKKRKLSNDFQMDFPTYPNSHQKKRKILSNRRYFTENEIESDQHNIKMRLKNEKGNDSELQAVEQKDILDIKKLSPVLGEVFHSETHTSNQNIPNNAGILADNKCHFVILYSNDGTIKINLHRPFYCKEGLKTLKIKRQHIGIGTLNNLSTKPNLVAGSNIPNYSLQQKALQNQRGQLFISAKIDSCSDSTVQTNGENEYEKLPEWNIHEEAVLYQNISHYQDHQFSINITENSNSLPNFKICEHYLNFYSITNTHRSNEICKIHFNKLQMGFQSHNKGEXXXXXXXXXXXXATSTGVLKVRTVNESRPVIGGVTGRKLKIKMKNSIGTYGTSIFGSTQAMTNKIKMFQNFLYDRKVNLTKTNQIVNSCLNSFDSKTTMTFKMLDEVVNTSKLPSLLPSHSQTIKKNATHISALEEHNIHPDKIFTPAMLIQRREDMDKESEQTNRQSSLTPISYRNF 5484
            YDSKFVNSQNNVVWSPPHMDNSLKIMHSELANMYILKPLENTGLSECVIPTKNYQTKTIFKKWDEKNYIVKDELILPSTDHADMNRIKKRKLSNDFQMDFPTYPNSHQKKRKILSNRRYFTENEIESDQHNIKMRLKNEKGNDSELQAVEQKDILDIKKLSPVLGEVFHSETHTSNQNIPNNAGILADNKCHFVILYSNDGTIKINLHRPFYCKEGLKTLKIKRQHIGIGTLNNLSTKPNLVAGSNIPNYSLQQKALQNQRGQLFISAKIDSCSDSTVQTNGENEYEKLPEWNIHEEAVLYQNISHYQDHQFSINITENSNSLPNFKICEHYLNFYSITNTHRSNEICKIHFNKLQMGFQSHNKGENSLSRINRNSNLATSTGVLKVRTVNESRPVIGGVTGRKLKIKMKNSIGTYGTSIFGSTQAMTNKIKMFQNFLYDRKVNLTKTNQIVNSCLNSFDSKTTMTFKMLDEVVNTSKLPSLLPSHSQTIKKNATHISALEEHNIHPDKIFTPAMLIQRREDMDKESEQTNRQSSLTPISYRNF
Sbjct: 1274 YDSKFVNSQNNVVWSPPHMDNSLKIMHSELANMYILKPLENTGLSECVIPTKNYQTKTIFKKWDEKNYIVKDELILPSTDHADMNRIKKRKLSNDFQMDFPTYPNSHQKKRKILSNRRYFTENEIESDQHNIKMRLKNEKGNDSELQAVEQKDILDIKKLSPVLGEVFHSETHTSNQNIPNNAGILADNKCHFVILYSNDGTIKINLHRPFYCKEGLKTLKIKRQHIGIGTLNNLSTKPNLVAGSNIPNYSLQQKALQNQRGQLFISAKIDSCSDSTVQTNGENEYEKLPEWNIHEEAVLYQNISHYQDHQFSINITENSNSLPNFKICEHYLNFYSITNTHRSNEICKIHFNKLQMGFQSHNKGENSLSRINRNSNLATSTGVLKVRTVNESRPVIGGVTGRKLKIKMKNSIGTYGTSIFGSTQAMTNKIKMFQNFLYDRKVNLTKTNQIVNSCLNSFDSKTTMTFKMLDEVVNTSKLPSLLPSHSQTIKKNATHISALEEHNIHPDKIFTPAMLIQRREDMDKESEQTNRQSSLTPISYRNF 1817          

HSP 3 Score: 217.238 bits (552), Expect = 4.174e-56
Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 3
Query: 5526 ESNTINTSSHSLNHIRRNSSNITSGQNLYSLQSTANNQIIARARYNVPINRQLSGSTAIHQPXXXXXXXXXXXXXXXXXMGCRSQALQFQIQHTRNTLPRKTPSQLFRDFILEMCIISHHFVTII 5900
            ESNTINTSSHSLNHIRRNSSNITSGQNLYSLQSTANNQIIARARYNVPINRQLSGSTAIHQPNQNSVIASSSNSSQNHNMGCRSQALQFQIQHTRNTLPRKTPSQLFRDFILEMCIISHHFVTII
Sbjct: 1818 ESNTINTSSHSLNHIRRNSSNITSGQNLYSLQSTANNQIIARARYNVPINRQLSGSTAIHQPNQNSVIASSSNSSQNHNMGCRSQALQFQIQHTRNTLPRKTPSQLFRDFILEMCIISHHFVTII 1942          
BLAST of Helicase domino vs. Planmine SMEST
Match: SMESG000031692.1 (SMESG000031692.1)

HSP 1 Score: 2440.23 bits (6323), Expect = 0.000e+0
Identity = 1252/1273 (98.35%), Postives = 1253/1273 (98.43%), Query Frame = 2
Query:   35 MNSLNLLNIFHFQNDFKYKFGPDSLNDIVLTKDKLCLPKPCNVLKNIYQYKKLRKRSISSGRQLNYFKRLKKVQDEQCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFSEKQTDCRLGSIFELPTENSSMDICQYWXXXXXXXXXXXXXXDYFYKSDSESLCSFNSTNSHTSVMLSDDHFNFRDDLSIDFSDGNTPTDELIDELNWLECDIKINETETNFSFEKEINELKILSQIPLEKIIDENYFNTDQYELKSESLSEIDLESVASENTDTVLSIKPSFIVSQSEKIQNVLNIPNTEMKNLGVFENIFKNESFNRNFQVIYELIKIKCSFSILSSMKCGDDRXXXXXXXXXXXXXXQYPSFELIVTNTSRIYEWKMLFSALSSPRQLIIFDSYVSLKDASEALKNVDXXXXXXXXXXYSVLPIFNLASVKWSNIIYDQIEKICEYSSNTIHLSTLDLYGARIGLISEHNDLFNQEGSSNIFLRLFYSSLQIEEFINEIQHSKILDKLTVLMNHCIPLEKIFDFEHVYKIVMCKLSPFQNSLHKYTLAKLRRSLETKSLLNSIEAICQDIQLSQHPFCFESYDNEETEMLKSLNKQHYLLKNSTYFLPNSDILSIYLPRKVFMTFLTLKDEKYSKSSNCILPHNNSAIFSYTKYERLQMKNLLISMSNIDNSMNELAFYLADVDDKHDQYFNKNINSNVNGNQGFLTSIEIDKLIDEYNIFNKNEVHNMIKNIDLESQLEPHNRERDSQLSSTLAARRSKTKFKSRLTSISKENEKYIILLDCSDINYLTSNLFMVDINYLSNELGCLDKLFSITKRYIEITWHKYIIIQPKVIARSPKITYSGKSKLQNQNENNLVNSISLVFQSYLNKLPTNTIKEYSYGQEELGLSGKLDTLNSILINLSKDLKLETCIIISHSFELLNLIEALIYINDNYGSFMRFRFSSYAGMNDRNTLNFISRFNKFQLRHKKTILLLHSRINYEFLIQLNIRSCAVVIADAHWQIDSDQSILNLINRLGLNCLLSQGNGISSIYKLCCLETLEQYFLRNDLSFLCENSYNNKDNISTTSAIICSNSIFKCFIDNVLSPIKEEFISVYCTEDLQKKDKLTKLSNQSVKDLLNSFVNPYDLLQLCHNQFTKNKFKNLSEYYVNKDKLNYRLVNLKEALQNWQNNLYKRQKKLKHLLNFFEDQGFFCF 3853
            MNSLNLLNIFHFQNDFKYKFGPDSLNDIVLTKDKLCLPKPCNVLKNIYQYKKLRKRSISSGRQLNYFKRLKKVQDEQCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFSEKQTDCRLGSIFELPTENSSMDICQYWISSNLISSENNENSDYFYKSDSESLCSFNSTNSHTSVMLSDDHFNFRDDLSIDFSDGNTPTDELIDELNWLECDIKINETETNFSFEKEINELKILSQIPLEKIIDENYFNTDQYELKSESLSEIDLESVASENTDTVLSIKPSFIVSQSEKIQNVLNIPNTEMKNLGVFENIFKNESFNRNFQVIYELIKIKCSFSILSSMKCGDDRLIISVLLSILPIELQYPSFELIVTNTSRIYEWKMLFSALSSPRQLIIFDSYVSLKDASEALKNVDCCESSICIISYSVLPIFNLASVKWSNIIYDQIEKICEYSSNTIHLSTLDLYGARIGLISEHNDLFNQEGSSNIFLRLFYSSLQIEEFINEIQHSKILDKLTVLMNHCIPLEKIFDFEHVYKIVMCKLSPFQNSLHKYTLAKLRRSLETKSLLNSIEAICQDIQLSQHPFCFESYDNEETEMLKSLNKQHYLLKNSTYFLPNSDILSIYLPRKVFMTFLTLKDE                  +YTKYERLQMKNLLISMSNIDNSMNELAFYLADVDDKHDQYFNKNINSNVNGNQGFLTSIEIDKLIDEYNIFNKNEVHNMIKNIDLESQLEPHNRERDSQLSSTLAARRSKTKFKSRLTSISKENEKYIILLDCSDINYLTSNLFMVDINYLSNELGCLDKLFSITKRYIEITWHKYIIIQPKVIARSPKITYSGKSKLQNQNENNLVNSISLVFQSYLNKLPTNTIKEYSYGQEELGLSGKLDTLNSILINLSKDLKLETCIIISHSFELLNLIEALIYINDNYGSFMRFRFSSYAGMNDRNTLNFISRFNKFQLRHKKTILLLHSRINYEFLIQLNIRSCAVVIADAHWQIDSDQSILNLINRLGLNCLLSQGNGISSIYKLCCLETLEQYFLRNDLSFLCENSYNNKDNISTTSAIICSNSIFKCFIDNVLSPIKEEFISVYCTEDLQKKDKLTKLSNQSVKDLLNSFVNPYDLLQLCHNQFTKNKFKNLSEYYVNKDKLNYRLVNLKEALQNWQNNLYKRQKKLKHLLNFFEDQGF  F
Sbjct:    1 MNSLNLLNIFHFQNDFKYKFGPDSLNDIVLTKDKLCLPKPCNVLKNIYQYKKLRKRSISSGRQLNYFKRLKKVQDEQCVSDALQEATVLEKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHWKISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFSEKQTDCRLGSIFELPTENSSMDICQYWISSNLISSENNENSDYFYKSDSESLCSFNSTNSHTSVMLSDDHFNFRDDLSIDFSDGNTPTDELIDELNWLECDIKINETETNFSFEKEINELKILSQIPLEKIIDENYFNTDQYELKSESLSEIDLESVASENTDTVLSIKPSFIVSQSEKIQNVLNIPNTEMKNLGVFENIFKNESFNRNFQVIYELIKIKCSFSILSSMKCGDDRLIISVLLSILPIELQYPSFELIVTNTSRIYEWKMLFSALSSPRQLIIFDSYVSLKDASEALKNVDCCESSICIISYSVLPIFNLASVKWSNIIYDQIEKICEYSSNTIHLSTLDLYGARIGLISEHNDLFNQEGSSNIFLRLFYSSLQIEEFINEIQHSKILDKLTVLMNHCIPLEKIFDFEHVYKIVMCKLSPFQNSLHKYTLAKLRRSLETKSLLNSIEAICQDIQLSQHPFCFESYDNEETEMLKSLNKQHYLLKNSTYFLPNSDILSIYLPRKVFMTFLTLKDE------------------NYTKYERLQMKNLLISMSNIDNSMNELAFYLADVDDKHDQYFNKNINSNVNGNQGFLTSIEIDKLIDEYNIFNKNEVHNMIKNIDLESQLEPHNRERDSQLSSTLAARRSKTKFKSRLTSISKENEKYIILLDCSDINYLTSNLFMVDINYLSNELGCLDKLFSITKRYIEITWHKYIIIQPKVIARSPKITYSGKSKLQNQNENNLVNSISLVFQSYLNKLPTNTIKEYSYGQEELGLSGKLDTLNSILINLSKDLKLETCIIISHSFELLNLIEALIYINDNYGSFMRFRFSSYAGMNDRNTLNFISRFNKFQLRHKKTILLLHSRINYEFLIQLNIRSCAVVIADAHWQIDSDQSILNLINRLGLNCLLSQGNGISSIYKLCCLETLEQYFLRNDLSFLCENSYNNKDNISTTSAIICSNSIFKCFIDNVLSPIKEEFISVYCTEDLQKKDKLTKLSNQSVKDLLNSFVNPYDLLQLCHNQFTKNKFKNLSEYYVNKDKLNYRLVNLKEALQNWQNNLYKRQKKLKHLLNFFEDQGFLLF 1255          

