Centriolar coiled-coil protein of 110 kDa

Overview
NameCentriolar coiled-coil protein of 110 kDa
Smed IDSMED30026738
Length (bp)3286
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Centriolar coiled-coil protein of 110 kDa (SMED30026738) t-SNE clustered cells

Violin plots show distribution of expression levels for Centriolar coiled-coil protein of 110 kDa (SMED30026738) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Centriolar coiled-coil protein of 110 kDa (SMED30026738) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Centriolar coiled-coil protein of 110 kDa (SMED30026738) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026738

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30026738SMESG000008964.1 SmedASXL_013110SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30026738SMESG000008964.1 dd_Smed_v4_13022_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30026738SMESG000008964.1 dd_Smed_v6_13022_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30026738SMESG000078509.1 SMESG000076652.1 SMESG000066165.1 SMESG000057427.1 SMESG000050587.1 SMESG000050353.1 SMESG000041546.1 SMESG000037212.1 SMESG000031049.1 SMESG000022704.1 SMESG000020698.1 SMESG000019334.1 SMESG000008964.1 SMESG000004687.1 Contig53170newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30026738SMESG000078509.1 SMESG000076652.1 SMESG000066165.1 SMESG000057427.1 SMESG000050587.1 SMESG000050353.1 SMESG000041546.1 SMESG000037212.1 SMESG000031049.1 SMESG000022704.1 SMESG000020698.1 SMESG000019334.1 SMESG000008964.1 SMESG000004687.1 Contig53170uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Human
Match: CCP110 (centriolar coiled-coil protein 110 [Source:HGNC Symbol;Acc:HGNC:24342])

HSP 1 Score: 57.7658 bits (138), Expect = 1.269e-7
Identity = 33/109 (30.28%), Postives = 59/109 (54.13%), Query Frame = 2
Query: 1352 KIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRH 1678
            +I+  F K TA+ KG++ R L +TDK++ +  T+KDT +     + E           P     VS ++     S Q+R+++QL+ AL  +H+IFF   ++ +M ++ H
Sbjct:  794 EIQAKFNKITAVAKGFLTRRLMQTDKLKQLRQTVKDTMEFIRSFQSEA----------PLKRGIVSAQD----ASLQERVLAQLRAALYGIHDIFFVMDAAERMSILHH 888          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Human
Match: CCP110 (centriolar coiled-coil protein 110 [Source:HGNC Symbol;Acc:HGNC:24342])

HSP 1 Score: 57.7658 bits (138), Expect = 1.327e-7
Identity = 34/111 (30.63%), Postives = 60/111 (54.05%), Query Frame = 2
Query: 1346 SPKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRH 1678
            S +I+  F K TA+ KG++ R L +TDK++ +  T+KDT +     + E           P     VS ++     S Q+R+++QL+ AL  +H+IFF   ++ +M ++ H
Sbjct:  792 SLEIQAKFNKITAVAKGFLTRRLMQTDKLKQLRQTVKDTMEFIRSFQSEA----------PLKRGIVSAQD----ASLQERVLAQLRAALYGIHDIFFVMDAAERMSILHH 888          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Human
Match: CCP110 (centriolar coiled-coil protein 110 [Source:HGNC Symbol;Acc:HGNC:24342])

HSP 1 Score: 57.7658 bits (138), Expect = 1.327e-7
Identity = 34/111 (30.63%), Postives = 60/111 (54.05%), Query Frame = 2
Query: 1346 SPKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRH 1678
            S +I+  F K TA+ KG++ R L +TDK++ +  T+KDT +     + E           P     VS ++     S Q+R+++QL+ AL  +H+IFF   ++ +M ++ H
Sbjct:  792 SLEIQAKFNKITAVAKGFLTRRLMQTDKLKQLRQTVKDTMEFIRSFQSEA----------PLKRGIVSAQD----ASLQERVLAQLRAALYGIHDIFFVMDAAERMSILHH 888          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Xenopus
Match: hpcal1 (hippocalcin-like 1 [Source:Xenbase;Acc:XB-GENE-947040])

HSP 1 Score: 67.781 bits (164), Expect = 1.105e-10
Identity = 37/111 (33.33%), Postives = 64/111 (57.66%), Query Frame = 2
Query: 1346 SPKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRH 1678
            SP ++  F K TAL KG++ R L +T+K++N+  T+KDTA+     + E           P +   VS ++     S Q+R+++QL++AL E+H+IFF    + +M ++ H
Sbjct:  761 SPAMQRKFNKATALAKGFLTRRLMQTEKLKNLKKTVKDTAEFMRTFQSEF----------PLSRGMVSSQD----ASLQERVLAQLRSALFEIHDIFFAMEPAERMNILAH 857          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Mouse
Match: Ccp110 (centriolar coiled coil protein 110 [Source:MGI Symbol;Acc:MGI:2141942])

HSP 1 Score: 60.077 bits (144), Expect = 1.717e-8
Identity = 34/110 (30.91%), Postives = 59/110 (53.64%), Query Frame = 2
Query: 1349 PKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRH 1678
            P+I   F K TA+ KG++ R L +TDK++ +  T+KDT +     + E           P     VS ++     S Q+R+++QL+ AL  +H+IFF   ++ +M ++ H
Sbjct:  622 PEIHAKFNKITAVAKGFLTRKLMQTDKLKQLRQTVKDTMEFIRSFQSEA----------PLKRGVVSAQD----ASLQERVLAQLRAALYGIHDIFFVMDAAERMSILHH 717          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Mouse
Match: Ccp110 (centriolar coiled coil protein 110 [Source:MGI Symbol;Acc:MGI:2141942])

