BTB domain containing 9

Overview
NameBTB domain containing 9
Smed IDSMED30026750
Length (bp)2854
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BTB domain containing 9 (SMED30026750) t-SNE clustered cells

Violin plots show distribution of expression levels for BTB domain containing 9 (SMED30026750) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BTB domain containing 9 (SMED30026750) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BTB domain containing 9 (SMED30026750) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026750

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30026750h1SMcG0004837 dd_Smed_v4_7778_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BTB domain containing 9 vs. Ensembl Human
Match: BTBD9 (BTB domain containing 9 [Source:HGNC Symbol;Acc:HGNC:21228])

HSP 1 Score: 372.474 bits (955), Expect = 7.572e-118
Identity = 191/391 (48.85%), Postives = 267/391 (68.29%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLETCHHSNETNAIEN 2724
            AL  ++ RDSF APE  IF A++ W + N    S++  ++I+  VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEEN+A  ++ A ++ G   +  +        +D     F  H I++  R  I I+LG PS IN IR+ L D + RSYSY ++VS+D++ WV V D+ +Y+CRSWQ LYF   V +YIRI+GT NTV + F ++ FEC++T+        + +P  NVA+I   A+VIEGVSRSRN+LLNG+TKNY+WDSGYTCHQLG+GAIVVQLAQPY++  IR LLWD DDRSYSY VEVST++ +W MVAD +   C S+Q++ F RQP  FIRI+GT+N+ANEVFH VH E C     +   EN
Sbjct:  117 ALLNIVLRDSFAAPEKDIFLALLNWCKHN----SKENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYFIEVSMDELDWVRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEKGLIVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFE-CPEQQSSQKEEN 499          
BLAST of BTB domain containing 9 vs. Ensembl Human
Match: BTBD9 (BTB domain containing 9 [Source:HGNC Symbol;Acc:HGNC:21228])

HSP 1 Score: 372.089 bits (954), Expect = 9.130e-117
Identity = 191/391 (48.85%), Postives = 267/391 (68.29%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLETCHHSNETNAIEN 2724
            AL  ++ RDSF APE  IF A++ W + N    S++  ++I+  VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEEN+A  ++ A ++ G   +  +        +D     F  H I++  R  I I+LG PS IN IR+ L D + RSYSY ++VS+D++ WV V D+ +Y+CRSWQ LYF   V +YIRI+GT NTV + F ++ FEC++T+        + +P  NVA+I   A+VIEGVSRSRN+LLNG+TKNY+WDSGYTCHQLG+GAIVVQLAQPY++  IR LLWD DDRSYSY VEVST++ +W MVAD +   C S+Q++ F RQP  FIRI+GT+N+ANEVFH VH E C     +   EN
Sbjct:  185 ALLNIVLRDSFAAPEKDIFLALLNWCKHN----SKENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYFIEVSMDELDWVRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEKGLIVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFE-CPEQQSSQKEEN 567          
BLAST of BTB domain containing 9 vs. Ensembl Human
Match: BTBD9 (BTB domain containing 9 [Source:HGNC Symbol;Acc:HGNC:21228])

HSP 1 Score: 372.089 bits (954), Expect = 9.130e-117
Identity = 191/391 (48.85%), Postives = 267/391 (68.29%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLETCHHSNETNAIEN 2724
            AL  ++ RDSF APE  IF A++ W + N    S++  ++I+  VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEEN+A  ++ A ++ G   +  +        +D     F  H I++  R  I I+LG PS IN IR+ L D + RSYSY ++VS+D++ WV V D+ +Y+CRSWQ LYF   V +YIRI+GT NTV + F ++ FEC++T+        + +P  NVA+I   A+VIEGVSRSRN+LLNG+TKNY+WDSGYTCHQLG+GAIVVQLAQPY++  IR LLWD DDRSYSY VEVST++ +W MVAD +   C S+Q++ F RQP  FIRI+GT+N+ANEVFH VH E C     +   EN
Sbjct:  185 ALLNIVLRDSFAAPEKDIFLALLNWCKHN----SKENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYFIEVSMDELDWVRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEKGLIVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFE-CPEQQSSQKEEN 567          
BLAST of BTB domain containing 9 vs. Ensembl Human
Match: BTBD9 (BTB domain containing 9 [Source:HGNC Symbol;Acc:HGNC:21228])

HSP 1 Score: 357.066 bits (915), Expect = 1.930e-111
Identity = 191/420 (45.48%), Postives = 267/420 (63.57%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVV-----------------------------QYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLETCHHSNETNAIEN 2724
            AL  ++ RDSF APE  IF A++ W + N    S++  ++I+  VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEEN+A  ++ A ++ G   +  +        +D     F  H I++  R  I I+LG PS IN IR+ L D + RSYSY ++VS+D++ WV V D+ +Y+CRSWQ LYF   V                              +YIRI+GT NTV + F ++ FEC++T+        + +P  NVA+I   A+VIEGVSRSRN+LLNG+TKNY+WDSGYTCHQLG+GAIVVQLAQPY++  IR LLWD DDRSYSY VEVST++ +W MVAD +   C S+Q++ F RQP  FIRI+GT+N+ANEVFH VH E C     +   EN
Sbjct:  126 ALLNIVLRDSFAAPEKDIFLALLNWCKHN----SKENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYFIEVSMDELDWVRVIDHSQYLCRSWQKLYFPARVCSGDGVSLWCPLWSRTPELKQSSLLGLPKCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEKGLIVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFE-CPEQQSSQKEEN 537          
BLAST of BTB domain containing 9 vs. Ensembl Human
Match: EXOSC7 (exosome component 7 [Source:HGNC Symbol;Acc:HGNC:28112])

HSP 1 Score: 151.369 bits (381), Expect = 4.713e-40
Identity = 83/276 (30.07%), Postives = 140/276 (50.72%), Query Frame = 1
Query:   43 MQNLMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVN-------------SSDANKELQFKFDNCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISSAVGMEMHKSL 816
            M ++ LS AEK++ +   Q++     +R+  RG   +R + +E          + V  G T +LV +  E  G P    P EGY++F +D S +   +   R  D+    I + L   +++   ++L  LCI+P + CW++YVD+L++EC GNL D +SI +  AL NT IP+V              S D    ++   +N P  VT+ KI  ++++DA  +EE C+    + ++   G + C    G+GS+   S+ EM++    VG  +H SL
Sbjct:    1 MASVTLSEAEKVYIVHGVQED-----LRVDGRGCEDYRCVEVETDVVSNTSGSARVKLGHTDILVGVKAEM-GTPKLEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVDLKTLCISPREHCWVLYVDVLLLECGGNLFDAISIAVKAALFNTRIPRVRVLEDEEGSKDIELSDDPYDCIRLSVENVPCIVTLCKIGYRHVVDATLQEEACSLASLLVSVTSKGVVTCMRKVGKGSLDPESIFEMMETGKRVGKVLHASL 270          
BLAST of BTB domain containing 9 vs. Ensembl Celegans
Match: hpo-9 (pep chromosome:WBcel235:V:7234922:7237130:-1 gene:WBGene00015463.1 transcript:C05C8.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:hpo-9)

HSP 1 Score: 254.988 bits (650), Expect = 6.204e-74
Identity = 150/379 (39.58%), Postives = 227/379 (59.89%), Query Frame = 1
Query: 1576 VIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAMENQL-KAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHV-DSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHL-LDLEGRSYSYIVDVSLDQ---ISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIR--HHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLET 2688
            ++ RDSF A E+ IF AV  W + N +   ++ +  +L LVRL LI+ ++LL  VRPTGLV+A+++LDA+E Q  +   +P RG             + +II   P A  +S+  +  +  D + S+F            I LG P  IN I M      E ++++Y V VS+D      W  V DY +Y CR  Q L+F   VV++I +I   N+++      + E +++           + +P+ N+ +IE+HA V+EGVSR RN+L+NG++ +Y+WD+GYTCHQ+G+G I++QLAQPYI++ +R LLW+ DDR YSY V VS ++ +WV + D ++E C  +Q L F   PVV+IR++GT NS NEVFH+VHLE 
Sbjct:  217 LLARDSFFALELKIFNAVRSWHQNNPT--MKEASKVLLELVRLPLITQTELLNCVRPTGLVSADTLLDAIEVQTQRPHEIPFRGC---------KSLDTNIIPHYPHAQPLSRELSSRYTNDENISVFQ-----------IDLGKPFIINTIMMDFNWKNEVQAFTYQVHVSMDNRVDAHWNLVADYSEYDCRGTQRLFFTDSVVRHI-LIRVNNSMSCKLEGSRIEAMFSTETMPVEPVHKVIVPHRNITTIENHARVVEGVSRCRNALINGDSSSYDWDTGYTCHQIGSGLIMIQLAQPYIISSMRILLWNCDDRFYSYYVAVSKNQDEWVTIVDRTNEECHGWQELIFDPLPVVYIRLVGTRNSINEVFHVVHLEA 572          
BLAST of BTB domain containing 9 vs. Ensembl Celegans
Match: exos-7 (EXOSome (Multiexonuclease complex) component [Source:UniProtKB/TrEMBL;Acc:G5EDS8])

HSP 1 Score: 80.8777 bits (198), Expect = 3.196e-16
Identity = 79/292 (27.05%), Postives = 126/292 (43.15%), Query Frame = 1
Query:   52 LMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGF-----NKSEVNAGDTR-VLVNINFE-----PDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDS-DII-NLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPK---------------------VNSSDANKEL-QFKFD--NCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAIL----------PNGDIKCTSTDGEGSVKTASLLEMLKISS 786
            + LS+ EKLF +  ++       IR   R    FR I +E G          V  G T  VL  I  E      + +  P  P    I F +D S    ++ + +  DEY E + +    AYS + DI+ NL+   +    + W I VDI V++ DG++ D +SI I  AL +   P+                      N  D N ++  +K D   CP+ +T++KI    L+D   EEE C  ++ +  +           PN D+ C    G G ++  S+ EML++++
Sbjct:    3 VHLSDDEKLFLITGAE-----ANIRNDGRSCQDFRQIILERGVLSGTNGSCRVQLGQTTDVLAGIKLELESYDAETEKEPKQP----INFNVDFSANASSQFAGKGGDEYAEELSAAFQAAYSKALDIMPNLAKTQLADGYR-WKINVDISVLQWDGSVSDAISIAIIGALSDLEFPEGDVAPDDGGKVRIVLKRPKVAGNVRDENVQVAMWKLDVMRCPLLLTISKIGTANLVDCTPEEECCIRSQLLVGLAAIADSSENNEPNYDVTCVKQVGGGLLEMESIQEMLELAA 284          
BLAST of BTB domain containing 9 vs. Ensembl Celegans
Match: exos-9 (EXOSome (Multiexonuclease complex) component [Source:UniProtKB/TrEMBL;Acc:Q8MNS7])

HSP 1 Score: 63.1586 bits (152), Expect = 4.785e-10
Identity = 51/185 (27.57%), Postives = 87/185 (47.03%), Query Frame = 1
Query:   58 LSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVG--FNKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSP-AIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANKELQFKFDNCPI 603
            ++N EK   L+A +   +F       R    FR + + VG     +    G+T+V+  ++ E   +P    P +G I   +DLSP A      +R   +  E I+ LL     DS  I++  LCI   K+ W I VD+ +++ DG+LLD   +   TAL++   P V     +  +  +++  P+
Sbjct:    6 VTNCEKAVILEALKIGKRF-----DFRSLEEFRDVKLVVGAEVGTAICTIGNTKVMAAVSAEI-AEPSSMRPHKGVINIDVDLSPMANYANEHDRLGSKGMELIR-LLELIIRDSRCIDVEALCIRAGKEIWKIRVDVRILDEDGSLLDCACLAAITALQHFRRPNVTLEPHHTLIYSEYEKAPV 183          
BLAST of BTB domain containing 9 vs. Ensembl Celegans
Match: exos-9 (EXOSome (Multiexonuclease complex) component [Source:UniProtKB/TrEMBL;Acc:Q8MNS7])

HSP 1 Score: 63.1586 bits (152), Expect = 4.785e-10
Identity = 51/185 (27.57%), Postives = 87/185 (47.03%), Query Frame = 1
Query:   58 LSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVG--FNKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSP-AIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANKELQFKFDNCPI 603
            ++N EK   L+A +   +F       R    FR + + VG     +    G+T+V+  ++ E   +P    P +G I   +DLSP A      +R   +  E I+ LL     DS  I++  LCI   K+ W I VD+ +++ DG+LLD   +   TAL++   P V     +  +  +++  P+
Sbjct:    6 VTNCEKAVILEALKIGKRF-----DFRSLEEFRDVKLVVGAEVGTAICTIGNTKVMAAVSAEI-AEPSSMRPHKGVINIDVDLSPMANYANEHDRLGSKGMELIR-LLELIIRDSRCIDVEALCIRAGKEIWKIRVDVRILDEDGSLLDCACLAAITALQHFRRPNVTLEPHHTLIYSEYEKAPV 183          
BLAST of BTB domain containing 9 vs. Ensembl Fly
Match: BTBD9 (gene:FBgn0030228 transcript:FBtr0071497)

HSP 1 Score: 315.079 bits (806), Expect = 2.127e-94
Identity = 166/372 (44.62%), Postives = 238/372 (63.98%), Query Frame = 1
Query: 1576 VIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAMENQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLI--EEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            V+ RD F APE+ IF AV +W   ++ N + D  S ++S VRL L++   LL  VRP+G++  + ILDA++ +  +  LP+R  + PEEN+A   + +  I G      +    T   +++    +  H I   +   IV+ LG    IN IRM L D + R+YSY V+VS DQ  W  V DY  Y CRSWQ LYF+   V++IR++GT+NTV R F V+  E ++T  +    ++   P  NVA++E  A V +GVSR+RN+L+NG+   Y+WDSGYTCHQLG+G IVV+L QPY +  +R LLWD DDR+YS+ +E+ST+R +W MV D  ++   S+QN +FT +PVV+IRI+GT N+ANE+FH VHLE
Sbjct:  197 VLRRDCFFAPEVQIFLAVWKW---SRFNSNVDFKS-VVSYVRLPLMNLEHLLQVVRPSGILDPDKILDAIDERSTSKALPYRAALWPEENVAAETFLSRCIQGECRDALLDGDVTTYDMENG---YTRHCITDSKDAGIVVELGTFCMINHIRMLLWDRDSRAYSYYVEVSGDQQHWDRVVDYSDYHCRSWQYLYFEARPVRFIRLVGTQNTVNRVFHVVGLEAMHTAKVPRLVNHFVAPKTNVATVEMSAIVTDGVSRTRNALINGDYVRYDWDSGYTCHQLGSGEIVVRLGQPYYLGSMRLLLWDCDDRTYSFYIEISTNRKEWQMVVDRRNDRTRSWQNFHFTPRPVVYIRIVGTRNTANEIFHCVHLE 561          

HSP 2 Score: 116.701 bits (291), Expect = 2.004e-26
Identity = 62/139 (44.60%), Postives = 86/139 (61.87%), Query Frame = 1
Query: 2287 PNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQL---GNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLETCH 2694
            P  NVA+    +  I+G    R++LL+G+   Y+ ++GYT H +    +  IVV+L    ++N+IR LLWD D R+YSY VEVS D+  W  V D S   C S+Q LYF  +PV FIR++GT N+ N VFH+V LE  H
Sbjct:  279 PEENVAAETFLSRCIQG--ECRDALLDGDVTTYDMENGYTRHCITDSKDAGIVVELGTFCMINHIRMLLWDRDSRAYSYYVEVSGDQQHWDRVVDYSDYHCRSWQYLYFEARPVRFIRLVGTQNTVNRVFHVVGLEAMH 415          

HSP 3 Score: 81.6481 bits (200), Expect = 1.716e-15
Identity = 38/93 (40.86%), Postives = 53/93 (56.99%), Query Frame = 1
Query: 1978 GRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDN 2256
            G IV+RLG P  +  +R+ L D + R+YS+ +++S ++  W  V D R    RSWQ  +F P  V YIRI+GTRNT    F  +  EC   D 
Sbjct:  475 GEIVVRLGQPYYLGSMRLLLWDCDDRTYSFYIEISTNRKEWQMVVDRRNDRTRSWQNFHFTPRPVVYIRIVGTRNTANEIFHCVHLECPTQDK 567          
BLAST of BTB domain containing 9 vs. Ensembl Fly
Match: BTBD9 (gene:FBgn0030228 transcript:FBtr0334456)

HSP 1 Score: 315.079 bits (806), Expect = 2.127e-94
Identity = 166/372 (44.62%), Postives = 238/372 (63.98%), Query Frame = 1
Query: 1576 VIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAMENQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLI--EEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            V+ RD F APE+ IF AV +W   ++ N + D  S ++S VRL L++   LL  VRP+G++  + ILDA++ +  +  LP+R  + PEEN+A   + +  I G      +    T   +++    +  H I   +   IV+ LG    IN IRM L D + R+YSY V+VS DQ  W  V DY  Y CRSWQ LYF+   V++IR++GT+NTV R F V+  E ++T  +    ++   P  NVA++E  A V +GVSR+RN+L+NG+   Y+WDSGYTCHQLG+G IVV+L QPY +  +R LLWD DDR+YS+ +E+ST+R +W MV D  ++   S+QN +FT +PVV+IRI+GT N+ANE+FH VHLE
Sbjct:  197 VLRRDCFFAPEVQIFLAVWKW---SRFNSNVDFKS-VVSYVRLPLMNLEHLLQVVRPSGILDPDKILDAIDERSTSKALPYRAALWPEENVAAETFLSRCIQGECRDALLDGDVTTYDMENG---YTRHCITDSKDAGIVVELGTFCMINHIRMLLWDRDSRAYSYYVEVSGDQQHWDRVVDYSDYHCRSWQYLYFEARPVRFIRLVGTQNTVNRVFHVVGLEAMHTAKVPRLVNHFVAPKTNVATVEMSAIVTDGVSRTRNALINGDYVRYDWDSGYTCHQLGSGEIVVRLGQPYYLGSMRLLLWDCDDRTYSFYIEISTNRKEWQMVVDRRNDRTRSWQNFHFTPRPVVYIRIVGTRNTANEIFHCVHLE 561          

HSP 2 Score: 116.701 bits (291), Expect = 2.004e-26
Identity = 62/139 (44.60%), Postives = 86/139 (61.87%), Query Frame = 1
Query: 2287 PNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQL---GNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLETCH 2694
            P  NVA+    +  I+G    R++LL+G+   Y+ ++GYT H +    +  IVV+L    ++N+IR LLWD D R+YSY VEVS D+  W  V D S   C S+Q LYF  +PV FIR++GT N+ N VFH+V LE  H
Sbjct:  279 PEENVAAETFLSRCIQG--ECRDALLDGDVTTYDMENGYTRHCITDSKDAGIVVELGTFCMINHIRMLLWDRDSRAYSYYVEVSGDQQHWDRVVDYSDYHCRSWQYLYFEARPVRFIRLVGTQNTVNRVFHVVGLEAMH 415          

HSP 3 Score: 81.6481 bits (200), Expect = 1.716e-15
Identity = 38/93 (40.86%), Postives = 53/93 (56.99%), Query Frame = 1
Query: 1978 GRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDN 2256
            G IV+RLG P  +  +R+ L D + R+YS+ +++S ++  W  V D R    RSWQ  +F P  V YIRI+GTRNT    F  +  EC   D 
Sbjct:  475 GEIVVRLGQPYYLGSMRLLLWDCDDRTYSFYIEISTNRKEWQMVVDRRNDRTRSWQNFHFTPRPVVYIRIVGTRNTANEIFHCVHLECPTQDK 567          
BLAST of BTB domain containing 9 vs. Ensembl Fly
Match: Rrp42 (gene:FBgn0034065 transcript:FBtr0087206)

HSP 1 Score: 108.612 bits (270), Expect = 1.454e-25
Identity = 75/279 (26.88%), Postives = 128/279 (45.88%), Query Frame = 1
Query:   43 MQNLMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANKEL-------------QFKFDNCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILP-NGD--IKCTSTDGEGSVKTASLLEMLKISSAVGMEMHKSL 816
            M  + LS AEK + L   +D+      R   R    +RP+ +E G        + +   +T +LV +  E D  P P  P+ G ++F +D S     +   R   +  + +   L  AY      N   LC+ P ++CW +Y+DIL++EC GNL D VS+    AL NT +P+V ++  +  +             +   +  P+ VTV KI    L+D   EEE C++   + ++   NG   +  T   G G++   ++   L++  A+G  + + L
Sbjct:    1 MAYVALSEAEKTYILHGVEDD-----FRCDGRSRRDYRPMDLETGLVSNASGSARLRLANTDILVGVKTEID-VPNPLTPEFGKLEFFVDCSANATPEFEGRGGSDLAQELILSLQNAYESPLAFNYRTLCLIPGQQCWKLYIDILILECGGNLHDAVSLAAKAALFNTKLPRVTATMLDAGITDLIISDNPYDCTRIGIETVPLLVTVCKIGDYVLVDPSAEEEVCSTVSMVVSVSMRNGQAFLSGTHLTGGGAMHRDTMRNCLELGLAIGEHLDRLL 273          
BLAST of BTB domain containing 9 vs. Ensembl Fly
Match: Rrp45 (gene:FBgn0030789 transcript:FBtr0344090)

HSP 1 Score: 67.3958 bits (163), Expect = 2.702e-11
Identity = 58/195 (29.74%), Postives = 86/195 (44.10%), Query Frame = 1
Query:   61 SNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVG--FNKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDA------NKELQF---KFDNCPIYVT 612
            S  E+ F +Q +  +N+ L+ R SN      R + +  G  +    V+ GDT+VL  +  E  G P  S P EG I   + L        ++   D+    + SLL   +  S  I+L  LC+   K  W I V++ V+  DGNL D  +I    AL +   P V   D        KE +F    F + P+ VT
Sbjct:   13 SKPERSF-VQLAVKQNQRLDGRRSNES----RDVELTFGKDWGSVAVSMGDTKVLAQVTCE-MGPPALSRPNEGKIHLNVYLGGVAFLDEAHTTHDQRSLKLNSLLERTFRSSRSIDLESLCVAVEKHVWCIRVNVNVLNHDGNLYDASTIATLAALMHFRRPDVWYKDGELRIFKKKEREFIPLLFHHYPVSVT 201          
BLAST of BTB domain containing 9 vs. Ensembl Fly
Match: Rrp45 (gene:FBgn0030789 transcript:FBtr0074355)

HSP 1 Score: 67.3958 bits (163), Expect = 2.702e-11
Identity = 58/195 (29.74%), Postives = 86/195 (44.10%), Query Frame = 1
Query:   61 SNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVG--FNKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDA------NKELQF---KFDNCPIYVT 612
            S  E+ F +Q +  +N+ L+ R SN      R + +  G  +    V+ GDT+VL  +  E  G P  S P EG I   + L        ++   D+    + SLL   +  S  I+L  LC+   K  W I V++ V+  DGNL D  +I    AL +   P V   D        KE +F    F + P+ VT
Sbjct:   13 SKPERSF-VQLAVKQNQRLDGRRSNES----RDVELTFGKDWGSVAVSMGDTKVLAQVTCE-MGPPALSRPNEGKIHLNVYLGGVAFLDEAHTTHDQRSLKLNSLLERTFRSSRSIDLESLCVAVEKHVWCIRVNVNVLNHDGNLYDASTIATLAALMHFRRPDVWYKDGELRIFKKKEREFIPLLFHHYPVSVT 201          
BLAST of BTB domain containing 9 vs. Ensembl Zebrafish
Match: btbd9 (BTB (POZ) domain containing 9 [Source:ZFIN;Acc:ZDB-GENE-040704-39])

HSP 1 Score: 351.288 bits (900), Expect = 3.430e-109
Identity = 175/379 (46.17%), Postives = 253/379 (66.75%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR---IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            AL  V+ RDSF + E  IF+A+  W   N          +++S VRL L++  ++L  VRP+GL++ + +LDA++  ++ +   L +RG++IPEEN+A  +  A ++ G   +  +        +D     F  H IEE+GR   I +RLG PS +N IR+ L D + RSYSY V+VS+D++ WV V D+ K++CRSWQ LYF   V ++IR++GT NTV + F ++  EC+YT         + +P  NVA+++  A+V+EGVSRSRN+LLNG+T +Y+WDSGYTCHQLG+GAIV+QLAQPY++  +R LLWD D+RSYSY VE+ST++  WV + D + + C S+Q L F RQP  FIRI+GT+N+ANEVFH VH E
Sbjct:  185 ALLTVVRRDSFASSEREIFQALCHWCHHNGDGPE---AKEVMSAVRLPLMTLFEMLNVVRPSGLLSPDDLLDAIQTRSESRDMDLNYRGMLIPEENIATMKHGAVVVKGELKSALLDGDTQNYDLDHG---FSRHPIEEEGRAAGIQVRLGQPSIVNHIRLLLWDKDSRSYSYYVEVSMDELDWVRVVDHSKFLCRSWQQLYFPARVCRFIRVVGTHNTVNKVFHLVALECMYTLRPFTLEKGLLVPTENVATVQACASVVEGVSRSRNALLNGDTSHYDWDSGYTCHQLGSGAIVIQLAQPYMLCSMRLLLWDCDERSYSYYVELSTNQQNWVKIVDRTKDECRSWQTLTFDRQPASFIRIVGTHNTANEVFHCVHFE 557          

HSP 2 Score: 94.3597 bits (233), Expect = 2.417e-19
Identity = 55/141 (39.01%), Postives = 78/141 (55.32%), Query Frame = 1
Query: 1819 RGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFEC 2241
            +GL++P EN+A  +  AS++ G   +          H D  DS +  H +   G IVI+L  P  +  +R+ L D + RSYSY V++S +Q +WV + D  K  CRSWQTL FD     +IRI+GT NT    F  + FEC
Sbjct:  420 KGLLVPTENVATVQACASVVEGVSRSRNALLNGDTSHYDW-DSGYTCHQLG-SGAIVIQLAQPYMLCSMRLLLWDCDERSYSYYVELSTNQQNWVKIVDRTKDECRSWQTLTFDRQPASFIRIVGTHNTANEVFHCVHFEC 558          
BLAST of BTB domain containing 9 vs. Ensembl Zebrafish
Match: exosc7 (exosome component 7 [Source:ZFIN;Acc:ZDB-GENE-050417-47])

HSP 1 Score: 155.221 bits (391), Expect = 1.619e-41
Identity = 88/278 (31.65%), Postives = 145/278 (52.16%), Query Frame = 1
Query:   43 MQNLMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSS---DANKELQFKFD----------NCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISSAVGMEMHKSLIE 822
            M  + +  AEK++ +   +D+     +RL  RG   +R + IE          ++++ G T VLV I  E  GKP P  P EGY++F +D S     +   R  +E    + + L++ +++   ++L  LCI P + CW++YVD+L+++CDGNL D +SI I  AL NT IPKV+ S   +  KE++   D          N P  VT+ KI  ++++DA  +E+ C+    + A+   G + C    G GS+   S+ EM +    VG  +H  L++
Sbjct:    1 MAAVKVCEAEKVYIMHGVRDD-----LRLDGRGCEDYRHMEIETDVVSNTDGSAKISLGHTDVLVGIKAEI-GKPRPMVPDEGYLEFFVDCSANATPEFEGRGGEELGVELSNTLLKVFNNRHSLDLRSLCICPGENCWVLYVDVLLLQCDGNLFDAISIAIKAALFNTRIPKVHISEDEEGGKEIELSDDPFDCMRLNVENVPCIVTLCKIGHRHVVDATLQEKACSVASLLIAVTHTGMVTCVRKMGGGSLDPESIFEMTEAGKRVGKSLHAPLMD 272          
BLAST of BTB domain containing 9 vs. Ensembl Zebrafish
Match: exosc8 (exosome component 8 [Source:ZFIN;Acc:ZDB-GENE-030131-1736])

HSP 1 Score: 80.1073 bits (196), Expect = 6.925e-16
Identity = 60/213 (28.17%), Postives = 88/213 (41.31%), Query Frame = 1
Query:  124 RLSNRGFYSFRPI-----SIEVGFNKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVN--------SSDANKELQFKFDNCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCT 723
            R   R    FRP      SI      + V  G+T V+  I  E    P  +  K GY+   +DL P   ++       E  +     + +    SD+INL +LCI   K CW++Y DI+ ++ DGNLLD     +  ALK   +P+V           D  K+ + K +  P+  +    D   +I     EE   ST  MT +    D  C 
Sbjct:   23 RPDGRELGEFRPTTLNINSISTADGSALVKIGNTTVICGIKAELAVPPSEAQNK-GYLVPNVDLPPLCSSRFRAGPPGEQAQAASQFIADVIESSDLINLEELCIEKAKLCWVLYCDIMCLDYDGNLLDACITVLLAALKTAQLPEVTINKETDLAEVDIEKKRRLKINRHPVGSSFAVFDDSIIIVDPTAEEESLSTALMTVVTDEEDRLCA 234          
BLAST of BTB domain containing 9 vs. Ensembl Zebrafish
Match: exosc9 (exosome component 9 [Source:NCBI gene;Acc:450057])