HSP 2 Score: 1102.04 bits (2849), Expect = 0.000e+0
Identity = 544/544 (100.00%), Postives = 544/544 (100.00%), Query Frame = 1
Query: 3853 YDSKFVNSQNNVVWSPPHMDNSLKIMHSELANMYILKPLENTGLSECVIPTKNYQTKTIFKKWDEKNYIVKDELILPSTDHADMNRIKKRKLSNDFQMDFPTYPNSHQKKRKILSNRRYFTENEIESDQHNIKMRLKNEKGNDSELQAVEQKDILDIKKLSPVLGEVFHSETHTSNQNIPNNAGILADNKCHFVILYSNDGTIKINLHRPFYCKEGLKTLKIKRQHIGIGTLNNLSTKPNLVAGSNIPNYSLQQKALQNQRGQLFISAKIDSCSDSTVQTNGENEYEKLPEWNIHEEAVLYQNISHYQDHQFSINITENSNSLPNFKICEHYLNFYSITNTHRSNEICKIHFNKLQMGFQSHNKGEXXXXXXXXXXXXATSTGVLKVRTVNESRPVIGGVTGRKLKIKMKNSIGTYGTSIFGSTQAMTNKIKMFQNFLYDRKVNLTKTNQIVNSCLNSFDSKTTMTFKMLDEVVNTSKLPSLLPSHSQTIKKNATHISALEEHNIHPDKIFTPAMLIQRREDMDKESEQTNRQSSLTPISYRNF 5484
            YDSKFVNSQNNVVWSPPHMDNSLKIMHSELANMYILKPLENTGLSECVIPTKNYQTKTIFKKWDEKNYIVKDELILPSTDHADMNRIKKRKLSNDFQMDFPTYPNSHQKKRKILSNRRYFTENEIESDQHNIKMRLKNEKGNDSELQAVEQKDILDIKKLSPVLGEVFHSETHTSNQNIPNNAGILADNKCHFVILYSNDGTIKINLHRPFYCKEGLKTLKIKRQHIGIGTLNNLSTKPNLVAGSNIPNYSLQQKALQNQRGQLFISAKIDSCSDSTVQTNGENEYEKLPEWNIHEEAVLYQNISHYQDHQFSINITENSNSLPNFKICEHYLNFYSITNTHRSNEICKIHFNKLQMGFQSHNKGENSLSRINRNSNLATSTGVLKVRTVNESRPVIGGVTGRKLKIKMKNSIGTYGTSIFGSTQAMTNKIKMFQNFLYDRKVNLTKTNQIVNSCLNSFDSKTTMTFKMLDEVVNTSKLPSLLPSHSQTIKKNATHISALEEHNIHPDKIFTPAMLIQRREDMDKESEQTNRQSSLTPISYRNF
Sbjct: 1256 YDSKFVNSQNNVVWSPPHMDNSLKIMHSELANMYILKPLENTGLSECVIPTKNYQTKTIFKKWDEKNYIVKDELILPSTDHADMNRIKKRKLSNDFQMDFPTYPNSHQKKRKILSNRRYFTENEIESDQHNIKMRLKNEKGNDSELQAVEQKDILDIKKLSPVLGEVFHSETHTSNQNIPNNAGILADNKCHFVILYSNDGTIKINLHRPFYCKEGLKTLKIKRQHIGIGTLNNLSTKPNLVAGSNIPNYSLQQKALQNQRGQLFISAKIDSCSDSTVQTNGENEYEKLPEWNIHEEAVLYQNISHYQDHQFSINITENSNSLPNFKICEHYLNFYSITNTHRSNEICKIHFNKLQMGFQSHNKGENSLSRINRNSNLATSTGVLKVRTVNESRPVIGGVTGRKLKIKMKNSIGTYGTSIFGSTQAMTNKIKMFQNFLYDRKVNLTKTNQIVNSCLNSFDSKTTMTFKMLDEVVNTSKLPSLLPSHSQTIKKNATHISALEEHNIHPDKIFTPAMLIQRREDMDKESEQTNRQSSLTPISYRNF 1799          

HSP 3 Score: 263.462 bits (672), Expect = 3.749e-70
Identity = 186/228 (81.58%), Postives = 197/228 (86.40%), Query Frame = 3
Query: 5526 ESNTINTSSHSLNHIRRNSSNITSGQNLYSLQSTANNQIIARARYNVPINRQLSGSTAIHQPXXXXXXXXXXXXXXXXXMGCRSQALQFQIQHTRNTLPRKTPSQLFRDFILEMCIISHHFVTII**TEVQLRLSDLLFRLYVFINFLKKLIFKXXXXXXXXXXXXXXXXXXXFPNSHDQNSTAITRTVERNSNFNLSCQIRAPSVRTNVTTVASTNRANQIPRMLHV 6209
            ESNTINTSSHSLNHIRRNSSNITSGQNLYSLQSTANNQIIARARYNVPINRQLSGSTAIHQPNQNSVIASSSNSSQNHNMGCRSQALQFQIQHTRNTLPRKTPSQ     +    +  H+F +        LR ++++ R      F++ +I  VVNQSNNQNTSTNNSIITVFPNSHDQNSTAITRTVERNSNFNLSCQIRAPSVRTNVTTVASTNRANQIPRMLHV
Sbjct: 1800 ESNTINTSSHSLNHIRRNSSNITSGQNLYSLQSTANNQIIARARYNVPINRQLSGSTAIHQPNQNSVIASSSNSSQNHNMGCRSQALQFQIQHTRNTLPRKTPSQPVIQRLYPGNV--HNFSS--------LRHNNIINRSAA--AFVRPIIPTVVNQSNNQNTSTNNSIITVFPNSHDQNSTAITRTVERNSNFNLSCQIRAPSVRTNVTTVASTNRANQIPRMLHV 2015          

HSP 4 Score: 76.6406 bits (187), Expect = 2.819e-13
Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 2
Query: 5840 IIQRLYPGNVHNFSSLRHNNIINRSAAAFVRPIIPTV 5950
            +IQRLYPGNVHNFSSLRHNNIINRSAAAFVRPIIPTV
Sbjct: 1906 VIQRLYPGNVHNFSSLRHNNIINRSAAAFVRPIIPTV 1942          
BLAST of Helicase domino vs. Planmine SMEST
Match: SMESG000073986.1 (SMESG000073986.1)

HSP 1 Score: 56.225 bits (134), Expect = 2.949e-7