HSP 1 Score: 59.6918 bits (143), Expect = 2.236e-8
Identity = 34/110 (30.91%), Postives = 59/110 (53.64%), Query Frame = 2
Query: 1349 PKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRH 1678
            P+I   F K TA+ KG++ R L +TDK++ +  T+KDT +     + E           P     VS ++     S Q+R+++QL+ AL  +H+IFF   ++ +M ++ H
Sbjct:  785 PEIHAKFNKITAVAKGFLTRKLMQTDKLKQLRQTVKDTMEFIRSFQSE----------APLKRGVVSAQD----ASLQERVLAQLRAALYGIHDIFFVMDAAERMSILHH 880          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Mouse
Match: Ccp110 (centriolar coiled coil protein 110 [Source:MGI Symbol;Acc:MGI:2141942])

HSP 1 Score: 59.6918 bits (143), Expect = 2.236e-8
Identity = 34/110 (30.91%), Postives = 59/110 (53.64%), Query Frame = 2
Query: 1349 PKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRH 1678
            P+I   F K TA+ KG++ R L +TDK++ +  T+KDT +     + E           P     VS ++     S Q+R+++QL+ AL  +H+IFF   ++ +M ++ H
Sbjct:  785 PEIHAKFNKITAVAKGFLTRKLMQTDKLKQLRQTVKDTMEFIRSFQSE----------APLKRGVVSAQD----ASLQERVLAQLRAALYGIHDIFFVMDAAERMSILHH 880          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. UniProt/SwissProt
Match: sp|Q7TSH4|CP110_MOUSE (Centriolar coiled-coil protein of 110 kDa OS=Mus musculus OX=10090 GN=Ccp110 PE=1 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.564e-7
Identity = 34/110 (30.91%), Postives = 59/110 (53.64%), Query Frame = 2
Query: 1349 PKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRH 1678
            P+I   F K TA+ KG++ R L +TDK++ +  T+KDT +     + E           P     VS ++     S Q+R+++QL+ AL  +H+IFF   ++ +M ++ H
Sbjct:  785 PEIHAKFNKITAVAKGFLTRKLMQTDKLKQLRQTVKDTMEFIRSFQSE----------APLKRGVVSAQD----ASLQERVLAQLRAALYGIHDIFFVMDAAERMSILHH 880          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. UniProt/SwissProt
Match: sp|O43303|CP110_HUMAN (Centriolar coiled-coil protein of 110 kDa OS=Homo sapiens OX=9606 GN=CCP110 PE=1 SV=3)

HSP 1 Score: 57.7658 bits (138), Expect = 6.096e-7
Identity = 33/109 (30.28%), Postives = 59/109 (54.13%), Query Frame = 2
Query: 1352 KIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRH 1678
            +I+  F K TA+ KG++ R L +TDK++ +  T+KDT +     + E           P     VS ++     S Q+R+++QL+ AL  +H+IFF   ++ +M ++ H
Sbjct:  794 EIQAKFNKITAVAKGFLTRRLMQTDKLKQLRQTVKDTMEFIRSFQSEA----------PLKRGIVSAQD----ASLQERVLAQLRAALYGIHDIFFVMDAAERMSILHH 888          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. TrEMBL
Match: A0A4D5RNZ2 (Putative nucleocytoplasmic transport chaperone srp40 (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.001e-14
Identity = 48/123 (39.02%), Postives = 68/123 (55.28%), Query Frame = 2
Query: 1349 PKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRHHINQLMSSTSNNL 1717
            PK + GF + TALV+G++ R L +TD+VQ II TIKDT + A+ L QE           P+         + E+    QRL++QL  A  ELH++FF  P   +MRLI    ++  S  +NNL
Sbjct:  384 PKWRRGFARLTALVRGHLTRRLMKTDRVQTIIQTIKDTLECALALHQE-----------PHIRCGTITSQDLEL---HQRLITQLTAACHELHDVFFRIPCGDRMRLIEQLRSKKTSDATNNL 492          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. TrEMBL
Match: A0A2H1C9R7 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_08688 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.126e-14
Identity = 44/114 (38.60%), Postives = 68/114 (59.65%), Query Frame = 2
Query: 1349 PKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSG------DSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLI 1672
            P++  GF    A  +G +VR L  T KV ++I T+KDTA+LA+ +  ERLS       + SL+ + ++    S   + E +  + RL+ QL+ ALG+LHE+FF WP S K+ L+
Sbjct:   94 PRVARGFTLLAAAFRGRLVRQLLATHKVCDLIRTVKDTAKLALSIHTERLSSFYQSTCNGSLLSNGHSVGQKSEGISSEELVLESRLMVQLRGALGQLHEVFFSWPLSNKLELL 207          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. TrEMBL
Match: A0A4D5RQ95 (Putative nucleocytoplasmic transport chaperone srp40 (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.047e-14
Identity = 48/123 (39.02%), Postives = 68/123 (55.28%), Query Frame = 2
Query: 1349 PKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRHHINQLMSSTSNNL 1717
            PK + GF + TALV+G++ R L +TD+VQ II TIKDT + A+ L QE           P+         + E+    QRL++QL  A  ELH++FF  P   +MRLI    ++  S  +NNL
Sbjct:  554 PKWRRGFARLTALVRGHLTRRLMKTDRVQTIIQTIKDTLECALALHQE-----------PHIRCGTITSQDLEL---HQRLITQLTAACHELHDVFFRIPCGDRMRLIEQLRSKKTSDATNNL 662          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. TrEMBL
Match: A0A4D5RK85 (Putative nucleocytoplasmic transport chaperone srp40 (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 6.269e-14
Identity = 47/123 (38.21%), Postives = 68/123 (55.28%), Query Frame = 2
Query: 1349 PKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRHHINQLMSSTSNNL 1717
            P+ + GF + TALV+G++ R L +TD+VQ II TIKDT + A+ L QE           P+         + E+    QRL++QL  A  ELH++FF  P   +MRLI    ++  S  +NNL
Sbjct:  393 PRWRRGFARLTALVRGHLTRRLMKTDRVQTIIQTIKDTLECALALHQE-----------PHIRCGTITSQDLEL---HQRLITQLTAACHELHDVFFRIPCGDRMRLIEQLRSKKTSDATNNL 501          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. TrEMBL
Match: A0A4E0RAA9 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_005463 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 9.223e-14
Identity = 44/114 (38.60%), Postives = 68/114 (59.65%), Query Frame = 2
Query: 1349 PKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSG------DSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLI 1672
            P++  GF    A  +G +VR L  T KV ++I T+KDTA+LA+ +  ERLS       + SL+ + ++    S   + E +  + RL+ QL+ ALG+LHE+FF WP S K+ L+
Sbjct:  372 PRVARGFTLLAAAFRGRLVRQLLATHKVCDLIRTVKDTAKLALSIHTERLSSFYQSTCNGSLLSNGHSVGQKSEGISSEELVLESRLMVQLRGALGQLHEVFFSWPLSNKLELL 485          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Cavefish
Match: ENSAMXT00000028505.2 (centriolar coiled-coil protein of 110 kDa-like [Source:NCBI gene;Acc:103030202])