HSP 1 Score: 72.7886 bits (177), Expect = 6.099e-13
Identity = 57/173 (32.95%), Postives = 82/173 (47.40%), Query Frame = 1
Query:   43 MQNLMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVG--FNKSEVNAGDTRVLVNINFE--PDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKV 549
            M++  LSN E+LF L+A +++      RL  R  Y +R I I  G  +    V  G TRVL  ++ E  P   P  S P EG + F ++LSP         +  E    +   L     +S  I+   LC+   +K W I VD+ V+  DGNL+D  SI   +AL +   P V
Sbjct:    1 MRDTPLSNCERLFLLKAIKEKK-----RLDGRQTYDYRNIKISFGTDYGCCVVELGKTRVLSQVSCELVP---PKDSRPTEGIVFFNLELSPMASPAFEPNRQSELLVTLNRQLERCLRNSKCIDTESLCVVSGEKVWQIRVDVHVLNHDGNLMDAASIAAISALSHFRRPDV 165          
BLAST of BTB domain containing 9 vs. Ensembl Xenopus
Match: arsi (arylsulfatase family member I [Source:Xenbase;Acc:XB-GENE-6046190])

HSP 1 Score: 148.288 bits (373), Expect = 5.635e-39
Identity = 85/276 (30.80%), Postives = 136/276 (49.28%), Query Frame = 1
Query:   43 MQNLMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVN---SSDANKELQFKFD----------NCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISSAVGMEMHKSL 816
            M +++LS AEK++ L   QD+     +R   RG   +R I +E          + V  G T VLV +  E  G P    P EGY++F +D S     +   R  +E    I  +L + + +   I+L  LCI   + CW++YVD+L++EC GNL D +S+ +  AL N  IPKV      +  K+ +   D          N P  VT+++I  ++++DA  +EE C+    + A+   G + C    G+GS+   S+ EM++    V   +H SL
Sbjct:    1 MASVVLSEAEKIYVLHGVQDD-----LRTDGRGCEDYRCIEVETDVVSNTTGSARVKIGHTDVLVGVKAEM-GTPKLERPGEGYLEFFVDCSANATPEFEGRGGEELGAEIAFMLYKIFDNRSSIDLESLCIQEREHCWVLYVDVLLLECGGNLFDTISVAVKAALFNARIPKVRILEDDEGGKDFELSDDPYDCVRLNVVNVPCIVTLSRIGHRHVVDATLQEEACSVASLLIAVTSKGILTCMRKIGKGSLDPESIFEMIETGKHVAKSLHTSL 270          
BLAST of BTB domain containing 9 vs. Ensembl Xenopus
Match: erc2 (ELKS/RAB6-interacting/CAST family member 2 [Source:Xenbase;Acc:XB-GENE-1013677])

HSP 1 Score: 149.058 bits (375), Expect = 7.408e-39
Identity = 83/203 (40.89%), Postives = 130/203 (64.04%), Query Frame = 1
Query: 1561 GALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYF 2157
            GAL  ++ RDSF APE  IF+A+++W   N     ++I S+I++ VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEENLA  ++ A ++ G   A  +        +D     F  H IE+  R  I ++LG PS IN IR+ L D + RSYSY ++VS+D++ W+ V D+ + +CRSWQ LYF
Sbjct:  123 GALLDIVQRDSFAAPEKDIFQALMRWCRHNL----KEIHSEIMAAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENLATMKYGAQVVKGELRAALLDGDTQNYDLDHG---FSRHPIEDDCRSGIQVKLGQPSIINHIRLLLWDRDSRSYSYYIEVSMDELDWIRVIDHSQVLCRSWQKLYF 318          

HSP 2 Score: 104.76 bits (260), Expect = 8.481e-24
Identity = 51/110 (46.36%), Postives = 75/110 (68.18%), Query Frame = 1
Query: 2284 IPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGN---GAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYF 2604
            IP  N+A++++ A V++G  R+  +LL+G+T+NY+ D G++ H + +     I V+L QP I+N+IR LLWD D RSYSY +EVS D   W+ V D+S  LC S+Q LYF
Sbjct:  211 IPEENLATMKYGAQVVKGELRA--ALLDGDTQNYDLDHGFSRHPIEDDCRSGIQVKLGQPSIINHIRLLLWDRDSRSYSYYIEVSMDELDWIRVIDHSQVLCRSWQKLYF 318          
BLAST of BTB domain containing 9 vs. Ensembl Xenopus
Match: exosc8 (exosome component 8 [Source:NCBI gene;Acc:493300])

HSP 1 Score: 71.633 bits (174), Expect = 5.908e-13
Identity = 57/236 (24.15%), Postives = 98/236 (41.53%), Query Frame = 1
Query:  106 NKFLE--IRLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIP--KVNSSDANKELQFKFDNC------PIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLE 768
             KFL+   R   R    FR  +I VG        + V  G+  VL  +  E    P  + P +GY+   +DL+P   ++       E  +     + +   +S ++   DLCI   K  W++Y D++ ++ DGNLLD     +  AL+N  +P  K+N      E+  K  +       P+  +    D  +L+     EE   ++  +T +    +  C +    GS   A  L+
Sbjct:   15 RKFLKEACRPDGRELTEFRTTTINVGSITTADGSALVKLGNCTVLCGVKAEFTAPPADA-PNKGYVVPNVDLTPLCSSQFRPGPPGEEAQVASQFIADVIDNSQMLLKEDLCIAHGKLAWVLYCDLICLDYDGNLLDTCMCALVAALQNVRLPSVKINEETGLAEVNLKTKHALKILKHPVATSFAVFDDSFLLVDPTGEEEGLASGLLTVVTDEDERLCATRKPGGSALAAEKLQ 249          
BLAST of BTB domain containing 9 vs. Ensembl Xenopus
Match: exosc8 (exosome component 8 [Source:NCBI gene;Acc:493300])

HSP 1 Score: 71.633 bits (174), Expect = 6.954e-13
Identity = 57/236 (24.15%), Postives = 98/236 (41.53%), Query Frame = 1
Query:  106 NKFLE--IRLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIP--KVNSSDANKELQFKFDNC------PIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLE 768
             KFL+   R   R    FR  +I VG        + V  G+  VL  +  E    P  + P +GY+   +DL+P   ++       E  +     + +   +S ++   DLCI   K  W++Y D++ ++ DGNLLD     +  AL+N  +P  K+N      E+  K  +       P+  +    D  +L+     EE   ++  +T +    +  C +    GS   A  L+
Sbjct:   15 RKFLKEACRPDGRELTEFRTTTINVGSITTADGSALVKLGNCTVLCGVKAEFTAPPADA-PNKGYVVPNVDLTPLCSSQFRPGPPGEEAQVASQFIADVIDNSQMLLKEDLCIAHGKLAWVLYCDLICLDYDGNLLDTCMCALVAALQNVRLPSVKINEETGLAEVNLKTKHALKILKHPVATSFAVFDDSFLLVDPTGEEEGLASGLLTVVTDEDERLCATRKPGGSALAAEKLQ 249          
BLAST of BTB domain containing 9 vs. Ensembl Xenopus
Match: kdelr3 (KDEL endoplasmic reticulum protein retention receptor 3 [Source:Xenbase;Acc:XB-GENE-489131])

HSP 1 Score: 58.5362 bits (140), Expect = 3.619e-8
Identity = 46/153 (30.07%), Postives = 69/153 (45.10%), Query Frame = 1
Query:   43 MQNLMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVG--FNKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLD 495
            M+   LSN E+ F LQA  +       RL  R  Y +R I I  G  +    V  G TRVL  ++ E    P  + P EG + F + +SP         +  E    +  LL     +S  I+   LC+   +K W I VD+ ++  +GN++D
Sbjct:    1 MKETPLSNCERAFLLQAIAERK-----RLDGRQTYDYRNIKITFGTDYGCCIVELGKTRVLCQVSSEIV-TPKMNRPTEGILFFDLAISPMAFPGFEMGRNSELSVKLNRLLERCLRNSKCIDTESLCVAAGEKVWQIRVDLHLLNHEGNIID 147          
BLAST of BTB domain containing 9 vs. Ensembl Mouse
Match: Btbd9 (BTB (POZ) domain containing 9 [Source:MGI Symbol;Acc:MGI:1916625])

HSP 1 Score: 370.163 bits (949), Expect = 1.444e-116
Identity = 189/379 (49.87%), Postives = 262/379 (69.13%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELN-KSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            AL  ++ RDSF APE  IF A++ W + N K N+++     I+  VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEEN+A  ++ A ++ G   +  +        +D     F  H I++  R  I I+LG PS IN IR+ L D + RSYSY ++VS+D++ W+ V D+  Y+CRSWQ LYF   V +YIRI+GT NTV + F ++ FEC++T+        + +P  NVA+I   A+VIEGVSRSRN+LLNG+TKNY+WDSGYTCHQLG+GAIVVQLAQPYI+  IR LLWD DDRSYSY VEVST++ +W MVAD +   C S+Q++ F RQP  FIRI+GT+N+ANEVFH VH E
Sbjct:  185 ALLNIVLRDSFAAPEKDIFLALLNWCKHNAKENHAE-----IMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIDDDCRSGIEIKLGQPSIINHIRLLLWDRDSRSYSYFIEVSMDELDWIRVIDHSHYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKAFTLEKGLIVPLENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYIIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFE 555          

HSP 2 Score: 87.0409 bits (214), Expect = 4.607e-17
Identity = 53/141 (37.59%), Postives = 76/141 (53.90%), Query Frame = 1
Query: 1819 RGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFEC 2241
            +GL++P EN+A     AS+I G   +         ++ D  DS +  H +   G IV++L  P  I  IR+ L D + RSYSY V+VS +Q  W  V D  K  C+SWQ++ F+     +IRI+GT NT    F  + FEC
Sbjct:  418 KGLIVPLENVATIADCASVIEGVSRSRNALLNGDTKNYDW-DSGYTCHQLG-SGAIVVQLAQPYIIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFEC 556          
BLAST of BTB domain containing 9 vs. Ensembl Mouse
Match: Btbd9 (BTB (POZ) domain containing 9 [Source:MGI Symbol;Acc:MGI:1916625])

HSP 1 Score: 369.007 bits (946), Expect = 9.858e-116
Identity = 189/379 (49.87%), Postives = 262/379 (69.13%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELN-KSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            AL  ++ RDSF APE  IF A++ W + N K N+++     I+  VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEEN+A  ++ A ++ G   +  +        +D     F  H I++  R  I I+LG PS IN IR+ L D + RSYSY ++VS+D++ W+ V D+  Y+CRSWQ LYF   V +YIRI+GT NTV + F ++ FEC++T+        + +P  NVA+I   A+VIEGVSRSRN+LLNG+TKNY+WDSGYTCHQLG+GAIVVQLAQPYI+  IR LLWD DDRSYSY VEVST++ +W MVAD +   C S+Q++ F RQP  FIRI+GT+N+ANEVFH VH E
Sbjct:  185 ALLNIVLRDSFAAPEKDIFLALLNWCKHNAKENHAE-----IMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIDDDCRSGIEIKLGQPSIINHIRLLLWDRDSRSYSYFIEVSMDELDWIRVIDHSHYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKAFTLEKGLIVPLENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYIIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFE 555          

HSP 2 Score: 86.2705 bits (212), Expect = 7.298e-17
Identity = 53/141 (37.59%), Postives = 76/141 (53.90%), Query Frame = 1
Query: 1819 RGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFEC 2241
            +GL++P EN+A     AS+I G   +         ++ D  DS +  H +   G IV++L  P  I  IR+ L D + RSYSY V+VS +Q  W  V D  K  C+SWQ++ F+     +IRI+GT NT    F  + FEC
Sbjct:  418 KGLIVPLENVATIADCASVIEGVSRSRNALLNGDTKNYDW-DSGYTCHQLG-SGAIVVQLAQPYIIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFEC 556          
BLAST of BTB domain containing 9 vs. Ensembl Mouse
Match: Btbd9 (BTB (POZ) domain containing 9 [Source:MGI Symbol;Acc:MGI:1916625])

HSP 1 Score: 369.007 bits (946), Expect = 9.858e-116
Identity = 189/379 (49.87%), Postives = 262/379 (69.13%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELN-KSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            AL  ++ RDSF APE  IF A++ W + N K N+++     I+  VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEEN+A  ++ A ++ G   +  +        +D     F  H I++  R  I I+LG PS IN IR+ L D + RSYSY ++VS+D++ W+ V D+  Y+CRSWQ LYF   V +YIRI+GT NTV + F ++ FEC++T+        + +P  NVA+I   A+VIEGVSRSRN+LLNG+TKNY+WDSGYTCHQLG+GAIVVQLAQPYI+  IR LLWD DDRSYSY VEVST++ +W MVAD +   C S+Q++ F RQP  FIRI+GT+N+ANEVFH VH E
Sbjct:  185 ALLNIVLRDSFAAPEKDIFLALLNWCKHNAKENHAE-----IMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIDDDCRSGIEIKLGQPSIINHIRLLLWDRDSRSYSYFIEVSMDELDWIRVIDHSHYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKAFTLEKGLIVPLENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYIIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFE 555          

HSP 2 Score: 86.2705 bits (212), Expect = 7.298e-17
Identity = 53/141 (37.59%), Postives = 76/141 (53.90%), Query Frame = 1
Query: 1819 RGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFEC 2241
            +GL++P EN+A     AS+I G   +         ++ D  DS +  H +   G IV++L  P  I  IR+ L D + RSYSY V+VS +Q  W  V D  K  C+SWQ++ F+     +IRI+GT NT    F  + FEC
Sbjct:  418 KGLIVPLENVATIADCASVIEGVSRSRNALLNGDTKNYDW-DSGYTCHQLG-SGAIVVQLAQPYIIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFEC 556          
BLAST of BTB domain containing 9 vs. Ensembl Mouse
Match: Btbd9 (BTB (POZ) domain containing 9 [Source:MGI Symbol;Acc:MGI:1916625])

HSP 1 Score: 369.007 bits (946), Expect = 9.858e-116
Identity = 189/379 (49.87%), Postives = 262/379 (69.13%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELN-KSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            AL  ++ RDSF APE  IF A++ W + N K N+++     I+  VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEEN+A  ++ A ++ G   +  +        +D     F  H I++  R  I I+LG PS IN IR+ L D + RSYSY ++VS+D++ W+ V D+  Y+CRSWQ LYF   V +YIRI+GT NTV + F ++ FEC++T+        + +P  NVA+I   A+VIEGVSRSRN+LLNG+TKNY+WDSGYTCHQLG+GAIVVQLAQPYI+  IR LLWD DDRSYSY VEVST++ +W MVAD +   C S+Q++ F RQP  FIRI+GT+N+ANEVFH VH E
Sbjct:  185 ALLNIVLRDSFAAPEKDIFLALLNWCKHNAKENHAE-----IMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIDDDCRSGIEIKLGQPSIINHIRLLLWDRDSRSYSYFIEVSMDELDWIRVIDHSHYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKAFTLEKGLIVPLENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYIIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFE 555          

HSP 2 Score: 86.2705 bits (212), Expect = 7.298e-17
Identity = 53/141 (37.59%), Postives = 76/141 (53.90%), Query Frame = 1
Query: 1819 RGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFEC 2241
            +GL++P EN+A     AS+I G   +         ++ D  DS +  H +   G IV++L  P  I  IR+ L D + RSYSY V+VS +Q  W  V D  K  C+SWQ++ F+     +IRI+GT NT    F  + FEC
Sbjct:  418 KGLIVPLENVATIADCASVIEGVSRSRNALLNGDTKNYDW-DSGYTCHQLG-SGAIVVQLAQPYIIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFEC 556          
BLAST of BTB domain containing 9 vs. Ensembl Mouse
Match: Btbd9 (BTB (POZ) domain containing 9 [Source:MGI Symbol;Acc:MGI:1916625])