Identity = 42/99 (42.42%), Postives = 53/99 (53.54%), Query Frame = -2
Query: 6353 IN*TRNQKIFIPRYVYEFLEQIVMDIACMEI--*KNC***LIV*VNRFHSPQS*SKMKKQFSR------LHNWNYRFGKLKDILT-RASNFEGEFSRDY 6622
            I+  R ++I +PR    FLEQIV+DIA ME    KNC   +IV +NRF    S S    Q         L+NW YRFG+ + ILT R   FEG    D+
Sbjct:  342 IDQGRAKEILLPRTRKRFLEQIVVDIAYMETKESKNC---MIVIINRFSKLVSLSAASTQDEATILNVILNNWIYRFGRPESILTDRGRIFEGSMFHDW 437          
BLAST of Helicase domino vs. Planmine SMEST
Match: SMESG000081439.1 (SMESG000081439.1)

HSP 1 Score: 54.6842 bits (130), Expect = 7.869e-7
Identity = 41/97 (42.27%), Postives = 51/97 (52.58%), Query Frame = -2
Query: 6353 IN*TRNQKIFIPRYVYEFLEQIVMDIACMEI*KNC***LIV*VNRFHSPQS*SKMKKQFSR------LHNWNYRFGKLKDILT-RASNFEGEFSRDY 6622
            I+  R ++I +PR    FLEQIV DIA ME  K     +IV ++RF      S    Q         L+NW YRFGKL+ ILT R   FEG   RD+
Sbjct:  343 IDQGRTKEILLPRTGERFLEQIVGDIAFMET-KESKKYMIVIIDRFSKLVCLSAASTQNEATILNVILNNWIYRFGKLESILTDRGRIFEGSMFRDW 438          
The following BLAST results are available for this feature:
BLAST of Helicase domino vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EP4001.100e-938.57E1A binding protein p400 [Source:HGNC Symbol;Acc:H... [more]
EP4002.015e-939.66E1A binding protein p400 [Source:HGNC Symbol;Acc:H... [more]
EP4002.323e-939.66E1A binding protein p400 [Source:HGNC Symbol;Acc:H... [more]
AC106886.67.196e-940.63novel transcript[more]
SRCAP7.233e-940.63Snf2 related CREBBP activator protein [Source:HGNC... [more]
back to top
BLAST of Helicase domino vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ssl-15.193e-1435.48Helicase ssl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
ssl-15.270e-1435.48Helicase ssl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
ssl-15.678e-1435.48Helicase ssl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
back to top
BLAST of Helicase domino vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dom4.943e-1050.98gene:FBgn0020306 transcript:FBtr0342890[more]
dom5.552e-1050.98gene:FBgn0020306 transcript:FBtr0071602[more]
dom5.601e-1050.98gene:FBgn0020306 transcript:FBtr0071603[more]
dom1.939e-950.98gene:FBgn0020306 transcript:FBtr0071604[more]
back to top
BLAST of Helicase domino vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ep4001.406e-935.80E1A binding protein p400 [Source:ZFIN;Acc:ZDB-GENE... [more]
ep4001.536e-935.80E1A binding protein p400 [Source:ZFIN;Acc:ZDB-GENE... [more]
srcap2.481e-627.03Snf2-related CREBBP activator protein [Source:ZFIN... [more]
srcap5.237e-627.03Snf2-related CREBBP activator protein [Source:ZFIN... [more]
back to top
BLAST of Helicase domino vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mlnr1.001e-1231.15motilin receptor [Source:Xenbase;Acc:XB-GENE-94065... [more]
mlnr2.937e-1134.00motilin receptor [Source:Xenbase;Acc:XB-GENE-94065... [more]
mlnr3.350e-1134.00motilin receptor [Source:Xenbase;Acc:XB-GENE-94065... [more]
mlnr3.565e-1134.00motilin receptor [Source:Xenbase;Acc:XB-GENE-94065... [more]
mlnr3.676e-1134.00motilin receptor [Source:Xenbase;Acc:XB-GENE-94065... [more]
back to top