HSP 1 Score: 61.6178 bits (148), Expect = 4.320e-9
Identity = 34/111 (30.63%), Postives = 64/111 (57.66%), Query Frame = 2
Query: 1337 ILESPKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRL 1669
            ++ +P+++    + TA+V+G++ R L +T+KV+N+  T+KDT        +E          +P    S++ ++    +S Q+R+ +QL+ AL ++H+IFFE   SL  RL
Sbjct:  549 LVLTPQLQKAMCRLTAIVQGFLTRQLLKTEKVKNLRQTVKDTQDFISSFHKE----------EPQKKGSLTEQD----LSLQERVRAQLRAALFDIHDIFFEM--SLDERL 643          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Medaka
Match: ENSORLT00000036607.1 (centriolar coiled-coil protein 110 [Source:NCBI gene;Acc:101175125])

HSP 1 Score: 59.6918 bits (143), Expect = 1.785e-8
Identity = 45/169 (26.63%), Postives = 80/169 (47.34%), Query Frame = 2
Query: 1151 DCRNVTQN----NPSNSSLHPVEKDTKAHINEILQIDLKKVPVSSVDVKLYRQKELSRIN-SKINCQILESPKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFE 1642
            +CR V  +    +PS   L PV   ++      L      V   SV + +Y        N S+    ++ + + +  F +  A+++G++VR L +T+KV+N+  TI DT +     + E     S       TY+        + +S Q+R+ +QL+ AL ++H+IFFE
Sbjct:  539 NCRCVNSSCPAISPSCPGLSPVRTPSELSPGHSLGFHNPSVTFPSVQLPVYLWGSTRGANKSRARLSLVLTAEQQRAFCRICAIIRGFLVRRLLKTEKVKNLRQTIVDTQEFIRSFQNEAEQKKS-------TYS-------EQDVSLQERVRAQLRAALYDIHDIFFE 693          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Medaka
Match: ENSORLT00000039886.1 (centriolar coiled-coil protein 110 [Source:NCBI gene;Acc:101175125])

HSP 1 Score: 59.6918 bits (143), Expect = 1.785e-8
Identity = 45/169 (26.63%), Postives = 80/169 (47.34%), Query Frame = 2
Query: 1151 DCRNVTQN----NPSNSSLHPVEKDTKAHINEILQIDLKKVPVSSVDVKLYRQKELSRIN-SKINCQILESPKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFE 1642
            +CR V  +    +PS   L PV   ++      L      V   SV + +Y        N S+    ++ + + +  F +  A+++G++VR L +T+KV+N+  TI DT +     + E     S       TY+        + +S Q+R+ +QL+ AL ++H+IFFE
Sbjct:  539 NCRCVNSSCPAISPSCPGLSPVRTPSELSPGHSLGFHNPSVTFPSVQLPVYLWGSTRGANKSRARLSLVLTAEQQRAFCRICAIIRGFLVRRLLKTEKVKNLRQTIVDTQEFIRSFQNEAEQKKS-------TYS-------EQDVSLQERVRAQLRAALYDIHDIFFE 693          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Medaka
Match: ENSORLT00000035661.1 (centriolar coiled-coil protein 110 [Source:NCBI gene;Acc:101175125])