HSP 1 Score: 345.125 bits (884), Expect = 1.140e-109
Identity = 172/337 (51.04%), Postives = 237/337 (70.33%), Query Frame = 1
Query: 1687 LSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            +  VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEEN+A  ++ A ++ G   +  +        +D     F  H I++  R  I I+LG PS IN IR+ L D + RSYSY ++VS+D++ W+ V D+  Y+CRSWQ LYF   V +YIRI+GT NTV + F ++ FEC++T+        + +P  NVA+I   A+VIEGVSRSRN+LLNG+TKNY+WDSGYTCHQLG+GAIVVQLAQPYI+  IR LLWD DDRSYSY VEVST++ +W MVAD +   C S+Q++ F RQP  FIRI+GT+N+ANEVFH VH E
Sbjct:    1 MQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIDDDCRSGIEIKLGQPSIINHIRLLLWDRDSRSYSYFIEVSMDELDWIRVIDHSHYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKAFTLEKGLIVPLENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYIIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFE 334          

HSP 2 Score: 86.6557 bits (213), Expect = 1.752e-17
Identity = 53/141 (37.59%), Postives = 76/141 (53.90%), Query Frame = 1
Query: 1819 RGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFEC 2241
            +GL++P EN+A     AS+I G   +         ++ D  DS +  H +   G IV++L  P  I  IR+ L D + RSYSY V+VS +Q  W  V D  K  C+SWQ++ F+     +IRI+GT NT    F  + FEC
Sbjct:  197 KGLIVPLENVATIADCASVIEGVSRSRNALLNGDTKNYDW-DSGYTCHQLGS-GAIVVQLAQPYIIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFEC 335          
BLAST of BTB domain containing 9 vs. UniProt/SwissProt
Match: sp|Q96Q07|BTBD9_HUMAN (BTB/POZ domain-containing protein 9 OS=Homo sapiens OX=9606 GN=BTBD9 PE=1 SV=2)

HSP 1 Score: 372.089 bits (954), Expect = 4.384e-116
Identity = 191/391 (48.85%), Postives = 267/391 (68.29%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLETCHHSNETNAIEN 2724
            AL  ++ RDSF APE  IF A++ W + N    S++  ++I+  VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEEN+A  ++ A ++ G   +  +        +D     F  H I++  R  I I+LG PS IN IR+ L D + RSYSY ++VS+D++ WV V D+ +Y+CRSWQ LYF   V +YIRI+GT NTV + F ++ FEC++T+        + +P  NVA+I   A+VIEGVSRSRN+LLNG+TKNY+WDSGYTCHQLG+GAIVVQLAQPY++  IR LLWD DDRSYSY VEVST++ +W MVAD +   C S+Q++ F RQP  FIRI+GT+N+ANEVFH VH E C     +   EN
Sbjct:  185 ALLNIVLRDSFAAPEKDIFLALLNWCKHN----SKENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYFIEVSMDELDWVRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEKGLIVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFE-CPEQQSSQKEEN 567          
BLAST of BTB domain containing 9 vs. UniProt/SwissProt
Match: sp|Q8C726|BTBD9_MOUSE (BTB/POZ domain-containing protein 9 OS=Mus musculus OX=10090 GN=Btbd9 PE=1 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 6.896e-115
Identity = 189/379 (49.87%), Postives = 262/379 (69.13%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELN-KSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            AL  ++ RDSF APE  IF A++ W + N K N+++     I+  VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEEN+A  ++ A ++ G   +  +        +D     F  H I++  R  I I+LG PS IN IR+ L D + RSYSY ++VS+D++ W+ V D+  Y+CRSWQ LYF   V +YIRI+GT NTV + F ++ FEC++T+        + +P  NVA+I   A+VIEGVSRSRN+LLNG+TKNY+WDSGYTCHQLG+GAIVVQLAQPYI+  IR LLWD DDRSYSY VEVST++ +W MVAD +   C S+Q++ F RQP  FIRI+GT+N+ANEVFH VH E
Sbjct:  185 ALLNIVLRDSFAAPEKDIFLALLNWCKHNAKENHAE-----IMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIDDDCRSGIEIKLGQPSIINHIRLLLWDRDSRSYSYFIEVSMDELDWIRVIDHSHYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKAFTLEKGLIVPLENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYIIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFE 555          

HSP 2 Score: 86.2705 bits (212), Expect = 5.105e-16
Identity = 53/141 (37.59%), Postives = 76/141 (53.90%), Query Frame = 1
Query: 1819 RGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFEC 2241
            +GL++P EN+A     AS+I G   +         ++ D  DS +  H +   G IV++L  P  I  IR+ L D + RSYSY V+VS +Q  W  V D  K  C+SWQ++ F+     +IRI+GT NT    F  + FEC
Sbjct:  418 KGLIVPLENVATIADCASVIEGVSRSRNALLNGDTKNYDW-DSGYTCHQLG-SGAIVVQLAQPYIIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFEC 556          
BLAST of BTB domain containing 9 vs. UniProt/SwissProt
Match: sp|Q5PQR3|BTBD9_RAT (BTB/POZ domain-containing protein 9 OS=Rattus norvegicus OX=10116 GN=Btbd9 PE=1 SV=1)

HSP 1 Score: 367.466 bits (942), Expect = 2.512e-114
Identity = 188/379 (49.60%), Postives = 261/379 (68.87%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELN-KSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            AL  ++ RDSF APE  IF A++ W + N K N+++     I+  VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEEN+A  ++ A ++ G   +  +        +D     F  H I++  R  I I+LG PS IN IR+ L D + RSYSY ++VS+D++ W+ V D+  Y+CRSWQ LYF   V +YIRI+GT NTV + F ++ FEC++T+        +  P  NVA+I   A+VIEGVSRSRN+LLNG+TKNY+WDSGYTCHQLG+GAIVVQLAQPY++  IR LLWD DDRSYSY VEVST++ +W MVAD +   C S+Q++ F RQP  FIRI+GT+N+ANEVFH VH E
Sbjct:  185 ALLNIVLRDSFAAPEKDIFLALLNWCKHNAKENHAE-----IMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIDDDCRSGIEIKLGQPSIINHIRLLLWDRDSRSYSYFIEVSMDELDWIRVIDHSHYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKAFTLEKGLIAPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFE 555          

HSP 2 Score: 86.2705 bits (212), Expect = 6.071e-16
Identity = 53/141 (37.59%), Postives = 75/141 (53.19%), Query Frame = 1
Query: 1819 RGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFEC 2241
            +GL+ P EN+A     AS+I G   +         ++ D  DS +  H +   G IV++L  P  I  IR+ L D + RSYSY V+VS +Q  W  V D  K  C+SWQ++ F+     +IRI+GT NT    F  + FEC
Sbjct:  418 KGLIAPMENVATIADCASVIEGVSRSRNALLNGDTKNYDW-DSGYTCHQLG-SGAIVVQLAQPYMIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVGTHNTANEVFHCVHFEC 556          
BLAST of BTB domain containing 9 vs. UniProt/SwissProt
Match: sp|A4IFG2|BTBD9_BOVIN (BTB/POZ domain-containing protein 9 OS=Bos taurus OX=9913 GN=BTBD9 PE=2 SV=2)

HSP 1 Score: 365.54 bits (937), Expect = 1.441e-113
Identity = 185/378 (48.94%), Postives = 261/378 (69.05%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            AL  ++ RDSF APE  IF A++ W + N    S +  ++I+  VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEEN+A  ++ A ++ G   +  +        +D     F  H I++  R  I I+LG PS IN IR+ L D + RSYSY ++VS+D++ W+ V D+ +Y+CRSWQ LYF   V +YIRI+GT NTV + F ++ FEC++T+        + +P  NVA+I   A+VIEGVSRSRN+LLNG+TKNY+WDS YTCHQLG+GAIVVQLAQPY++  IR LLWD DDRSYSY VEVST++ +W MVAD +   C S+Q++ F R+P  FIRI+GT+N+ANEVFH VH E
Sbjct:  185 ALLNIVLRDSFAAPEKDIFLALLNWCKHN----SNENHAEIMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYFIEVSMDELDWIRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEKGLIVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSSYTCHQLGSGAIVVQLAQPYMIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERRPASFIRIVGTHNTANEVFHCVHFE 555          

HSP 2 Score: 87.8113 bits (216), Expect = 1.649e-16
Identity = 53/141 (37.59%), Postives = 76/141 (53.90%), Query Frame = 1
Query: 1819 RGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFEC 2241
            +GL++P EN+A     AS+I G   +         ++ D  DS +  H +   G IV++L  P  I  IR+ L D + RSYSY V+VS +Q  W  V D  K  C+SWQ++ F+     +IRI+GT NT    F  + FEC
Sbjct:  418 KGLIVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDW-DSSYTCHQLG-SGAIVVQLAQPYMIGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERRPASFIRIVGTHNTANEVFHCVHFEC 556          
BLAST of BTB domain containing 9 vs. UniProt/SwissProt
Match: sp|Q9W2S3|BTBD9_DROME (BTB/POZ domain-containing protein 9 OS=Drosophila melanogaster OX=7227 GN=BTBD9 PE=1 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 2.132e-93
Identity = 166/372 (44.62%), Postives = 238/372 (63.98%), Query Frame = 1
Query: 1576 VIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAMENQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLI--EEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            V+ RD F APE+ IF AV +W   ++ N + D  S ++S VRL L++   LL  VRP+G++  + ILDA++ +  +  LP+R  + PEEN+A   + +  I G      +    T   +++    +  H I   +   IV+ LG    IN IRM L D + R+YSY V+VS DQ  W  V DY  Y CRSWQ LYF+   V++IR++GT+NTV R F V+  E ++T  +    ++   P  NVA++E  A V +GVSR+RN+L+NG+   Y+WDSGYTCHQLG+G IVV+L QPY +  +R LLWD DDR+YS+ +E+ST+R +W MV D  ++   S+QN +FT +PVV+IRI+GT N+ANE+FH VHLE
Sbjct:  197 VLRRDCFFAPEVQIFLAVWKW---SRFNSNVDFKS-VVSYVRLPLMNLEHLLQVVRPSGILDPDKILDAIDERSTSKALPYRAALWPEENVAAETFLSRCIQGECRDALLDGDVTTYDMENG---YTRHCITDSKDAGIVVELGTFCMINHIRMLLWDRDSRAYSYYVEVSGDQQHWDRVVDYSDYHCRSWQYLYFEARPVRFIRLVGTQNTVNRVFHVVGLEAMHTAKVPRLVNHFVAPKTNVATVEMSAIVTDGVSRTRNALINGDYVRYDWDSGYTCHQLGSGEIVVRLGQPYYLGSMRLLLWDCDDRTYSFYIEISTNRKEWQMVVDRRNDRTRSWQNFHFTPRPVVYIRIVGTRNTANEIFHCVHLE 561          

HSP 2 Score: 116.701 bits (291), Expect = 2.009e-25
Identity = 62/139 (44.60%), Postives = 86/139 (61.87%), Query Frame = 1
Query: 2287 PNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQL---GNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLETCH 2694
            P  NVA+    +  I+G    R++LL+G+   Y+ ++GYT H +    +  IVV+L    ++N+IR LLWD D R+YSY VEVS D+  W  V D S   C S+Q LYF  +PV FIR++GT N+ N VFH+V LE  H
Sbjct:  279 PEENVAAETFLSRCIQG--ECRDALLDGDVTTYDMENGYTRHCITDSKDAGIVVELGTFCMINHIRMLLWDRDSRAYSYYVEVSGDQQHWDRVVDYSDYHCRSWQYLYFEARPVRFIRLVGTQNTVNRVFHVVGLEAMH 415          