BLAST of Helicase domino vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Srcap1.857e-934.52Snf2-related CREBBP activator protein [Source:MGI ... [more]
Srcap2.186e-939.39Snf2-related CREBBP activator protein [Source:MGI ... [more]
Ep4002.349e-938.57E1A binding protein p400 [Source:MGI Symbol;Acc:MG... [more]
Ep4002.356e-938.57E1A binding protein p400 [Source:MGI Symbol;Acc:MG... [more]
Ep4002.359e-938.57E1A binding protein p400 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Helicase domino vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NEL2|SSL1_CAEEL6.606e-1335.48Helicase ssl-1 OS=Caenorhabditis elegans OX=6239 G... [more]
sp|Q96L91|EP400_HUMAN5.288e-938.57E1A-binding protein p400 OS=Homo sapiens OX=9606 G... [more]
sp|Q9NDJ2|DOM_DROME5.615e-950.98Helicase domino OS=Drosophila melanogaster OX=7227... [more]
sp|Q8CHI8|EP400_MOUSE1.652e-838.57E1A-binding protein p400 OS=Mus musculus OX=10090 ... [more]
sp|Q6ZRS2|SRCAP_HUMAN3.473e-840.63Helicase SRCAP OS=Homo sapiens OX=9606 GN=SRCAP PE... [more]
back to top
BLAST of Helicase domino vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PN172.282e-1536.61HSA domain-containing protein OS=Schistocephalus s... [more]
A0A5K3F9V61.745e-1436.28Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3U4K81.861e-1436.28Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3F9K71.865e-1436.28Uncharacterized protein OS=Mesocestoides corti OX=... [more]
R7UBK61.222e-1346.05HSA domain-containing protein OS=Capitella teleta ... [more]
back to top
BLAST of Helicase domino vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ep4008.922e-1229.81E1A binding protein p400 [Source:ZFIN;Acc:ZDB-GENE... [more]
srcap1.280e-635.94Snf2-related CREBBP activator protein [Source:ZFIN... [more]
back to top
BLAST of Helicase domino vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000882.11.671e-936.90pep scaffold:Pmarinus_7.0:GL478495:191085:195963:-... [more]
back to top
BLAST of Helicase domino vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Helicase domino vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Helicase domino vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ep4004.120e-1122.78E1A binding protein p400 [Source:NCBI gene;Acc:101... [more]
srcap2.573e-727.93Snf2 related CREBBP activator protein [Source:NCBI... [more]
back to top
BLAST of Helicase domino vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031692.15.656e-7099.84SMESG000031692.1[more]
SMESG000031692.14.174e-5699.84SMESG000031692.1[more]
SMESG000031692.13.749e-7098.35SMESG000031692.1[more]
SMESG000073986.12.949e-742.42SMESG000073986.1[more]
SMESG000081439.17.869e-742.27SMESG000081439.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026756 ID=SMED30026756|Name=Helicase domino|organism=Schmidtea mediterranea sexual|type=transcript|length=6722bp
TATAATTGTAATGGGGGATTTGAAGTCTTACAAAATGAATTCTTTGAATT
TATTAAATATCTTTCATTTTCAAAATGACTTTAAGTATAAATTTGGTCCT
GATAGTCTAAATGATATCGTATTGACTAAAGATAAACTTTGTTTGCCCAA
GCCATGTAATGTTTTGAAAAATATTTATCAATATAAGAAATTGAGAAAAC
GTTCAATAAGTTCTGGAAGACAATTAAATTATTTTAAAAGATTAAAAAAA