HSP 1 Score: 59.3066 bits (142), Expect = 1.983e-8
Identity = 45/169 (26.63%), Postives = 80/169 (47.34%), Query Frame = 2
Query: 1151 DCRNVTQN----NPSNSSLHPVEKDTKAHINEILQIDLKKVPVSSVDVKLYRQKELSRIN-SKINCQILESPKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFE 1642
            +CR V  +    +PS   L PV   ++      L      V   SV + +Y        N S+    ++ + + +  F +  A+++G++VR L +T+KV+N+  TI DT +     + E     S       TY+        + +S Q+R+ +QL+ AL ++H+IFFE
Sbjct:  513 NCRCVNSSCPAISPSCPGLSPVRTPSELSPGHSLGFHNPSVTFPSVQLPVYLWGSTRGANKSRARLSLVLTAEQQRAFCRICAIIRGFLVRRLLKTEKVKNLRQTIVDTQEFIRSFQNEAEQKKS-------TYS-------EQDVSLQERVRAQLRAALYDIHDIFFE 667          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Planmine SMEST
Match: SMESG000008964.1 (SMESG000008964.1)

HSP 1 Score: 1926.37 bits (4989), Expect = 0.000e+0
Identity = 1015/1015 (100.00%), Postives = 1015/1015 (100.00%), Query Frame = 2
Query:   65 MNRYDEILQIFESQKLEILKLSDKVNELEETNAFLMTVLEKSKTLPPVYDPNLLRKDKAAAIQKEYSLNTIRRNNSHIDSTHCETTLNDSLDLITNNNPNSLRWSSDSLVNXXXXXXXXXXXXXNLKKLKNSSTADEIINNSSDKKSHQSLTKHENNLNLRISNSSPIRSQFLKPAVLCNNDKIHLSNEYSSDNKTSNSEDETDHEQDFLDSVIIKSVDDLINEVENLPISKTNANFSICQKSNGXXXXXXXXXXXXXXXXXMIPRTTEKENIQVLLDNLIDTLQTTNKAYSSHESYDNLKXXXXXXXXXXXXMNKLITQKNQYVSNINDKHAQMKLLMTAQQLQADLLHQSLEENSKILFKDCRNVTQNNPSNSSLHPVEKDTKAHINEILQIDLKKVPVSSVDVKLYRQKELSRINSKINCQILESPKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRHHINQLMSSTSNNLQTDYEDGNSIPATENYTSPREAKLSSATLKRRQKLALRSGNNNKESGIKNSISSASHRKPIYSSPYGCRGYGSGTNSRSTNVQSKITNDRKSRTNTISRRRGATRTITKFDINKITESPKSNPGSITNQPVKTSKSEVPTIQTVSNKSEEISDNQPHQQQSQSKSLTSIKHSQMQENSHSKCNIQSQPSSKSHVPKHFQNWIQPKTITTSICSPNSNNFVPFAKNLQKHLFIVRNQNPTNESKADGDSFEISPNHNKISTTGLSSNSGYTEGNINKYSEECDWKTQTYTLSTNITVTDDNFKHDISSPGIQTNKFSYNDDTSNRSCLSDFNEKSVSRVEVDVNDMDIGYLCRNNSSYYSEYNDPTESQSVVFVDVISKNHSTETDMHQNSRKPIIESPXXXXXXXXXXXXXXXQKHIKPNANNVVISNALNSSKPEFYFPTNTNGDILPVSSQFRIRKRIVAAN 3109
            MNRYDEILQIFESQKLEILKLSDKVNELEETNAFLMTVLEKSKTLPPVYDPNLLRKDKAAAIQKEYSLNTIRRNNSHIDSTHCETTLNDSLDLITNNNPNSLRWSSDSLVNKKIISSTTKSESINLKKLKNSSTADEIINNSSDKKSHQSLTKHENNLNLRISNSSPIRSQFLKPAVLCNNDKIHLSNEYSSDNKTSNSEDETDHEQDFLDSVIIKSVDDLINEVENLPISKTNANFSICQKSNGSPSPSKSLNQSSSLTSTMIPRTTEKENIQVLLDNLIDTLQTTNKAYSSHESYDNLKSSNNSESIYSEYMNKLITQKNQYVSNINDKHAQMKLLMTAQQLQADLLHQSLEENSKILFKDCRNVTQNNPSNSSLHPVEKDTKAHINEILQIDLKKVPVSSVDVKLYRQKELSRINSKINCQILESPKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRHHINQLMSSTSNNLQTDYEDGNSIPATENYTSPREAKLSSATLKRRQKLALRSGNNNKESGIKNSISSASHRKPIYSSPYGCRGYGSGTNSRSTNVQSKITNDRKSRTNTISRRRGATRTITKFDINKITESPKSNPGSITNQPVKTSKSEVPTIQTVSNKSEEISDNQPHQQQSQSKSLTSIKHSQMQENSHSKCNIQSQPSSKSHVPKHFQNWIQPKTITTSICSPNSNNFVPFAKNLQKHLFIVRNQNPTNESKADGDSFEISPNHNKISTTGLSSNSGYTEGNINKYSEECDWKTQTYTLSTNITVTDDNFKHDISSPGIQTNKFSYNDDTSNRSCLSDFNEKSVSRVEVDVNDMDIGYLCRNNSSYYSEYNDPTESQSVVFVDVISKNHSTETDMHQNSRKPIIESPNSNSSNKSNKRNFSFQKHIKPNANNVVISNALNSSKPEFYFPTNTNGDILPVSSQFRIRKRIVAAN
Sbjct:    1 MNRYDEILQIFESQKLEILKLSDKVNELEETNAFLMTVLEKSKTLPPVYDPNLLRKDKAAAIQKEYSLNTIRRNNSHIDSTHCETTLNDSLDLITNNNPNSLRWSSDSLVNKKIISSTTKSESINLKKLKNSSTADEIINNSSDKKSHQSLTKHENNLNLRISNSSPIRSQFLKPAVLCNNDKIHLSNEYSSDNKTSNSEDETDHEQDFLDSVIIKSVDDLINEVENLPISKTNANFSICQKSNGSPSPSKSLNQSSSLTSTMIPRTTEKENIQVLLDNLIDTLQTTNKAYSSHESYDNLKSSNNSESIYSEYMNKLITQKNQYVSNINDKHAQMKLLMTAQQLQADLLHQSLEENSKILFKDCRNVTQNNPSNSSLHPVEKDTKAHINEILQIDLKKVPVSSVDVKLYRQKELSRINSKINCQILESPKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRHHINQLMSSTSNNLQTDYEDGNSIPATENYTSPREAKLSSATLKRRQKLALRSGNNNKESGIKNSISSASHRKPIYSSPYGCRGYGSGTNSRSTNVQSKITNDRKSRTNTISRRRGATRTITKFDINKITESPKSNPGSITNQPVKTSKSEVPTIQTVSNKSEEISDNQPHQQQSQSKSLTSIKHSQMQENSHSKCNIQSQPSSKSHVPKHFQNWIQPKTITTSICSPNSNNFVPFAKNLQKHLFIVRNQNPTNESKADGDSFEISPNHNKISTTGLSSNSGYTEGNINKYSEECDWKTQTYTLSTNITVTDDNFKHDISSPGIQTNKFSYNDDTSNRSCLSDFNEKSVSRVEVDVNDMDIGYLCRNNSSYYSEYNDPTESQSVVFVDVISKNHSTETDMHQNSRKPIIESPNSNSSNKSNKRNFSFQKHIKPNANNVVISNALNSSKPEFYFPTNTNGDILPVSSQFRIRKRIVAAN 1015          
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Planmine SMEST
Match: SMESG000008964.1 (SMESG000008964.1)