HSP 3 Score: 81.6481 bits (200), Expect = 1.720e-14
Identity = 38/93 (40.86%), Postives = 53/93 (56.99%), Query Frame = 1
Query: 1978 GRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDN 2256
            G IV+RLG P  +  +R+ L D + R+YS+ +++S ++  W  V D R    RSWQ  +F P  V YIRI+GTRNT    F  +  EC   D 
Sbjct:  475 GEIVVRLGQPYYLGSMRLLLWDCDDRTYSFYIEISTNRKEWQMVVDRRNDRTRSWQNFHFTPRPVVYIRIVGTRNTANEIFHCVHLECPTQDK 567          
BLAST of BTB domain containing 9 vs. TrEMBL
Match: C3Y0L5 (BTB domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_93002 PE=4 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 2.534e-118
Identity = 194/383 (50.65%), Postives = 266/383 (69.45%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQ-GRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLETCHHSN 2703
            AL  +I RDSFCAPE  IF A ++W E  + N ++D+   I+  +RL L+S ++LL  VRPT LV  ++ILDA++  ++ +   L +RG + PEEN+A     AS+I G   A  +   CT   +D     F  H IEE  G +V++LG PS IN IR+ L D + RSYSY ++VS+D+  W+ V D+ +Y+CRSWQTL+F   V++Y+RI+G  NTV + F ++ FECLYT+        + +P+ NVA+ +H A+VIEGVSRSRN+LLNG+TKNY+WDSGYTCHQLG+GAIVVQLAQP+IV  +R LLWD DDRSYSY +EVSTD+  W +V D + E C S+Q ++F ++PV FIRI+GT+N+ANEVFH VH E   + N
Sbjct:  187 ALKEIISRDSFCAPEKDIFAATLRWSE-EEPNKNEDV-RHIVKSIRLPLMSLAELLNVVRPTNLVEPDNILDAIKTRSESRDMDLNYRGFLTPEENIATLRHGASVIKGEMKAALLDGDCTNYDLDRG---FTRHPIEENNGGVVVKLGQPSIINTIRLLLWDRDTRSYSYYLEVSMDEKDWLRVVDHSRYLCRSWQTLHFPTRVIKYVRIVGVHNTVNKVFHLVSFECLYTNKPFQLERGLLVPSENVATTQHSASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPFIVGSMRLLLWDCDDRSYSYYIEVSTDQQHWELVCDKTREACRSWQAIFFEKRPVTFIRIVGTHNTANEVFHCVHFECPANPN 564          
BLAST of BTB domain containing 9 vs. TrEMBL
Match: B1WB70 (LOC100145760 protein OS=Xenopus tropicalis OX=8364 GN=btbd9 PE=2 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 1.553e-115
Identity = 193/392 (49.23%), Postives = 269/392 (68.62%), Query Frame = 1
Query: 1561 GALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLETCHHSNETNAIEN 2724
            GAL  ++ RDSF APE  IF+A+++W   N     ++I S+I++ VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEENLA  ++ A ++ G   A  +        +D     F  H IE+  R  I ++LG PS IN IR+ L D + RSYSY ++VS+D++ W+ V D+ + +CRSWQ LYF   V +YIRI+GT NTV + F ++ FECLYT       + + +P  NVA+I   A+VIEGVSRSRN+LLNG+T+NY+WDSGYTCHQLG+GAIVVQLAQP+++  IR LLWD DDRSYSY +EVST++ +W MVAD +   C S+Q + F RQP  FIRI+GT+N+ANEVFH VH E C   N  +  EN
Sbjct:  185 GALLDIVQRDSFAAPEKDIFQALMRWCRHNL----KEIHSEIMAAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENLATMKYGAQVVKGELRAALLDGDTQNYDLDHG---FSRHPIEDDCRSGIQVKLGQPSIINHIRLLLWDRDSRSYSYYIEVSMDELDWIRVIDHSQVLCRSWQKLYFPARVCRYIRIVGTHNTVNKVFHLVAFECLYTQRSFTLENGLIVPTENVATISECASVIEGVSRSRNALLNGDTRNYDWDSGYTCHQLGSGAIVVQLAQPFMIGSIRLLLWDCDDRSYSYYIEVSTNQQQWTMVADRTKVPCRSWQTITFDRQPTCFIRIVGTHNTANEVFHCVHFE-CPAQNVPHKEEN 568          
BLAST of BTB domain containing 9 vs. TrEMBL
Match: A0A2I0MAE0 (BTB (POZ) domain containing 9, transcript variant X2 OS=Columba livia OX=8932 GN=BTBD9 PE=4 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 5.670e-115
Identity = 191/393 (48.60%), Postives = 268/393 (68.19%), Query Frame = 1
Query: 1561 GALCCVIGRDSFCAPEITIFEAVVQWLELN-KSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLETCHHSNETNAIEN 2724
             AL  ++ RDSF APE  IF+A++ W + N K N+++     I+  VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IP EN+A  ++ A ++ G   +  +        +D     F  H I++  R  I I+LG PS IN IR+ L D + RSYSY ++VS+D++ W+ V D+ KY+CRSWQ LYF   V +YIRI+GT NTV + F ++ FEC++T+        + +P  NVA+I   A+VIEGVSRSRN+LLNG+TKNY+WDSGYTCHQLG+GAIVVQLAQPY++  IR LLWD DDRSYSY +EVST++ +W MVAD +   C S+Q + F +QP  FIRI+GT+N+ANEVFH VH E C   N T+  EN
Sbjct:  116 AALLSIVLRDSFAAPEKDIFQALMNWCKHNPKENHAE-----IMQAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKIRSESRDMDLNYRGMLIPGENIATMKYGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYYIEVSMDELDWIRVIDHSKYLCRSWQNLYFPARVCRYIRIVGTHNTVNKVFHIVAFECMFTNKTFTLEKGLIVPTENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPYMIGSIRLLLWDCDDRSYSYYIEVSTNQQQWTMVADCTKISCKSWQTITFDKQPASFIRIVGTHNTANEVFHCVHFE-CPAQNSTHKDEN 499          
BLAST of BTB domain containing 9 vs. TrEMBL
Match: A0A4W3GH25 (BTB domain-containing protein OS=Callorhinchus milii OX=7868 GN=btbd9 PE=4 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 6.697e-115
Identity = 192/379 (50.66%), Postives = 257/379 (67.81%), Query Frame = 1
Query: 1561 GALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
             AL  ++ RDSF APE  IF A+V W + N      +   +IL  VRL L+S ++LL  VRP  L++A++ILDA++  ++ +   L +RG++IPEEN+A  +  A II G   A  +        +D     F  H I++  R  I ++LG PS IN IR+ L D + RSYSY ++VS+D++ W+ V D+ KY+CRSWQ LYF P V +YIRI+GT NTV + F ++  ECL+T+        I +P  NVA+I   A+VIEGVSRSRN+LLNG+TKNY+WDSGYTCHQLG+GAIVVQLAQP+++  +R LLWD DDRSYSY +EVS +  KW MVAD +   C S+Q + F RQP+VFIRI+GTYN+ANEVFH VH E
Sbjct:  184 AALLSIVSRDSFAAPEKDIFLALVNWCKRNP----DETHPEILQAVRLPLMSLTELLNVVRPAALLSADTILDAIKIRSESRDMELNYRGMLIPEENIATLKHGAQIITGELRASLLDGDTQNYDLDHG---FSRHPIDDDCRSGICVKLGQPSIINHIRVLLWDRDSRSYSYYIEVSMDELDWIRVIDHSKYLCRSWQNLYFTPRVCRYIRIVGTHNTVNKVFHLVSLECLFTNEPFLLDSGILVPTENVATISESASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIVVQLAQPFMIASMRLLLWDCDDRSYSYYIEVSNNLQKWTMVADRTKVTCKSWQTINFDRQPMVFIRIVGTYNTANEVFHCVHFE 555          

HSP 2 Score: 85.1149 bits (209), Expect = 3.843e-13
Identity = 51/140 (36.43%), Postives = 76/140 (54.29%), Query Frame = 1
Query: 1822 GLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFEC 2241
            G+++P EN+A    +AS+I G   +         ++ D  DS +  H +   G IV++L  P  I  +R+ L D + RSYSY ++VS +   W  V D  K  C+SWQT+ FD   + +IRI+GT NT    F  + FEC
Sbjct:  419 GILVPTENVATISESASVIEGVSRSRNALLNGDTKNYDW-DSGYTCHQLG-SGAIVVQLAQPFMIASMRLLLWDCDDRSYSYYIEVSNNLQKWTMVADRTKVTCKSWQTINFDRQPMVFIRIVGTYNTANEVFHCVHFEC 556          
BLAST of BTB domain containing 9 vs. TrEMBL
Match: A0A1L8G6N4 (BTB domain-containing protein OS=Xenopus laevis OX=8355 GN=btbd9 PE=4 SV=1)

HSP 1 Score: 376.326 bits (965), Expect = 7.150e-115
Identity = 189/379 (49.87%), Postives = 264/379 (69.66%), Query Frame = 1
Query: 1561 GALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            GAL  ++ RDSF APE  IF+A+++W   N     ++I S+I++ VRL L+S ++LL  VRP+GL++ ++ILDA++  ++ +   L +RG++IPEENLA  ++ A ++ G   A  +        +D     F  H IE+  R  I ++LG PS IN IR+ L D + RSYSY ++VS+D++ W+ V D+   +CRSWQ L+F   V +YIRI+GT NTV + F ++ FECLYT       + + +P  NVA+I   A+VIEGVSRSRN+LLNG+T+NY+WDSGYTCHQLG+GAIVVQLAQP+++N IR LLWD DDRSYSY +EVST++ +W MVAD +   C S+Q + F RQP  FIRI+GT+N+ANEVFH VH E
Sbjct:  218 GALLDIVQRDSFAAPEKDIFQALMRWCRHNL----KEIHSEIMAAVRLPLMSLTELLNVVRPSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENLATMKYGAQVVKGELRAALLDGDTQNYDLDHG---FSRHPIEDDCRSGIQVKLGQPSIINHIRLLLWDRDSRSYSYYIEVSMDELDWIRVVDHSLVLCRSWQKLFFQARVCRYIRIVGTHNTVNKVFHLVAFECLYTHKSFTLENGLIVPTENVATIAECASVIEGVSRSRNALLNGDTRNYDWDSGYTCHQLGSGAIVVQLAQPFMINSIRLLLWDCDDRSYSYYIEVSTNQQQWTMVADRTKVPCRSWQTITFDRQPTCFIRIVGTHNTANEVFHCVHFE 589          

HSP 2 Score: 93.2041 bits (230), Expect = 1.320e-15
Identity = 58/152 (38.16%), Postives = 80/152 (52.63%), Query Frame = 1
Query: 1822 GLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDN 2277
            GL++P EN+A     AS+I G   +          + D  DS +  H +   G IV++L  P  IN IR+ L D + RSYSY ++VS +Q  W  V D  K  CRSWQT+ FD     +IRI+GT NT    F  + FEC    N+ H  ++
Sbjct:  453 GLIVPTENVATIAECASVIEGVSRSRNALLNGDTRNYDW-DSGYTCHQLG-SGAIVVQLAQPFMINSIRLLLWDCDDRSYSYYIEVSTNQQQWTMVADRTKVPCRSWQTITFDRQPTCFIRIVGTHNTANEVFHCVHFEC-PAQNVAHKEES 601          
BLAST of BTB domain containing 9 vs. Ensembl Cavefish
Match: btbd9 (BTB domain containing 9 [Source:NCBI gene;Acc:103022014])

HSP 1 Score: 358.992 bits (920), Expect = 3.316e-112
Identity = 178/379 (46.97%), Postives = 258/379 (68.07%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR---IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            AL  V+ RDSF A E  IF+A+ +W   N    +   + +++S VRL L+S S++L  VRP+GL++ + +LDA++  ++ +   L +RG++IPEEN+A  +  A ++ G   +  +        +D     F  H IEE+GR   I IRLG PS +N IRM L D + RSYSY ++VS+D++ WV V D+ K++CRSWQ LYF   V ++IR++GT NTV + F ++  EC++T         + +P+ NVA+++  A+V+EGVSR RN+LLNG+T +Y+WDSGYTCHQLG+GA+V+QLAQPY++N +R LLWD D+RSYSY VE+ST++ +WV V D +   C S+Q L F RQP  FIRI+GT+N+ANEVFH VH E
Sbjct:  185 ALLTVVRRDSFAASEREIFQALCRWCRHNGDGTA---SQEVMSAVRLPLMSLSEMLNVVRPSGLLSPDDLLDAIQTRSESRDMDLNYRGMLIPEENIATMKHGAVVVKGELKSALLDGDTQNYDLDHG---FSRHPIEEEGRATGIQIRLGQPSIVNHIRMLLWDKDSRSYSYYIEVSMDELDWVRVVDHSKFLCRSWQNLYFQARVCRFIRVVGTHNTVNKVFHLVALECMFTQRSFILESGLLVPSENVATVQACASVVEGVSRCRNALLNGDTSHYDWDSGYTCHQLGSGAVVIQLAQPYMLNSMRLLLWDCDERSYSYYVELSTNQQQWVRVVDRTRVACRSWQTLRFERQPASFIRIVGTHNTANEVFHCVHFE 557          

HSP 2 Score: 94.3597 bits (233), Expect = 1.922e-19
Identity = 54/140 (38.57%), Postives = 76/140 (54.29%), Query Frame = 1
Query: 1822 GLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFEC 2241
            GL++P EN+A  +  AS++ G              H D  DS +  H +   G +VI+L  P  +N +R+ L D + RSYSY V++S +Q  WV V D  +  CRSWQTL F+     +IRI+GT NT    F  + FEC
Sbjct:  421 GLLVPSENVATVQACASVVEGVSRCRNALLNGDTSHYDW-DSGYTCHQLG-SGAVVIQLAQPYMLNSMRLLLWDCDERSYSYYVELSTNQQQWVRVVDRTRVACRSWQTLRFERQPASFIRIVGTHNTANEVFHCVHFEC 558          
BLAST of BTB domain containing 9 vs. Ensembl Cavefish
Match: exosc7 (exosome component 7 [Source:ZFIN;Acc:ZDB-GENE-050417-47])

HSP 1 Score: 147.132 bits (370), Expect = 9.224e-39
Identity = 82/264 (31.06%), Postives = 140/264 (53.03%), Query Frame = 1
Query:   43 MQNLMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSS---DANKELQFKFD----------NCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKI 780
            M  + +S AEK++ +   +D+     +R+  RG   +R + +E          ++V+ G T VLV I  E  GKP P+ P EGY++F +D S     +   R  +E    + + L + +++   ++L  LCI P + CW++Y+D+L+++CDGNL D +S+ I  AL NT IPKV  S   +  KE++   D          N P  VT++KI  ++++DA  +E+ C+    + +I   G + C    G GS+   S+ EM ++
Sbjct:    1 MATVQVSEAEKVYIMHGVRDD-----LRVDGRGCEDYRHMEVETDVVSNTDGSAKVSLGHTDVLVGIKAEI-GKPKPAVPNEGYVEFFVDCSANATPEFEGRGGEELGVELSNTLYKVFNNRHSLDLRSLCICPGEHCWVLYIDVLLLQCDGNLFDAMSVAIKAALFNTRIPKVQVSEDEEGGKEIELSDDPYDCMRLDVTNVPCIVTLSKIGHRHVVDATLQEKACSVASLLISITHKGLVTCVRKLGVGSLDPDSIFEMTEV 258          
BLAST of BTB domain containing 9 vs. Ensembl Cavefish
Match: exosc8 (exosome component 8 [Source:NCBI gene;Acc:103041470])

HSP 1 Score: 89.3521 bits (220), Expect = 3.855e-19
Identity = 65/228 (28.51%), Postives = 96/228 (42.11%), Query Frame = 1
Query:  124 RLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVN--------SSDANKELQFKFDNCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLE 768
            R   R    FRP ++ +G        + V  G+T V+  I  E    P    P +GYI   +DL P   ++       E  +     + +    S II   DLCI   K CW++Y DI+ ++ DGN+LD   I +  ALKNT IPKV           D   +   + +  P+  +    D   LI     EE   +T  +TA++   D  C      GS  +A  L+
Sbjct:   23 RPDGRELGEFRPTTLNIGSIGTADGSAMVKIGNTTVICGIKAELSAPP-SDAPDKGYIVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIDGSKIIKKEDLCIEKSKLCWVLYCDIMCLDYDGNVLDACIITLLAALKNTQIPKVTINKETDLAEVDIEHKRHLQINKHPVSSSFAVFDDTVLIVDPTAEEESLATSVITAVVDEDDQLCAFHKPGGSSLSAEKLQ 249          
BLAST of BTB domain containing 9 vs. Ensembl Cavefish
Match: exosc8 (exosome component 8 [Source:NCBI gene;Acc:103041470])

HSP 1 Score: 89.3521 bits (220), Expect = 3.969e-19
Identity = 65/228 (28.51%), Postives = 96/228 (42.11%), Query Frame = 1
Query:  124 RLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVN--------SSDANKELQFKFDNCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLE 768
            R   R    FRP ++ +G        + V  G+T V+  I  E    P    P +GYI   +DL P   ++       E  +     + +    S II   DLCI   K CW++Y DI+ ++ DGN+LD   I +  ALKNT IPKV           D   +   + +  P+  +    D   LI     EE   +T  +TA++   D  C      GS  +A  L+
Sbjct:   22 RPDGRELGEFRPTTLNIGSIGTADGSAMVKIGNTTVICGIKAELSAPP-SDAPDKGYIVPNVDLPPLCSSRFRPGPPGEQAQAASQFIADVIDGSKIIKKEDLCIEKSKLCWVLYCDIMCLDYDGNVLDACIITLLAALKNTQIPKVTINKETDLAEVDIEHKRHLQINKHPVSSSFAVFDDTVLIVDPTAEEESLATSVITAVVDEDDQLCAFHKPGGSSLSAEKLQ 248          
BLAST of BTB domain containing 9 vs. Ensembl Cavefish
Match: exosc9 (exosome component 9 [Source:NCBI gene;Acc:103023601])