GTTCAAGATGAGCAATGTGTTAGTGATGCCTTGCAAGAAGCAACTGTACT
TGAAAAAATATCAACAATGAAAAAAAATGGAATATGGACAAGAGAAGCTT
TACCTAAGGTAATGGAACCAAATAGAAATAAAGCTTATTGGGATTTCGTT
TTGGAAGAGTTTGAATGGTTGGCAATTGACCGTATTAATCGTTTGCATTG
GAAAATATCAGCTGCTAGAATTATTGCAGAAAATGCAAAAACCTATGTAC
TTATGAAAGATGAAATTAAATCACTTGAATTTCTTCAATTACAAGATGAA
GCTAGGCTACATTGCTCAAGAATTTCAAATATGATAAAAGCTTGGTTTAG
TGAAAAACAAACTGACTGCAGATTGGGTTCCATATTCGAATTACCAACTG
AAAATTCTTCAATGGATATTTGTCAATATTGGATATCTTCGAACCTTATA
TCATCAGAAAATAATGAGAATTCAGATTATTTTTATAAGTCTGATAGTGA
AAGTTTATGTTCATTCAATTCAACTAACTCGCATACCTCTGTCATGCTCT
CTGATGATCATTTCAACTTCAGAGATGATTTATCGATTGACTTTAGTGAT
GGAAATACGCCAACAGATGAACTAATAGATGAATTAAATTGGTTGGAGTG
TGATATTAAAATAAATGAAACTGAGACAAATTTTTCTTTTGAAAAAGAAA
TCAACGAATTGAAAATTCTATCACAGATACCATTGGAAAAGATTATCGAT
GAAAATTATTTTAATACAGATCAATATGAACTAAAATCCGAATCACTTTC
AGAGATTGATTTAGAATCAGTTGCATCAGAAAATACTGATACAGTTTTGA
GTATTAAACCTAGCTTTATAGTATCTCAGAGTGAAAAAATACAAAATGTA
TTGAATATTCCAAATACTGAAATGAAAAATTTGGGAGTTTTTGAGAATAT
ATTTAAAAATGAATCGTTTAACCGTAATTTTCAAGTTATTTACGAATTAA
TTAAAATTAAATGTTCCTTTTCGATATTGAGTTCCATGAAGTGTGGGGAT
GATAGATTAATAATTTCAGTGCTTTTGTCCATATTACCCATTGAATTACA
ATATCCATCATTTGAACTAATTGTTACAAATACTTCTCGAATATATGAAT
GGAAAATGCTATTTTCCGCTTTATCTTCGCCACGACAATTAATTATTTTT
GATTCATACGTTTCATTGAAAGATGCATCTGAAGCTCTTAAAAATGTTGA
TTGTTGTGAATCATCAATCTGTATTATAAGTTATAGTGTCCTACCAATCT
TTAATTTAGCATCTGTAAAATGGAGCAACATTATTTACGATCAGATTGAA
AAAATATGTGAATATTCTTCTAACACAATTCATCTTTCAACACTTGATTT
ATATGGTGCTCGAATAGGACTTATTTCGGAACATAATGATTTATTCAATC
AAGAGGGATCATCAAATATATTTCTTCGATTATTTTATTCTTCATTACAA
ATTGAAGAATTTATAAATGAAATTCAACATTCAAAAATTTTAGATAAACT
TACGGTATTAATGAATCATTGTATTCCACTTGAAAAGATATTTGATTTCG
AACATGTGTATAAAATTGTTATGTGCAAACTTAGTCCATTTCAAAATAGT
CTTCATAAATACACATTAGCCAAATTAAGACGATCTCTTGAAACAAAGAG
TCTCTTAAATTCAATCGAAGCTATATGTCAGGATATTCAATTAAGTCAAC
ATCCATTTTGTTTCGAAAGTTATGACAATGAAGAGACAGAAATGTTAAAG
TCATTAAACAAACAACATTATCTTTTAAAAAACTCAACTTATTTTCTGCC
AAATAGTGACATATTGTCAATCTATTTGCCGAGGAAAGTTTTCATGACAT
TTCTAACCCTTAAAGATGAAAAGTACAGCAAATCCTCGAATTGCATATTA
CCACATAATAACTCCGCTATATTTAGTTATACTAAATATGAAAGATTACA
AATGAAAAATTTACTTATTTCTATGTCAAACATAGATAATTCAATGAATG
AACTAGCGTTTTATTTAGCAGACGTAGACGATAAACACGATCAATATTTC
AATAAAAATATTAATTCAAATGTTAATGGAAATCAAGGATTTCTTACTTC
TATTGAAATAGATAAATTGATAGACGAATATAACATTTTTAATAAAAATG
AAGTTCATAATATGATAAAAAATATTGATTTGGAATCCCAGTTGGAACCT
CATAATCGTGAAAGAGATTCTCAATTATCCTCTACGCTTGCAGCTCGTAG
ATCTAAAACAAAATTTAAGTCACGTCTTACTAGTATATCCAAAGAAAATG
AAAAGTATATTATATTGCTAGATTGTAGTGATATTAACTATTTAACTTCT
AATTTGTTCATGGTTGATATAAATTACTTGTCAAATGAGCTGGGTTGTTT
GGATAAGCTCTTTTCAATTACTAAGAGATATATTGAAATTACATGGCATA
AATATATTATAATTCAGCCAAAAGTTATTGCCCGATCTCCTAAAATAACT
TACAGTGGAAAATCAAAACTGCAAAATCAAAATGAAAATAACTTGGTTAA
CTCTATAAGCTTAGTGTTTCAATCATATTTAAATAAATTACCAACAAATA
CTATAAAAGAATATAGCTATGGACAGGAAGAATTAGGTTTATCTGGAAAG
TTGGATACTCTTAATTCTATTTTAATAAATTTGTCAAAAGATTTGAAACT
AGAGACTTGCATCATAATTTCACACAGTTTTGAATTGTTGAATTTAATTG
AAGCTTTGATATATATAAATGATAATTACGGTTCATTTATGCGATTTAGA
TTTAGTTCTTATGCAGGAATGAATGACCGAAATACTTTAAATTTTATTAG
CAGATTTAATAAATTTCAATTACGACATAAAAAAACCATTTTATTGTTGC
ATTCTCGAATTAATTATGAATTTTTGATTCAATTAAATATAAGATCGTGT