HSP 1 Score: 1916.74 bits (4964), Expect = 0.000e+0
Identity = 1015/1027 (98.83%), Postives = 1015/1027 (98.83%), Query Frame = 2
Query:   65 MNRYDEILQIFESQKLEILKLSDKVNELEETNAFLMTVLEKSKTLPPVYDPNLLRKDKAAAIQKEYSLNTIRRNNSHIDSTHCETTLNDSLDLITNNNPNSLRWSSDSLVNXXXXXXXXXXXXXNLKKLKNSSTADEIINNSSDKKSHQSLTKHENNLNLRISNSSPIRSQFLKPAVLCNNDKIHLSNEYSSDNKTSNSEDETDHEQDFLDSVIIKSVDDLINEVENLPISKTNANFSICQKSNGXXXXXXXXXXXXXXXXXMIPRTTEKENIQVLLDNLIDTLQTTNKAYSSHESYDNLKXXXXXXXXXXXXMNKLITQKNQYVSNINDKHAQMKLLMTAQQLQADLLHQSLEENSKILFKDCRNVTQNNPSNSSLHPVEKDTKAHINEILQIDLKKVPVSSVDVKLYRQKELSRINSKINCQILESPKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRHHINQLMSSTSNNLQTDYEDGNSIPATENYTSPREAKLSSATLKRRQKLALR------------SGNNNKESGIKNSISSASHRKPIYSSPYGCRGYGSGTNSRSTNVQSKITNDRKSRTNTISRRRGATRTITKFDINKITESPKSNPGSITNQPVKTSKSEVPTIQTVSNKSEEISDNQPHQQQSQSKSLTSIKHSQMQENSHSKCNIQSQPSSKSHVPKHFQNWIQPKTITTSICSPNSNNFVPFAKNLQKHLFIVRNQNPTNESKADGDSFEISPNHNKISTTGLSSNSGYTEGNINKYSEECDWKTQTYTLSTNITVTDDNFKHDISSPGIQTNKFSYNDDTSNRSCLSDFNEKSVSRVEVDVNDMDIGYLCRNNSSYYSEYNDPTESQSVVFVDVISKNHSTETDMHQNSRKPIIESPXXXXXXXXXXXXXXXQKHIKPNANNVVISNALNSSKPEFYFPTNTNGDILPVSSQFRIRKRIVAAN 3109
            MNRYDEILQIFESQKLEILKLSDKVNELEETNAFLMTVLEKSKTLPPVYDPNLLRKDKAAAIQKEYSLNTIRRNNSHIDSTHCETTLNDSLDLITNNNPNSLRWSSDSLVNKKIISSTTKSESINLKKLKNSSTADEIINNSSDKKSHQSLTKHENNLNLRISNSSPIRSQFLKPAVLCNNDKIHLSNEYSSDNKTSNSEDETDHEQDFLDSVIIKSVDDLINEVENLPISKTNANFSICQKSNGSPSPSKSLNQSSSLTSTMIPRTTEKENIQVLLDNLIDTLQTTNKAYSSHESYDNLKSSNNSESIYSEYMNKLITQKNQYVSNINDKHAQMKLLMTAQQLQADLLHQSLEENSKILFKDCRNVTQNNPSNSSLHPVEKDTKAHINEILQIDLKKVPVSSVDVKLYRQKELSRINSKINCQILESPKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRHHINQLMSSTSNNLQTDYEDGNSIPATENYTSPREAKLSSATLKRRQKLALR            SGNNNKESGIKNSISSASHRKPIYSSPYGCRGYGSGTNSRSTNVQSKITNDRKSRTNTISRRRGATRTITKFDINKITESPKSNPGSITNQPVKTSKSEVPTIQTVSNKSEEISDNQPHQQQSQSKSLTSIKHSQMQENSHSKCNIQSQPSSKSHVPKHFQNWIQPKTITTSICSPNSNNFVPFAKNLQKHLFIVRNQNPTNESKADGDSFEISPNHNKISTTGLSSNSGYTEGNINKYSEECDWKTQTYTLSTNITVTDDNFKHDISSPGIQTNKFSYNDDTSNRSCLSDFNEKSVSRVEVDVNDMDIGYLCRNNSSYYSEYNDPTESQSVVFVDVISKNHSTETDMHQNSRKPIIESPNSNSSNKSNKRNFSFQKHIKPNANNVVISNALNSSKPEFYFPTNTNGDILPVSSQFRIRKRIVAAN
Sbjct:    1 MNRYDEILQIFESQKLEILKLSDKVNELEETNAFLMTVLEKSKTLPPVYDPNLLRKDKAAAIQKEYSLNTIRRNNSHIDSTHCETTLNDSLDLITNNNPNSLRWSSDSLVNKKIISSTTKSESINLKKLKNSSTADEIINNSSDKKSHQSLTKHENNLNLRISNSSPIRSQFLKPAVLCNNDKIHLSNEYSSDNKTSNSEDETDHEQDFLDSVIIKSVDDLINEVENLPISKTNANFSICQKSNGSPSPSKSLNQSSSLTSTMIPRTTEKENIQVLLDNLIDTLQTTNKAYSSHESYDNLKSSNNSESIYSEYMNKLITQKNQYVSNINDKHAQMKLLMTAQQLQADLLHQSLEENSKILFKDCRNVTQNNPSNSSLHPVEKDTKAHINEILQIDLKKVPVSSVDVKLYRQKELSRINSKINCQILESPKIKNGFVKFTALVKGYIVRTLRETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNHEIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRHHINQLMSSTSNNLQTDYEDGNSIPATENYTSPREAKLSSATLKRRQKLALRRSEGNFKHEIFKSGNNNKESGIKNSISSASHRKPIYSSPYGCRGYGSGTNSRSTNVQSKITNDRKSRTNTISRRRGATRTITKFDINKITESPKSNPGSITNQPVKTSKSEVPTIQTVSNKSEEISDNQPHQQQSQSKSLTSIKHSQMQENSHSKCNIQSQPSSKSHVPKHFQNWIQPKTITTSICSPNSNNFVPFAKNLQKHLFIVRNQNPTNESKADGDSFEISPNHNKISTTGLSSNSGYTEGNINKYSEECDWKTQTYTLSTNITVTDDNFKHDISSPGIQTNKFSYNDDTSNRSCLSDFNEKSVSRVEVDVNDMDIGYLCRNNSSYYSEYNDPTESQSVVFVDVISKNHSTETDMHQNSRKPIIESPNSNSSNKSNKRNFSFQKHIKPNANNVVISNALNSSKPEFYFPTNTNGDILPVSSQFRIRKRIVAAN 1027          