HSP 1 Score: 70.0922 bits (170), Expect = 3.715e-12
Identity = 55/173 (31.79%), Postives = 80/173 (46.24%), Query Frame = 1
Query:   43 MQNLMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVG--FNKSEVNAGDTRVLVNINFE--PDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKV 549
            M+   LS  E+ F L+A +++      RL  R  Y +R I I  G  +    V+ G TRVL  ++ E  P   P  S P EG + F ++LSP         +  E    +   L     +S  I+   LC+   +K W I VD+ V+  DGNL+D  SI   +AL +   P V
Sbjct:    1 MKETPLSACERTFLLKAVEEKK-----RLDGRQTYDYRNIRITFGTDYGCCTVSLGKTRVLAQVSCELVP---PKDSRPTEGIVFFNLELSPMASPAFQPNRQSELLVTLNRQLERCLRNSKCIDTESLCVVSGEKVWQIRVDVHVLNHDGNLMDAASIAAISALSHFRRPDV 165          
BLAST of BTB domain containing 9 vs. Ensembl Sea Lamprey
Match: btbd9 (BTB (POZ) domain containing 9 [Source:ZFIN;Acc:ZDB-GENE-040704-39])

HSP 1 Score: 357.066 bits (915), Expect = 4.167e-112
Identity = 185/381 (48.56%), Postives = 256/381 (67.19%), Query Frame = 1
Query: 1561 GALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQ----GRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            GAL  ++ RDSF APE  IF AVV W  +   N  +D   + ++ VRL L++ S+LL RVRP+GL++ ++ILDA++  +Q + + L +RG+++ EEN+A     A +  G   A  +    T   +D     F  H IE      G I +RLG P+ +N IRM L D + RSYSY ++VS+D+  WV V D+ ++ CRSWQ LYF   V +++RI+GT NTV R F V+ FEC++T+        + +P  NVA+I   A+VIEGVSRSRN+LLNG+T++Y+WD GYTCHQLG+GAIVVQLAQPYI+  +R LLWD DDRSYS+ VEVST++  W  VAD + + C S+Q + F ++PV FIRI+GT+N+ANEVFH VH E
Sbjct:  184 GALLRILSRDSFAAPERDIFSAVVAWC-VCGHNPGED-AREAVAAVRLPLMNLSELLDRVRPSGLLSPDAILDAIKARSQGRDSELNYRGVLLAEENVATLRHGAVVTQGELKAALLDGDTTTYDLDRG---FSRHPIEPDTSRGGAITVRLGTPAILNHIRMLLWDRDSRSYSYYIEVSMDEQDWVRVVDHSRHFCRSWQLLYFPARVCRFLRIVGTHNTVNRVFHVVAFECMFTNRPFVLEGGLVVPQENVATIVASASVIEGVSRSRNALLNGDTRHYDWDCGYTCHQLGSGAIVVQLAQPYIIGSMRLLLWDCDDRSYSFYVEVSTEQQTWHRVADRTKQACRSWQTITFDKRPVSFIRIVGTHNTANEVFHCVHFE 559          

HSP 2 Score: 93.5893 bits (231), Expect = 7.202e-20
Identity = 55/140 (39.29%), Postives = 77/140 (55.00%), Query Frame = 1
Query: 1822 GLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFEC 2241
            GL++P+EN+A    +AS+I G   +          H D  D  +  H +   G IV++L  P  I  +R+ L D + RSYS+ V+VS +Q +W  V D  K  CRSWQT+ FD   V +IRI+GT NT    F  + FEC
Sbjct:  423 GLVVPQENVATIVASASVIEGVSRSRNALLNGDTRHYDW-DCGYTCHQLG-SGAIVVQLAQPYIIGSMRLLLWDCDDRSYSFYVEVSTEQQTWHRVADRTKQACRSWQTITFDKRPVSFIRIVGTHNTANEVFHCVHFEC 560          
BLAST of BTB domain containing 9 vs. Ensembl Sea Lamprey
Match: exosc7 (exosome component 7 [Source:ZFIN;Acc:ZDB-GENE-050417-47])

HSP 1 Score: 135.191 bits (339), Expect = 2.505e-35
Identity = 86/276 (31.16%), Postives = 135/276 (48.91%), Query Frame = 1
Query:   52 LMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDL---SPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSS---DANKELQFKFD--NC--------PIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISSAVGMEMHKSL 816
            LMLS AEK F +   QD      +R   RG   FR + +E          + +  G T VLV +  E  G P    P EGY++F +D    S     +   R  ++    I S L  +++ +  ++L  LCI P ++CW++YVD+L++E  GN+ D  SI +  AL NT IP V+ S   +  +E++   D  +C        P  VT++KI  ++++DA  EE  C     M ++   G I      G GS+   S+  M++    VG+ +HK+L
Sbjct:    5 LMLSEAEKAFIVHGVQDG-----VRGDGRGCEDFRVVELETEVVSNTSGSARLRLGQTDVLVGVKAEL-GSPRLDCPDEGYLEFFVDCTTSSANATPEFEGRGGEDLSLEISSALQRSFAHAGCLDLRSLCILPRQQCWVLYVDVLLLEYGGNVFDAASIAVKAALFNTRIPTVHVSEDEEGVREIELSDDPYDCVRLEVARVPCIVTLSKIGQRHVVDASLEETCCCRASLMVSVTAAGAITGLRKAGPGSLHPDSVCHMIETGKRVGVSLHKAL 274          
BLAST of BTB domain containing 9 vs. Ensembl Sea Lamprey
Match: exosc8 (exosome component 8 [Source:ZFIN;Acc:ZDB-GENE-030131-1736])

HSP 1 Score: 81.2629 bits (199), Expect = 4.204e-17
Identity = 66/254 (25.98%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  124 RLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSD--------ANKELQFKFDNCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISSAV--GMEMHKSLIEYSSTVA 840
            R   R    FR  ++ +G        + V  G+T V+  +  E    P    P +G+I   ++L P    +       E  +     L +    S II L DLCI   K  W++Y D++ ++ DGN+LD  SI +  AL+N ++PKV  S           + L  K  N P+  + +  D   L+    +EE   S   +T +    D  C      GS  +A  ++   ++ AV  G E+ + L E   +V 
Sbjct:   26 RPDGRELGEFRVTTLNIGSLSTADGSALVKVGNTTVICGVKGE-LAAPTSEAPDQGFIVPNLELPPLCSPRFRPGPPGEQAQAASQFLADVIDSSHIIALQDLCIEKGKLAWVLYCDLMCLDYDGNILDACSIALLAALQNLTLPKVGVSKETGLAQVTVQERLPVKVGNYPVSTSFSIFDGTVLLVDPTDEEEALSCGMVTIVTDEEDQLCAVHKPGGSPLSAEQMQDC-VTRAVQRGAEVRRLLHETLKSVG 277          
BLAST of BTB domain containing 9 vs. Ensembl Yeast
Match: RRP45 (Exosome non-catalytic core component; involved in 3'-5' RNA processing and degradation in both the nucleus and the cytoplasm; has similarity to E. coli RNase PH and to human hRrp45p (PM/SCL-75, EXOSC9); protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002688])

HSP 1 Score: 65.0846 bits (157), Expect = 1.045e-11
Identity = 44/164 (26.83%), Postives = 72/164 (43.90%), Query Frame = 1
Query:   85 LQASQDENKFL------EIRLSNRGFYSFRPISIEVG--FNKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIE-AYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKV 549
            ++ S  E+KF+        RL  R F  FR + I  G  F    V  G+T+V   I+ +   +P    P EG      ++SP   ++  N       E + S +IE +   S  +++  LCI    KCW +  D+  ++CDG  +D   I +   L +   P +
Sbjct:    5 IEISASESKFILEALRQNYRLDGRSFDQFRDVEITFGKEFGDVSVKMGNTKVHCRISCQI-AQPYEDRPFEGLFVISTEISPMAGSQFENGNITGEDEVLCSRIIEKSVRRSGALDVEGLCIVAGSKCWAVRADVHFLDCDGGFIDASCIAVMAGLMHFKKPDI 167          
BLAST of BTB domain containing 9 vs. Ensembl Nematostella
Match: EDO39128 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAY3])

HSP 1 Score: 363.229 bits (931), Expect = 2.281e-114
Identity = 190/378 (50.26%), Postives = 252/378 (66.67%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAME--NQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR-IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDN-IQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            +L  +I RDSFCAPE+ IF AV  W+E+NK +  +DI S +L  VRL  IS  +L   VRPT L +A++ILD+++   + + + +  RG ++ +EN+A   +   +I G      +        +D     F  HLI +  + I I LG PS IN IRM L D + RSYSY ++VS+D   WVTV DY KY+CRSWQ L+F P VV+YIRIIGT N+V + F ++ FEC+Y+      SDN I +P+ NVA     A+VIEGVSRS N+LLNGETK Y+W+SGYTCHQ+G+G+IVVQLAQPY +  +R LLWD DDR YSY +EVSTDR  W  V D S+E C ++Q+L F   P+ FIRI+GT+N+ANEVFH VH E
Sbjct:  181 SLIDIIKRDSFCAPEVQIFRAVSDWIEVNKDSKEEDIES-VLQCVRLTQISLHELFHTVRPTKLYSADAILDSIKIKTESRVSEMNFRGHLVKDENIATSSYGTDVIEGEKRDGLLDNESLNYDLDRG---FSRHLIADGDKGICIALGRPSIINTIRMLLWDRDLRSYSYYIEVSIDNQDWVTVIDYSKYLCRSWQILHFAPRVVRYIRIIGTYNSVNKVFHLVHFECMYSTGSFKLSDNGIIVPSDNVAVPTASASVIEGVSRSWNALLNGETKCYDWNSGYTCHQVGSGSIVVQLAQPYFIGSMRLLLWDCDDRCYSYYIEVSTDRQHWTKVVDKSNEQCRAWQHLEFKPLPMTFIRIVGTHNTANEVFHCVHFE 554          

HSP 2 Score: 126.716 bits (317), Expect = 3.379e-30
Identity = 70/151 (46.36%), Postives = 94/151 (62.25%), Query Frame = 1
Query: 2254 NIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNG--AIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLETCHHS 2700
            N R H     + + N+A+  +   VIEG    R+ LL+ E+ NY+ D G++ H + +G   I + L +P I+N IR LLWD D RSYSY +EVS D   WV V D S  LC S+Q L+F  + V +IRIIGTYNS N+VFH+VH E C +S
Sbjct:  265 NFRGH----LVKDENIATSSYGTDVIEG--EKRDGLLDNESLNYDLDRGFSRHLIADGDKGICIALGRPSIINTIRMLLWDRDLRSYSYYIEVSIDNQDWVTVIDYSKYLCRSWQILHFAPRVVRYIRIIGTYNSVNKVFHLVHFE-CMYS 408          

HSP 3 Score: 87.8113 bits (216), Expect = 6.827e-18
Identity = 50/145 (34.48%), Postives = 77/145 (53.10%), Query Frame = 1
Query: 1807 RLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFEC 2241
            +L   G+++P +N+A P  +AS+I G   +         +  D  +S +  H +   G IV++L  P  I  +R+ L D + R YSY ++VS D+  W  V D     CR+WQ L F P+ + +IRI+GT NT    F  + FEC
Sbjct:  413 KLSDNGIIVPSDNVAVPTASASVIEGVSRSWNALLNGETKCYDW-NSGYTCHQVG-SGSIVVQLAQPYFIGSMRLLLWDCDDRCYSYYIEVSTDRQHWTKVVDKSNEQCRAWQHLEFKPLPMTFIRIVGTHNTANEVFHCVHFEC 555          
BLAST of BTB domain containing 9 vs. Ensembl Nematostella
Match: EDO34904 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMZ0])

HSP 1 Score: 115.161 bits (287), Expect = 1.547e-28
Identity = 73/263 (27.76%), Postives = 125/263 (47.53%), Query Frame = 1
Query:   43 MQNLMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANKELQFKF------------DNCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKI 780
            M +  LS  E+ F +  ++ +      R   R    +R   +E G        + +   DT +LV +  E  G+P    P  G ++F +D S     + + R  D+    +   L   YS+   I+LS L I   ++CW++YVD LV+EC GNL D +S+ +  AL NT IP V  S    E++ +             D  PI +T++KI  ++++DA + EE C+    + A+   G++      G G ++  ++ EML++
Sbjct:    1 MADAQLSVYEREFIISGAEQD-----YRSDGRSCEDYRYFEVETGIVSNTSGSARLRLSDTDILVGVKAEI-GEPNLLTPGCGRVEFFVDCSSNASVEFNGRSGDDLAADLMRSLDRTYSNKSAIDLSSLSIIHGQQCWVLYVDTLVLECGGNLYDALSLAVKAALYNTRIPNVTVSSDGGEVELEISDDPYDCHQLPPDQMPIIITLSKIGGRHVVDASQSEELCSDCHLLVAVNSCGNVCGQQKIGCGGLEPDTICEMLEV 257          
BLAST of BTB domain containing 9 vs. Ensembl Nematostella
Match: EDO34153 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ48])

HSP 1 Score: 87.0409 bits (214), Expect = 9.334e-19
Identity = 64/258 (24.81%), Postives = 114/258 (44.19%), Query Frame = 1
Query:  109 KFLE--IRLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVN--------SSDANKELQFKFDNCPIYVTVNKIDCKYLI-DADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISSAVGMEMHKSLIEYSST 834
            +FL+  IR   RG + FR   + VG        + V  G+T V+  +  E   +P    P +G+I   +DL P            E+ + + + +    ++S +I+L DLCI   K  W++Y+D++ ++ DGN+ D   I +  AL+NT +  V             NK++  K  + P+ VT    D  ++  D   EEE   S +    +  N  +      G   +    L E   +++   +E+ + LI+ + T
Sbjct:   16 QFLKENIRPDGRGLFDFRETILNVGSISTANGSALVKLGNTTVVCGVTAE-FAEPAADVPNKGFIVPNVDLPPLCSPSFRPGPPSEHAQVLSTFIDNLITNSQLIDLEDLCIVDGKLVWVLYIDLMCLDYDGNVADAAVIAMLAALQNTRLHTVTINEETETPEPSENKDIHLKLKSMPVAVTFGIFDDDHIYCDPTDEEERLASGKVSVVMTTNNKVVAVHKPGGPPLTQDKLQECFDVTTGRVLEVQQ-LIDAACT 271          
BLAST of BTB domain containing 9 vs. Ensembl Nematostella
Match: EDO40802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S657])