GCTGTAGTAATAGCGGATGCACATTGGCAGATCGATTCTGATCAATCAAT
TCTTAACTTGATTAATAGACTGGGACTTAATTGTTTATTGTCTCAAGGAA
ACGGGATATCTTCGATTTATAAATTATGTTGTTTGGAAACCTTAGAACAA
TATTTCCTAAGAAATGATCTTTCTTTTCTATGTGAAAATTCATATAATAA
TAAAGACAATATTTCTACAACATCGGCAATAATTTGTTCAAATTCGATAT
TTAAATGCTTTATTGATAATGTACTCTCACCTATCAAAGAAGAATTTATT
AGTGTTTATTGTACAGAGGATTTGCAAAAAAAAGACAAATTAACAAAACT
TTCCAATCAATCTGTTAAAGATCTATTGAATAGTTTCGTAAATCCTTATG
ATTTATTGCAGCTTTGTCATAATCAATTTACTAAAAATAAATTTAAAAAT
TTATCAGAATATTATGTGAACAAAGACAAATTAAATTATAGATTAGTTAA
TTTAAAAGAAGCATTGCAAAACTGGCAGAATAATCTTTATAAAAGACAGA
AAAAATTAAAACATTTATTAAATTTTTTTGAAGATCAAGGTTTTTTTTGT
TTTATGATTCTAAATTTGTGAATTCCCAAAATAATGTGGTTTGGAGTCCT
CCTCATATGGATAATTCTTTAAAAATTATGCATAGTGAATTAGCTAATAT
GTACATTTTAAAACCTCTGGAAAATACAGGACTTTCAGAATGCGTAATTC
CAACAAAAAATTACCAAACAAAAACAATTTTTAAAAAATGGGATGAAAAA
AATTATATTGTTAAAGATGAACTCATTTTGCCCTCAACTGACCACGCAGA
TATGAATCGAATAAAAAAAAGAAAGCTTTCAAATGATTTTCAAATGGATT
TCCCTACGTATCCTAATAGTCATCAAAAAAAAAGAAAGATACTCAGTAAC
AGACGATATTTTACTGAAAATGAAATAGAATCTGATCAGCATAACATTAA
AATGAGACTGAAAAATGAAAAAGGAAATGATTCTGAATTACAAGCCGTTG
AGCAAAAAGATATATTAGATATTAAAAAATTGTCTCCTGTTCTCGGAGAA
GTATTTCATAGCGAAACTCATACTTCAAATCAAAATATTCCAAATAATGC
TGGAATACTTGCTGATAATAAATGCCATTTTGTCATTTTATACAGTAATG
ATGGGACAATAAAAATAAACTTGCATAGACCGTTTTATTGTAAAGAAGGA
TTAAAAACTCTTAAAATAAAAAGGCAACATATTGGAATAGGAACTCTGAA
TAATTTGTCGACAAAACCAAATTTAGTGGCTGGTTCAAATATACCTAATT
ACAGTTTGCAGCAAAAGGCGCTTCAAAACCAAAGAGGACAATTATTTATA
AGTGCGAAGATTGACAGTTGTTCGGATTCTACCGTTCAAACTAATGGCGA
AAATGAGTATGAAAAACTACCAGAATGGAATATTCACGAAGAAGCAGTTT
TATATCAGAATATAAGTCATTATCAAGATCATCAATTTTCAATAAATATA
ACTGAAAATTCTAATTCCTTGCCAAATTTTAAAATTTGCGAACATTATTT
GAATTTTTACTCGATTACAAATACTCATCGCAGTAATGAAATCTGTAAAA
TACACTTTAATAAATTACAAATGGGATTTCAAAGTCATAACAAAGGTGAA
AATAGTCTTTCTCGCATAAACCGGAATTCTAATTTAGCAACATCCACTGG
AGTTTTAAAAGTTCGTACTGTCAATGAGAGTAGACCAGTTATTGGGGGCG
TTACAGGTCGGAAATTAAAAATTAAAATGAAGAATTCCATTGGTACATAT
GGTACATCCATTTTTGGAAGTACCCAAGCTATGACAAATAAGATTAAAAT
GTTTCAGAATTTTTTATATGATCGAAAAGTAAATCTAACAAAAACAAATC
AAATTGTTAACAGTTGCCTTAATTCATTCGATAGCAAAACAACTATGACT
TTTAAGATGCTAGATGAAGTTGTGAATACTAGTAAACTTCCATCGTTGCT
TCCAAGTCATAGTCAAACCATTAAAAAGAATGCCACACATATTAGTGCTC
TTGAAGAACATAATATACATCCAGATAAAATTTTTACACCAGCTATGCTA
ATTCAAAGAAGAGAAGATATGGATAAAGAATCGGAACAAACTAATCGTCA
ATCAAGTTTAACACCTATATCATATCGCAATTTTGTAAGAATAGAATTTT
TTTATTTTACAATAAAACATTATAGGAATCAAATACAATTAACACATCCT
CTCACTCACTAAATCATATTAGGAGAAACTCGTCAAATATCACGAGTGGT
CAAAATCTATATTCTTTACAAAGTACTGCTAATAATCAGATTATAGCAAG
AGCACGTTATAACGTTCCAATAAATAGACAGTTATCTGGAAGTACAGCTA
TTCATCAGCCAAATCAAAATTCTGTTATAGCGTCAAGTTCTAATTCATCT
CAAAATCATAATATGGGTTGCAGAAGTCAAGCGCTCCAATTTCAAATTCA
ACATACCCGAAATACGTTACCTCGTAAAACGCCTAGTCAATTATTCAGAG
ACTTTATCCTGGAAATGTGCATAATTTCTCATCACTTCGTCACAATAATA
TAATAAACAGAAGTGCAGCTGCGTTTGTCAGACCTATTATTCCGACTGTA
TGTTTTTATTAATTTTTTAAAAAAACTTATTTTTAAGGTTGTTAATCAAT
CAAACAATCAAAATACTTCGACAAATAATTCGATAATAACTGTTTTTCCA
AATTCTCATGATCAAAATTCTACTGCTATAACAAGAACAGTAGAAAGAAA
TTCTAATTTTAACTTAAGTTGTCAAATTAGAGCCCCAAGTGTCCGTACTA
ATGTAACAACAGTGGCATCCACTAATCGTGCAAATCAAATTCCTAGAATG
CTTCATGTTAACCAAATTAATAGAAATAATATTAATATAAATAATTCATT
AAATCGTAATCAACAAGATCAATAGAAATATGTTATGTAAATATATTTCT