The following BLAST results are available for this feature:
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CCP1101.269e-730.28centriolar coiled-coil protein 110 [Source:HGNC Sy... [more]
CCP1101.327e-730.63centriolar coiled-coil protein 110 [Source:HGNC Sy... [more]
CCP1101.327e-730.63centriolar coiled-coil protein 110 [Source:HGNC Sy... [more]
back to top
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hpcal11.105e-1033.33hippocalcin-like 1 [Source:Xenbase;Acc:XB-GENE-947... [more]
back to top
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ccp1101.717e-830.91centriolar coiled coil protein 110 [Source:MGI Sym... [more]
Ccp1102.236e-830.91centriolar coiled coil protein 110 [Source:MGI Sym... [more]
Ccp1102.236e-830.91centriolar coiled coil protein 110 [Source:MGI Sym... [more]
back to top
BLAST of Centriolar coiled-coil protein of 110 kDa vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q7TSH4|CP110_MOUSE1.564e-730.91Centriolar coiled-coil protein of 110 kDa OS=Mus m... [more]
sp|O43303|CP110_HUMAN6.096e-730.28Centriolar coiled-coil protein of 110 kDa OS=Homo ... [more]
back to top
BLAST of Centriolar coiled-coil protein of 110 kDa vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D5RNZ24.001e-1439.02Putative nucleocytoplasmic transport chaperone srp... [more]
A0A2H1C9R75.126e-1438.60Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A4D5RQ956.047e-1439.02Putative nucleocytoplasmic transport chaperone srp... [more]
A0A4D5RK856.269e-1438.21Putative nucleocytoplasmic transport chaperone srp... [more]
A0A4E0RAA99.223e-1438.60Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
back to top
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000028505.24.320e-930.63centriolar coiled-coil protein of 110 kDa-like [So... [more]
back to top
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000036607.11.785e-826.63centriolar coiled-coil protein 110 [Source:NCBI ge... [more]
ENSORLT00000039886.11.785e-826.63centriolar coiled-coil protein 110 [Source:NCBI ge... [more]
ENSORLT00000035661.11.983e-826.63centriolar coiled-coil protein 110 [Source:NCBI ge... [more]
back to top
BLAST of Centriolar coiled-coil protein of 110 kDa vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000008964.10.000e+0100.00SMESG000008964.1[more]
SMESG000008964.10.000e+098.83SMESG000008964.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026738 ID=SMED30026738|Name=Centriolar coiled-coil protein of 110 kDa|organism=Schmidtea mediterranea sexual|type=transcript|length=3286bp
TTTTGAATCTGATTTATTATTTTCATTATCCTTTTATTTAAAAGATTTTA
TTAAAATAATTTAGATGAACAGGTATGACGAAATATTGCAAATATTCGAG
TCACAGAAACTAGAAATTCTAAAACTCTCTGATAAAGTTAATGAATTAGA
AGAAACTAACGCATTTCTAATGACAGTTTTAGAGAAATCTAAAACTCTTC
CCCCAGTTTATGATCCGAATTTATTACGTAAGGATAAAGCTGCTGCAATT
CAAAAAGAATATTCTCTTAATACAATTCGTCGAAACAATTCTCATATTGA
TTCAACACACTGTGAAACAACTTTAAATGACTCATTAGATTTAATAACAA