HSP 1 Score: 73.1738 bits (178), Expect = 4.435e-14
Identity = 71/261 (27.20%), Postives = 113/261 (43.30%), Query Frame = 1
Query:  127 LSNRGFYSFRPISIEVGFNKS--EVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANKELQFKFD---------NCPIYVTVNKIDCK--YLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEG-SVKTASLLEMLKISSAVGMEMHKSLIEYSSTVAATNENYVDN 867
            L  RG Y +R + I     +   EV  G TRVL  ++ E   KP  +   +G+I   ++LSP         +  E    +   +   Y +S  I+   LCI   +K W + VDI V++  GN+LD   I   TAL +   P V+ S     +  + D         + PI VT    D     L+D + +EE       M A+  + ++ C +  G G S++T  ++    I+     E+   LIE +  V A  + +V N
Sbjct:    2 LDGRGIYDYRKLRIAFSVERGHCEVQLGKTRVLAQVSCEIT-KPKTNRQTDGHIYINVELSPMASPAFEAGRMSELGVELNRFVERFYIESRAIDTESLCIVAGEKVWSVRVDIQVLDHSGNILDCACISAITALSHFRRPDVSVSGEEVTIHSEADRDPVPLSILHMPICVTFAFFDNGELLLVDPNDKEEAVMDGHMMMALNIHREV-CGAVMGGGVSLETDQIIRCSNIAVVKVAEI-TELIEKALAVDA-KQRFVTN 258          
BLAST of BTB domain containing 9 vs. Ensembl Nematostella
Match: EDO34155 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ50])

HSP 1 Score: 52.7582 bits (125), Expect = 1.421e-7
Identity = 43/208 (20.67%), Postives = 84/208 (40.38%), Query Frame = 1
Query:  244 GKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKK--CWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVN--------SSDANKELQFKFDNCPIYVTVNKIDCKYLI-DADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISSAVGMEMHKSLIEYSST 834
             +P    P +G+I   +DL P            E+ + + + +       ++I    + +    K   W++Y+D++ ++ DGN+ D   I +  AL+NT +  V             NK++  K  + P+ VT    D  ++  D   EEE   S +    +  N  +      G   +    L E   +++   +E+ + LI  + T
Sbjct:   20 AEPAADVPNKGFIVPNVDLPPLCSPSFRPGPPSEHAQVLSTFI------DNLITKRSMELLQHAKYLVWVLYIDLMCLDYDGNVADAAVIAMLAALQNTRLHTVTINEETETPEPSENKDIHLKLKSMPVAVTFGIFDDDHIYCDPTDEEERLASGKVSVVMTTNNKVVAVHKPGGPPLTQDKLQECFDVTTGRVLEV-QQLIHTACT 220          
BLAST of BTB domain containing 9 vs. Ensembl Medaka
Match: btbd9 (BTB domain containing 9 [Source:NCBI gene;Acc:101173522])

HSP 1 Score: 367.466 bits (942), Expect = 2.639e-115
Identity = 184/378 (48.68%), Postives = 258/378 (68.25%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAMENQLKAAR--LPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLE 2685
            AL  V+ RDSF A E  IF+A+ +W   ++     D T +++S+VRL L++ +++L  VRP+GLV+ + +LDA++ + ++    L +RG++IPEENLA  +  A ++ G   +  +        +D     F  H IEE GR  I ++LG PS IN IR+ L D + RSYSY V+VS+D++ WV V D+ K++CRSWQ LYF P V +Y+RI+GT NTV + F ++ FEC++T       + + +P  NVA+    A+V+EGVSRSRN+LLNG+T+NY+WDSGYTCHQLG+GAIV+QLAQPY V  +R LLWD D+RSYSY +EVSTD+  WV V D +   C S+Q L F +QP  FIRI+GT+N+ANEVFH VH E
Sbjct:  185 ALLTVVQRDSFAATEKDIFQALCRWCRHHQDG---DHTQEVMSVVRLPLMTLTEMLNVVRPSGLVSPDDLLDAIKTRSESRNMDLNYRGMLIPEENLATMKHGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIEEDGRAGIEVKLGQPSIINHIRLLLWDRDSRSYSYYVEVSMDELDWVRVVDHSKHLCRSWQNLYFTPRVCRYVRIVGTHNTVNKVFHLVAFECMFTSRSFTLENGLLVPAENVATTACCASVVEGVSRSRNALLNGDTRNYDWDSGYTCHQLGSGAIVIQLAQPYAVGSLRLLLWDCDERSYSYYIEVSTDQQHWVRVVDRTKVACRSWQTLTFDKQPASFIRIVGTHNTANEVFHCVHFE 556          
BLAST of BTB domain containing 9 vs. Ensembl Medaka
Match: btbd9 (BTB domain containing 9 [Source:NCBI gene;Acc:101173522])

HSP 1 Score: 152.14 bits (383), Expect = 3.213e-40
Identity = 85/208 (40.87%), Postives = 130/208 (62.50%), Query Frame = 1
Query: 1564 ALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAMENQLKAAR--LPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGR--IVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQ 2175
            AL  V+ RDSF A E  IF+A+ +W    + +   D T +++S+VRL L++ +++L  VRP+GLV+ + +LDA++ + ++    L +RG++IPEENLA  +  A ++ G   +  +        +D     F  H IEE GR  I ++LG PS IN IR+ L D + RSYSY V+VS+D++ WV V D+ K++CRSWQ LYF P V +
Sbjct:  124 ALLTVVQRDSFAATEKDIFQALCRWC---RHHQDGDHTQEVMSVVRLPLMTLTEMLNVVRPSGLVSPDDLLDAIKTRSESRNMDLNYRGMLIPEENLATMKHGAQVVKGELKSALLDGDTQNYDLDHG---FSRHPIEEDGRAGIEVKLGQPSIINHIRLLLWDRDSRSYSYYVEVSMDELDWVRVVDHSKHLCRSWQNLYFTPRVCR 325          

HSP 2 Score: 116.316 bits (290), Expect = 6.193e-28
Identity = 57/111 (51.35%), Postives = 77/111 (69.37%), Query Frame = 1
Query: 2284 IPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQL---GNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFT 2607
            IP  N+A+++H A V++G  +S  +LL+G+T+NY+ D G++ H +   G   I V+L QP I+N+IR LLWD D RSYSY VEVS D   WV V D+S  LC S+QNLYFT
Sbjct:  212 IPEENLATMKHGAQVVKGELKS--ALLDGDTQNYDLDHGFSRHPIEEDGRAGIEVKLGQPSIINHIRLLLWDRDSRSYSYYVEVSMDELDWVRVVDHSKHLCRSWQNLYFT 320          
BLAST of BTB domain containing 9 vs. Ensembl Medaka
Match: exosc7 (exosome component 7 [Source:NCBI gene;Acc:101160328])

HSP 1 Score: 149.443 bits (376), Expect = 1.406e-39
Identity = 85/278 (30.58%), Postives = 143/278 (51.44%), Query Frame = 1
Query:   43 MQNLMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSS---DANKELQFKFD----------NCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISSAVGMEMHKSLIE 822
            M  + +S AEK++ L   +D+     +R+  R    +R + +E          + V+ G T VLV I  E  GKP P  P EGY++F +D S     +   R  +E    + + L   +++ + I+L  LCI+  + CW++YVD+L+++CDGNL D +S+ I  AL NT IP+V+ S   +  KE++   D          N P  VT+ K+  ++++DA  +E+ C+    + A+   G + C    G GS+   S+ EM +    VG  +H  L++
Sbjct:    1 MATVKVSEAEKVYILHGIRDD-----LRVDGRSCEDYRHMEVETDVVSNTDGSARVSLGHTAVLVGIKAEI-GKPRPLVPDEGYLEFFVDCSANATPEFEGRGGEELGIELSNTLYRVFNNKNSIDLKGLCISAGEHCWVLYVDVLLLQCDGNLYDAISVAIKAALFNTKIPRVHMSSDDEGGKEVELSDDPFDCVRLSVENVPCIVTLCKVGHRHVVDATLQEKACSVASLIIAVTHRGTVTCVKKVGGGSLDPESIFEMTEAGKRVGKALHAPLMK 272          
BLAST of BTB domain containing 9 vs. Ensembl Medaka
Match: exosc8 (exosome component 8 [Source:NCBI gene;Acc:101168140])

HSP 1 Score: 80.4925 bits (197), Expect = 3.632e-16
Identity = 56/185 (30.27%), Postives = 77/185 (41.62%), Query Frame = 1
Query:  124 RLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANKELQFKFDNCPIYVTVNKIDCKYLIDADREEE 663
            R   R    FR  ++ +G        + V  G T V+  I  E    P    P +GYI   +DL P   ++       E  +     + +    S+II   DLCI   K CW++Y DI+ ++ DGN+LD   I +  ALKNT +PK                    VTVNK  CK  ID     E
Sbjct:    9 RPDGRELSEFRTTTLNIGSISTADGSALVKLGSTTVICGIKAE-LANPTVEAPGKGYIVPNVDLPPLCSSRFRPGPPGEQAQASSQFIADVIESSEIIKPEDLCIDRGKLCWVLYCDIMCLDYDGNILDACIIALLAALKNTRLPK--------------------VTVNKATCKPEIDLKERHE 172          
BLAST of BTB domain containing 9 vs. Ensembl Medaka
Match: exosc8 (exosome component 8 [Source:NCBI gene;Acc:101168140])

HSP 1 Score: 80.4925 bits (197), Expect = 4.204e-16
Identity = 56/185 (30.27%), Postives = 77/185 (41.62%), Query Frame = 1
Query:  124 RLSNRGFYSFRPISIEVGF-----NKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANKELQFKFDNCPIYVTVNKIDCKYLIDADREEE 663
            R   R    FR  ++ +G        + V  G T V+  I  E    P    P +GYI   +DL P   ++       E  +     + +    S+II   DLCI   K CW++Y DI+ ++ DGN+LD   I +  ALKNT +PK                    VTVNK  CK  ID     E
Sbjct:   23 RPDGRELSEFRTTTLNIGSISTADGSALVKLGSTTVICGIKAE-LANPTVEAPGKGYIVPNVDLPPLCSSRFRPGPPGEQAQASSQFIADVIESSEIIKPEDLCIDRGKLCWVLYCDIMCLDYDGNILDACIIALLAALKNTRLPK--------------------VTVNKATCKPEIDLKERHE 186          
BLAST of BTB domain containing 9 vs. Planmine SMEST
Match: SMESG000005263.1 (SMESG000005263.1)

HSP 1 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 388/389 (99.74%), Postives = 389/389 (100.00%), Query Frame = 1
Query: 1561 GALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAESILDAMENQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLETCHHSNETNAIENP 2727
            GALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAE+ILDAMENQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLETCHHSNETNAIENP
Sbjct:  183 GALCCVIGRDSFCAPEITIFEAVVQWLELNKSNYSQDITSQILSLVRLCLISSSDLLWRVRPTGLVAAENILDAMENQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHVDSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVSLDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQFECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKNYNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVSTDRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHLETCHHSNETNAIENP 571          
BLAST of BTB domain containing 9 vs. Planmine SMEST
Match: SMESG000042098.1 (SMESG000042098.1)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 277/277 (100.00%), Postives = 277/277 (100.00%), Query Frame = 1
Query:   43 MQNLMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGFNKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANKELQFKFDNCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISSAVGMEMHKSLIEYSSTVAATNENYVDNVL 873
            MQNLMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGFNKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANKELQFKFDNCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISSAVGMEMHKSLIEYSSTVAATNENYVDNVL
Sbjct:    1 MQNLMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGFNKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANKELQFKFDNCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISSAVGMEMHKSLIEYSSTVAATNENYVDNVL 277          
BLAST of BTB domain containing 9 vs. Planmine SMEST
Match: SMESG000042098.1 (SMESG000042098.1)

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 273/273 (100.00%), Postives = 273/273 (100.00%), Query Frame = 1
Query:   55 MLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGFNKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANKELQFKFDNCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISSAVGMEMHKSLIEYSSTVAATNENYVDNVL 873
            MLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGFNKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANKELQFKFDNCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISSAVGMEMHKSLIEYSSTVAATNENYVDNVL
Sbjct:    1 MLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGFNKSEVNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANKELQFKFDNCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISSAVGMEMHKSLIEYSSTVAATNENYVDNVL 273          
BLAST of BTB domain containing 9 vs. Planmine SMEST
Match: SMESG000042085.1 (SMESG000042085.1)

HSP 1 Score: 288.115 bits (736), Expect = 3.844e-91
Identity = 153/192 (79.69%), Postives = 165/192 (85.94%), Query Frame = 1
Query:  211 RVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANKELQFKFDNCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISS 786
            RVLVNINFEP+ KPLPSNPK+GYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSD INLSDLCITPFKKCWIIYVDILVM+CDGNLLDIVSIGINTALKNT          N  L+       I++  + IDCKYLIDADR EETC+ST+TMTA+  NGDIKCTSTDGEGSVKTASLLEMLK++S
Sbjct:   14 RVLVNINFEPECKPLPSNPKKGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDKINLSDLCITPFKKCWIIYVDILVMKCDGNLLDIVSIGINTALKNTMFHLF----VNGMLKLIL----IFLK-STIDCKYLIDADR-EETCSSTQTMTAVPSNGDIKCTSTDGEGSVKTASLLEMLKVNS 195          
BLAST of BTB domain containing 9 vs. Planmine SMEST
Match: SMESG000042085.1 (SMESG000042085.1)