TAATTGTTTTATCGAATTTTAATTTCATATTCCTGCTTAATACCAAGTTT
TTGTAGTCTCTTGAAAATTCTCCTTCAAAATTCGAGGCCCTTGTCAATAT
GTCCTTTAGTTTTCCGAAACGATAATTCCAATTGTGAAGTCTTGAAAATT
GTTTCTTCATTTTGCTTCAGGATTGCGGTGAATGAAATCGGTTTACTTAA
ACGATCAACTATTACTAACAATTTTTTTATATCTCCATACACGCTATATC
CATAACAATTTGTTCCAGGAATTCATAGACATATCTAGGGATAAATATTT
TCTGGTTTCTTGTCTAGTTGATCACCTAGAACGGATATCACAACAACATA
GACTAAGCTGGATTGTCTCATGCATCTTCACATACTTCTTGATATAAGGT
TGTTGTTAATAAGCTTACAAAG
back to top

protein sequence of SMED30026756-orf-1

>SMED30026756-orf-1 ID=SMED30026756-orf-1|Name=SMED30026756-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1290bp
IIVMGDLKSYKMNSLNLLNIFHFQNDFKYKFGPDSLNDIVLTKDKLCLPK
PCNVLKNIYQYKKLRKRSISSGRQLNYFKRLKKVQDEQCVSDALQEATVL
EKISTMKKNGIWTREALPKVMEPNRNKAYWDFVLEEFEWLAIDRINRLHW
KISAARIIAENAKTYVLMKDEIKSLEFLQLQDEARLHCSRISNMIKAWFS
EKQTDCRLGSIFELPTENSSMDICQYWISSNLISSENNENSDYFYKSDSE
SLCSFNSTNSHTSVMLSDDHFNFRDDLSIDFSDGNTPTDELIDELNWLEC
DIKINETETNFSFEKEINELKILSQIPLEKIIDENYFNTDQYELKSESLS
EIDLESVASENTDTVLSIKPSFIVSQSEKIQNVLNIPNTEMKNLGVFENI
FKNESFNRNFQVIYELIKIKCSFSILSSMKCGDDRLIISVLLSILPIELQ
YPSFELIVTNTSRIYEWKMLFSALSSPRQLIIFDSYVSLKDASEALKNVD
CCESSICIISYSVLPIFNLASVKWSNIIYDQIEKICEYSSNTIHLSTLDL
YGARIGLISEHNDLFNQEGSSNIFLRLFYSSLQIEEFINEIQHSKILDKL
TVLMNHCIPLEKIFDFEHVYKIVMCKLSPFQNSLHKYTLAKLRRSLETKS
LLNSIEAICQDIQLSQHPFCFESYDNEETEMLKSLNKQHYLLKNSTYFLP
NSDILSIYLPRKVFMTFLTLKDEKYSKSSNCILPHNNSAIFSYTKYERLQ
MKNLLISMSNIDNSMNELAFYLADVDDKHDQYFNKNINSNVNGNQGFLTS
IEIDKLIDEYNIFNKNEVHNMIKNIDLESQLEPHNRERDSQLSSTLAARR
SKTKFKSRLTSISKENEKYIILLDCSDINYLTSNLFMVDINYLSNELGCL
DKLFSITKRYIEITWHKYIIIQPKVIARSPKITYSGKSKLQNQNENNLVN
SISLVFQSYLNKLPTNTIKEYSYGQEELGLSGKLDTLNSILINLSKDLKL
ETCIIISHSFELLNLIEALIYINDNYGSFMRFRFSSYAGMNDRNTLNFIS
RFNKFQLRHKKTILLLHSRINYEFLIQLNIRSCAVVIADAHWQIDSDQSI
LNLINRLGLNCLLSQGNGISSIYKLCCLETLEQYFLRNDLSFLCENSYNN
KDNISTTSAIICSNSIFKCFIDNVLSPIKEEFISVYCTEDLQKKDKLTKL
SNQSVKDLLNSFVNPYDLLQLCHNQFTKNKFKNLSEYYVNKDKLNYRLVN
LKEALQNWQNNLYKRQKKLKHLLNFFEDQGFFCFMILNL*
back to top

protein sequence of SMED30026756-orf-2

>SMED30026756-orf-2 ID=SMED30026756-orf-2|Name=SMED30026756-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=552bp
MDNSLKIMHSELANMYILKPLENTGLSECVIPTKNYQTKTIFKKWDEKNY
IVKDELILPSTDHADMNRIKKRKLSNDFQMDFPTYPNSHQKKRKILSNRR
YFTENEIESDQHNIKMRLKNEKGNDSELQAVEQKDILDIKKLSPVLGEVF
HSETHTSNQNIPNNAGILADNKCHFVILYSNDGTIKINLHRPFYCKEGLK
TLKIKRQHIGIGTLNNLSTKPNLVAGSNIPNYSLQQKALQNQRGQLFISA
KIDSCSDSTVQTNGENEYEKLPEWNIHEEAVLYQNISHYQDHQFSINITE
NSNSLPNFKICEHYLNFYSITNTHRSNEICKIHFNKLQMGFQSHNKGENS
LSRINRNSNLATSTGVLKVRTVNESRPVIGGVTGRKLKIKMKNSIGTYGT
SIFGSTQAMTNKIKMFQNFLYDRKVNLTKTNQIVNSCLNSFDSKTTMTFK
MLDEVVNTSKLPSLLPSHSQTIKKNATHISALEEHNIHPDKIFTPAMLIQ
RREDMDKESEQTNRQSSLTPISYRNFVRIEFFYFTIKHYRNQIQLTHPLT
H*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR004153CXCXC_repeat
IPR014012HSA_dom
Vocabulary: molecular function
TermDefinition
GO:0004386helicase activity
GO:0005524ATP binding
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1241..1268
NoneNo IPR availablePANTHERPTHR46459FAMILY NOT NAMEDcoord: 85..197
IPR014012Helicase/SANT-associated domainPROSITEPS51204HSAcoord: 117..191
score: 11.034