ACAATAATCCCAACTCACTGAGATGGTCAAGCGATTCTTTAGTTAACAAG
AAAATAATTAGCTCAACTACGAAATCAGAATCCATTAATTTAAAAAAATT
AAAAAATTCCAGCACTGCTGATGAGATTATTAATAATAGTTCTGATAAAA
AGTCTCACCAATCACTAACAAAACATGAAAATAACCTAAACCTGAGAATA
TCTAATTCATCGCCGATCAGAAGCCAATTTCTCAAACCAGCCGTATTATG
CAATAATGACAAAATTCATCTGTCCAATGAATACTCTAGTGACAATAAAA
CAAGCAACAGCGAAGACGAAACCGATCATGAACAGGATTTTCTCGACAGT
GTCATCATTAAAAGTGTCGACGATCTCATTAATGAAGTAGAGAACCTGCC
TATTTCGAAAACGAATGCAAACTTTAGCATTTGTCAAAAAAGCAATGGAT
CACCATCACCGTCAAAAAGCCTGAATCAATCGTCGTCTCTCACTAGCACA
ATGATACCACGGACAACCGAGAAGGAGAACATTCAAGTGCTCTTGGACAA
TCTAATCGACACATTACAAACCACTAACAAAGCATATAGTAGCCATGAAT
CGTATGACAATCTGAAATCATCCAATAATTCTGAATCAATTTATTCCGAA
TACATGAATAAATTGATCACTCAAAAAAATCAATATGTTTCAAATATAAA
CGACAAGCATGCTCAAATGAAACTTTTGATGACCGCTCAGCAGCTCCAAG
CCGATCTTTTGCATCAGTCATTGGAAGAAAATAGTAAAATATTATTCAAA
GATTGCCGAAATGTTACTCAAAATAACCCTTCAAATTCTTCTCTCCATCC
CGTTGAAAAAGATACCAAAGCTCATATTAATGAAATTTTGCAAATTGACT
TGAAAAAAGTCCCAGTTTCGTCAGTTGACGTGAAACTCTATCGGCAAAAA
GAATTATCTCGAATCAATAGTAAAATTAACTGCCAGATTTTGGAATCACC
GAAGATTAAAAATGGTTTCGTAAAATTTACAGCGTTAGTCAAAGGTTATA
TCGTACGGACGCTTCGAGAAACTGATAAAGTTCAAAATATTATTATAACA
ATTAAAGATACAGCGCAATTAGCTATAAAATTAAGACAGGAAAGATTATC
GGGTGACTCGTCTCTTATTGATGATCCTAACACATACAATTCAGTTTCGA
GGCGCAATAATCATGAGATTATATCTTTTCAACAACGATTAGTTTCACAG
TTAAAAACCGCACTCGGTGAATTACATGAAATCTTCTTTGAATGGCCTTC
GTCGTTAAAAATGCGCCTTATTCGTCACCATATCAATCAATTAATGTCTT
CAACGTCAAATAATCTACAAACTGACTACGAGGATGGAAATAGCATTCCA
GCAACGGAAAACTATACTTCACCAAGGGAAGCTAAGTTATCATCAGCAAC
TCTCAAACGACGCCAGAAATTAGCATTACGATCCGGAAATAATAATAAGG
AGAGTGGAATTAAGAATTCCATCTCCAGTGCGTCCCATAGAAAACCGATC
TATTCCTCACCATATGGATGCCGGGGATATGGTTCTGGAACGAATTCAAG
ATCCACAAATGTACAATCCAAGATTACCAATGATAGAAAATCCAGAACCA
ATACAATTTCTCGTAGAAGAGGTGCAACTAGAACAATCACAAAGTTTGAC
ATCAACAAAATCACTGAAAGTCCTAAGTCGAATCCGGGTTCAATTACGAA
TCAACCGGTTAAGACTTCAAAATCAGAGGTTCCGACAATTCAAACAGTTT
CGAACAAATCTGAGGAAATTTCCGATAATCAGCCACACCAACAACAATCA
CAGTCCAAGTCCCTTACTTCTATCAAGCATTCTCAAATGCAAGAAAATTC
ACATTCTAAATGCAACATCCAGTCTCAGCCTTCATCAAAATCTCATGTAC
CAAAACATTTCCAAAATTGGATACAACCTAAAACAATCACCACCAGTATA
TGTTCACCAAATTCTAATAATTTTGTGCCTTTTGCGAAAAATCTTCAAAA
ACATTTGTTTATTGTTCGAAATCAAAATCCAACCAATGAAAGTAAAGCTG
ACGGAGATTCATTTGAAATTTCGCCAAATCACAATAAAATCTCTACTACT
GGATTATCGAGTAATTCAGGATATACCGAAGGAAACATCAATAAGTATTC
TGAGGAATGTGATTGGAAAACTCAAACGTATACTCTGTCTACTAATATTA
CAGTTACGGATGACAATTTCAAACACGATATTTCTTCACCAGGAATACAG
ACGAATAAATTTTCATACAATGACGACACTTCCAATAGATCATGTCTTTC
TGATTTCAATGAGAAGAGCGTTTCAAGAGTTGAAGTTGACGTCAATGACA
TGGATATTGGATACCTTTGTCGGAATAATAGTTCCTATTATAGTGAATAT
AATGACCCAACAGAATCTCAGAGTGTGGTTTTTGTAGATGTGATATCCAA
AAATCATTCTACAGAAACAGATATGCATCAAAATTCTAGAAAACCCATAA
TTGAATCACCTAATTCTAATTCATCCAATAAATCAAATAAAAGAAATTTC
AGTTTCCAGAAACACATTAAACCCAATGCAAACAACGTTGTCATTTCCAA
TGCCCTAAACTCCTCTAAACCTGAATTCTATTTCCCCACCAACACTAATG
GTGATATCCTACCTGTATCATCCCAATTTAGAATCAGAAAGCGTATTGTG
GCGGCGAACAGCTTGCATTCCTCAACCGTTTCACACTCATAATAATTCTA
TATATTACAAATGCAATCCTTTCTTGTGCTGTAAATGTTTATTTTGATGG
CATTAAAAGTTATAGTGAAATGAATAAATTTTGATCGAGTATTTACAATG
TATTTTCAATTATTCGGGTTTTCATTGAGTACTGCA
back to top