HSP 1 Score: 285.034 bits (728), Expect = 4.198e-90
Identity = 151/192 (78.65%), Postives = 159/192 (82.81%), Query Frame = 1
Query:  211 RVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLLDIVSIGINTALKNTSIPKVNSSDANKELQFKFDNCPIYVTVNKIDCKYLIDADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISS 786
            RVLVNINFEP+ KPLPSNPK+GYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSD INLSDLCITPFKKCWIIYVDILVM+CDGNLLDIVSIGINTALKNT               F             IDCKYLIDADR EETC+ST+TMTA+  NGDIKCTSTDGEGSVKTASLLEMLK++S
Sbjct:   14 RVLVNINFEPECKPLPSNPKKGYIKFKIDLSPAIITKMSNRKADEYCEYIKSLLIEAYSDSDKINLSDLCITPFKKCWIIYVDILVMKCDGNLLDIVSIGINTALKNT--------------MFHL----------FIDCKYLIDADR-EETCSSTQTMTAVPSNGDIKCTSTDGEGSVKTASLLEMLKVNS 180          
The following BLAST results are available for this feature:
BLAST of BTB domain containing 9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BTBD97.572e-11848.85BTB domain containing 9 [Source:HGNC Symbol;Acc:HG... [more]
BTBD99.130e-11748.85BTB domain containing 9 [Source:HGNC Symbol;Acc:HG... [more]
BTBD99.130e-11748.85BTB domain containing 9 [Source:HGNC Symbol;Acc:HG... [more]
BTBD91.930e-11145.48BTB domain containing 9 [Source:HGNC Symbol;Acc:HG... [more]
EXOSC74.713e-4030.07exosome component 7 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of BTB domain containing 9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hpo-96.204e-7439.58pep chromosome:WBcel235:V:7234922:7237130:-1 gene:... [more]
exos-73.196e-1627.05EXOSome (Multiexonuclease complex) component [Sou... [more]
exos-94.785e-1027.57EXOSome (Multiexonuclease complex) component [Sou... [more]
exos-94.785e-1027.57EXOSome (Multiexonuclease complex) component [Sou... [more]
back to top
BLAST of BTB domain containing 9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BTBD92.127e-9444.62gene:FBgn0030228 transcript:FBtr0071497[more]
BTBD92.127e-9444.62gene:FBgn0030228 transcript:FBtr0334456[more]
Rrp421.454e-2526.88gene:FBgn0034065 transcript:FBtr0087206[more]
Rrp452.702e-1129.74gene:FBgn0030789 transcript:FBtr0344090[more]
Rrp452.702e-1129.74gene:FBgn0030789 transcript:FBtr0074355[more]
back to top
BLAST of BTB domain containing 9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
btbd93.430e-10946.17BTB (POZ) domain containing 9 [Source:ZFIN;Acc:ZDB... [more]
exosc71.619e-4131.65exosome component 7 [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
exosc86.925e-1628.17exosome component 8 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
exosc96.099e-1332.95exosome component 9 [Source:NCBI gene;Acc:450057][more]
back to top
BLAST of BTB domain containing 9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arsi5.635e-3930.80arylsulfatase family member I [Source:Xenbase;Acc:... [more]
erc27.408e-3940.89ELKS/RAB6-interacting/CAST family member 2 [Source... [more]
exosc85.908e-1324.15exosome component 8 [Source:NCBI gene;Acc:493300][more]
exosc86.954e-1324.15exosome component 8 [Source:NCBI gene;Acc:493300][more]
kdelr33.619e-830.07KDEL endoplasmic reticulum protein retention recep... [more]
back to top
BLAST of BTB domain containing 9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Btbd91.444e-11649.87BTB (POZ) domain containing 9 [Source:MGI Symbol;A... [more]
Btbd99.858e-11649.87BTB (POZ) domain containing 9 [Source:MGI Symbol;A... [more]
Btbd99.858e-11649.87BTB (POZ) domain containing 9 [Source:MGI Symbol;A... [more]
Btbd99.858e-11649.87BTB (POZ) domain containing 9 [Source:MGI Symbol;A... [more]
Btbd91.140e-10951.04BTB (POZ) domain containing 9 [Source:MGI Symbol;A... [more]
back to top
BLAST of BTB domain containing 9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96Q07|BTBD9_HUMAN4.384e-11648.85BTB/POZ domain-containing protein 9 OS=Homo sapien... [more]
sp|Q8C726|BTBD9_MOUSE6.896e-11549.87BTB/POZ domain-containing protein 9 OS=Mus musculu... [more]
sp|Q5PQR3|BTBD9_RAT2.512e-11449.60BTB/POZ domain-containing protein 9 OS=Rattus norv... [more]
sp|A4IFG2|BTBD9_BOVIN1.441e-11348.94BTB/POZ domain-containing protein 9 OS=Bos taurus ... [more]
sp|Q9W2S3|BTBD9_DROME2.132e-9344.62BTB/POZ domain-containing protein 9 OS=Drosophila ... [more]
back to top
BLAST of BTB domain containing 9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3Y0L52.534e-11850.65BTB domain-containing protein OS=Branchiostoma flo... [more]
B1WB701.553e-11549.23LOC100145760 protein OS=Xenopus tropicalis OX=8364... [more]
A0A2I0MAE05.670e-11548.60BTB (POZ) domain containing 9, transcript variant ... [more]
A0A4W3GH256.697e-11550.66BTB domain-containing protein OS=Callorhinchus mil... [more]
A0A1L8G6N47.150e-11549.87BTB domain-containing protein OS=Xenopus laevis OX... [more]
back to top
BLAST of BTB domain containing 9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btbd93.316e-11246.97BTB domain containing 9 [Source:NCBI gene;Acc:1030... [more]
exosc79.224e-3931.06exosome component 7 [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
exosc83.855e-1928.51exosome component 8 [Source:NCBI gene;Acc:10304147... [more]
exosc83.969e-1928.51exosome component 8 [Source:NCBI gene;Acc:10304147... [more]
exosc93.715e-1231.79exosome component 9 [Source:NCBI gene;Acc:10302360... [more]
back to top
BLAST of BTB domain containing 9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
btbd94.167e-11248.56BTB (POZ) domain containing 9 [Source:ZFIN;Acc:ZDB... [more]
exosc72.505e-3531.16exosome component 7 [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
exosc84.204e-1725.98exosome component 8 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
back to top
BLAST of BTB domain containing 9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RRP451.045e-1126.83Exosome non-catalytic core component; involved in ... [more]
back to top
BLAST of BTB domain containing 9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO391282.281e-11450.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349041.547e-2827.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341539.334e-1924.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408024.435e-1427.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341551.421e-720.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BTB domain containing 9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btbd92.639e-11548.68BTB domain containing 9 [Source:NCBI gene;Acc:1011... [more]
btbd93.213e-4040.87BTB domain containing 9 [Source:NCBI gene;Acc:1011... [more]
exosc71.406e-3930.58exosome component 7 [Source:NCBI gene;Acc:10116032... [more]
exosc83.632e-1630.27exosome component 8 [Source:NCBI gene;Acc:10116814... [more]
exosc84.204e-1630.27exosome component 8 [Source:NCBI gene;Acc:10116814... [more]
back to top
BLAST of BTB domain containing 9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005263.10.000e+099.74SMESG000005263.1[more]
SMESG000042098.10.000e+0100.00SMESG000042098.1[more]
SMESG000042098.10.000e+0100.00SMESG000042098.1[more]
SMESG000042085.13.844e-9179.69SMESG000042085.1[more]
SMESG000042085.14.198e-9078.65SMESG000042085.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026750 ID=SMED30026750|Name=BTB domain containing 9|organism=Schmidtea mediterranea sexual|type=transcript|length=2854bp
AGTAATAAAATTGTTTAAATATTTGCAAATTGTAAGAAAAGTATGCAAAA
TTTAATGTTGAGCAATGCTGAGAAGCTTTTTAGACTTCAGGCATCTCAAG
ATGAAAATAAATTTTTAGAAATTAGATTAAGTAATCGAGGTTTCTATAGT
TTTAGACCTATTTCAATTGAAGTAGGATTTAATAAAAGTGAAGTCAATGC
GGGTGATACACGAGTTTTAGTTAACATAAATTTTGAACCAGATGGAAAAC
CATTGCCTAGTAACCCAAAGGAAGGCTATATTAAATTTAAAATTGATCTA
TCTCCAGCAATTATTACTAAAATGTCAAACCGCAAAGCTGATGAATATTG
TGAATATATTAAATCTTTATTAATTGAAGCATACAGTGATTCAGATATAA
TAAATTTATCAGATTTATGCATCACTCCTTTCAAAAAATGTTGGATAATT
TATGTAGATATTTTGGTTATGGAGTGTGACGGTAACCTTTTGGATATTGT
TTCTATCGGAATCAATACCGCCCTTAAAAATACCAGTATTCCTAAAGTCA
ACAGTAGCGATGCAAATAAAGAATTACAATTTAAGTTTGACAACTGTCCG
ATTTATGTTACAGTGAATAAAATTGATTGTAAATATCTGATTGACGCTGA
TCGAGAAGAAGAAACCTGCACATCCACTCGAACGATGACAGCCATCCTTC
CAAATGGGGACATCAAATGTACATCGACAGACGGAGAAGGCAGTGTCAAA
ACTGCCAGTTTATTGGAAATGTTAAAGATTTCTTCTGCTGTTGGTATGGA
AATGCACAAATCTTTGATCGAGTATTCCAGCACGGTTGCCGCCACGAATG
AGAACTATGTTGATAATGTTTTGTGAATAAATACTTTTTACATTTGATAT
TTTTAAAAGATCTTTTTCTAATTTTCACCTCTGATTGCTGTTCAATTTGC
AATGGCATAAAGAAGTTTTCTATTGATTGACTATGAATCAAATGTTTTAT
TGATATTCATAGTCAGTCAATGAAAAAATTCTTTGTCATTGTAAAATAAA
AAAGCAATCAGAGGTGGAAACTAAAAAAAGTTCTTTCAATAATTAAAGTA
ATTTAACAATGCAACTCATCAATATAAGTAAAAGGTCTTGTAGAATCATA
ATGTATCGAGGGTTAGTTATATCACAACATGTTTTTAAAAAGATTGATTA
AATTGTTTTCTCTTCTATTTTTTCAGTTATATCAGCGCTTTCCGCGTAGA
CCTTTTCGAGTTATAATTACAGGAGTAATATAATAAATAAATATATAGTC
GGTGTCTTCATGTAAACAATTTCGAAAGTTGATGCAATTTAAACAAAAAA
ATCAATGAATCAACTATCTAACAATTGTATATTTGCAGAGATTATTAACT
ATTAATATTGCGAAATTCTGTAAGCCTATTTGTTCATTTAAAAATGTTAT
TTGAAATTGTTATAAAATACCTTCGTACATAATAAATAGATTCACTGTTA
CTACTAGTGAAATTGTTGTTGTCTAATGAGCCACTCAACTGACAGGTTTC
ATGTATTTAGGGAGCCCTATGTTGTGTTATTGGCCGTGATAGCTTTTGTG
CCCCAGAAATTACAATTTTTGAGGCGGTGGTACAATGGTTGGAACTCAAT
AAATCCAATTACAGTCAAGATATTACATCGCAAATTCTCTCTCTTGTGCG
CTTGTGTTTAATTTCCTCTTCAGATCTTCTTTGGAGGGTCCGACCCACAG
GCTTAGTAGCAGCTGAAAGCATTCTCGATGCAATGGAGAACCAGCTTAAA
GCTGCTCGTTTGCCCCATCGAGGACTAATGATCCCCGAAGAGAATCTCGC
CAAACCCGAATGGAATGCTTCAATAATCCATGGGGGACCCGACGCGATGT
GTATGAGTCAATATTGTACGCCTGAACATGTTGACTCTTCAGATTCAATT
TTTGGTGAGCACCTCATTGAAGAGCAAGGACGAATTGTGATTCGGCTGGG
AAATCCCAGTAAAATAAATTTGATCCGAATGCATCTGTTGGATCTAGAAG
GACGCTCATATTCCTACATTGTCGATGTATCTCTTGACCAAATATCATGG
GTAACCGTTACTGACTATCGTAAATATATTTGCCGCTCCTGGCAAACTCT
CTACTTTGACCCGATAGTTGTTCAATATATCAGAATCATTGGCACACGTA
ACACAGTCACCAGGACATTTACTGTGCTTCAATTTGAGTGTCTCTATACC
GACAATATTCGTCACCATTCTGATAACATTCAGATTCCCAATTACAACGT
GGCTTCCATTGAGCATCACGCTACTGTAATCGAGGGCGTAAGTAGGTCTA
GGAACTCTCTGTTGAATGGAGAAACTAAAAACTATAATTGGGACTCAGGA
TACACTTGTCACCAGCTGGGAAATGGCGCAATTGTTGTCCAATTAGCCCA
GCCCTACATTGTTAATTACATCAGGTTCTTGTTATGGGATCTGGATGATC
GTTCATATAGCTATACAGTTGAAGTGAGTACTGATCGCGCGAAATGGGTT
ATGGTAGCAGACAACAGTTCGGAATTATGCTCATCTTATCAAAACCTTTA
TTTCACCAGGCAACCTGTGGTCTTTATCAGAATTATTGGAACCTATAATT
CCGCCAATGAAGTATTTCATATCGTCCATCTGGAAACGTGCCACCATTCA
AATGAGACTAATGCAATTGAAAATCCCTAATAATAATCTTCTTTCCTTCC
TTTCTTCATTCTGTGTTAACCTCACTATTTATTACAGATCGATTCAATTG
ATATTTTTTGACTTTGTTTTTGGTATTTACTATTATCATATTTATTAATA
TCTC
back to top

protein sequence of SMED30026750-orf-1

>SMED30026750-orf-1 ID=SMED30026750-orf-1|Name=SMED30026750-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=278bp
MQNLMLSNAEKLFRLQASQDENKFLEIRLSNRGFYSFRPISIEVGFNKSE
VNAGDTRVLVNINFEPDGKPLPSNPKEGYIKFKIDLSPAIITKMSNRKAD
EYCEYIKSLLIEAYSDSDIINLSDLCITPFKKCWIIYVDILVMECDGNLL
DIVSIGINTALKNTSIPKVNSSDANKELQFKFDNCPIYVTVNKIDCKYLI
DADREEETCTSTRTMTAILPNGDIKCTSTDGEGSVKTASLLEMLKISSAV
GMEMHKSLIEYSSTVAATNENYVDNVL*
back to top

protein sequence of SMED30026750-orf-2

>SMED30026750-orf-2 ID=SMED30026750-orf-2|Name=SMED30026750-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=316bp
MENQLKAARLPHRGLMIPEENLAKPEWNASIIHGGPDAMCMSQYCTPEHV
DSSDSIFGEHLIEEQGRIVIRLGNPSKINLIRMHLLDLEGRSYSYIVDVS
LDQISWVTVTDYRKYICRSWQTLYFDPIVVQYIRIIGTRNTVTRTFTVLQ
FECLYTDNIRHHSDNIQIPNYNVASIEHHATVIEGVSRSRNSLLNGETKN
YNWDSGYTCHQLGNGAIVVQLAQPYIVNYIRFLLWDLDDRSYSYTVEVST
DRAKWVMVADNSSELCSSYQNLYFTRQPVVFIRIIGTYNSANEVFHIVHL
ETCHHSNETNAIENP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR001247ExoRNase_PH_dom1
IPR015847ExoRNase_PH_dom2
IPR020568Ribosomal_S5_D2-typ_fold
IPR000421FA58C
IPR008979Galactose-bd-like_sf
IPR011705BACK
Vocabulary: biological process
TermDefinition
GO:0050804modulation of synaptic transmission
GO:0050951sensory perception of temperature stimulus
GO:0060586multicellular organismal iron ion homeostasis
GO:1900242regulation of synaptic vesicle endocytosis
GO:0007616long-term memory
GO:0008344adult locomotory behavior
GO:0030162regulation of proteolysis
GO:0042428serotonin metabolic process
GO:0042748circadian sleep/wake cycle, non-REM sleep
GO:0042787protein ubiquitination involved in ubiquitin-dependent protein catabolic process
GO:0043161proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0048512circadian behavior
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0019005SCF ubiquitin ligase complex
Vocabulary: molecular function
TermDefinition
GO:0031625ubiquitin protein ligase binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000421Coagulation factor 5/8 C-terminal domainPFAMPF00754F5_F8_type_Ccoord: 67..140
e-value: 1.3E-6
score: 28.5
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 43..158
e-value: 2.9E-10
score: 42.3
coord: 180..311
e-value: 1.6E-12
score: 49.6
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 68..152
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 202..292
NoneNo IPR availablePANTHERPTHR46306FAMILY NOT NAMEDcoord: 3..305