protein sequence of SMED30026738-orf-1

>SMED30026738-orf-1 ID=SMED30026738-orf-1|Name=SMED30026738-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1026bp
MNRYDEILQIFESQKLEILKLSDKVNELEETNAFLMTVLEKSKTLPPVYD
PNLLRKDKAAAIQKEYSLNTIRRNNSHIDSTHCETTLNDSLDLITNNNPN
SLRWSSDSLVNKKIISSTTKSESINLKKLKNSSTADEIINNSSDKKSHQS
LTKHENNLNLRISNSSPIRSQFLKPAVLCNNDKIHLSNEYSSDNKTSNSE
DETDHEQDFLDSVIIKSVDDLINEVENLPISKTNANFSICQKSNGSPSPS
KSLNQSSSLTSTMIPRTTEKENIQVLLDNLIDTLQTTNKAYSSHESYDNL
KSSNNSESIYSEYMNKLITQKNQYVSNINDKHAQMKLLMTAQQLQADLLH
QSLEENSKILFKDCRNVTQNNPSNSSLHPVEKDTKAHINEILQIDLKKVP
VSSVDVKLYRQKELSRINSKINCQILESPKIKNGFVKFTALVKGYIVRTL
RETDKVQNIIITIKDTAQLAIKLRQERLSGDSSLIDDPNTYNSVSRRNNH
EIISFQQRLVSQLKTALGELHEIFFEWPSSLKMRLIRHHINQLMSSTSNN
LQTDYEDGNSIPATENYTSPREAKLSSATLKRRQKLALRSGNNNKESGIK
NSISSASHRKPIYSSPYGCRGYGSGTNSRSTNVQSKITNDRKSRTNTISR
RRGATRTITKFDINKITESPKSNPGSITNQPVKTSKSEVPTIQTVSNKSE
EISDNQPHQQQSQSKSLTSIKHSQMQENSHSKCNIQSQPSSKSHVPKHFQ
NWIQPKTITTSICSPNSNNFVPFAKNLQKHLFIVRNQNPTNESKADGDSF
EISPNHNKISTTGLSSNSGYTEGNINKYSEECDWKTQTYTLSTNITVTDD
NFKHDISSPGIQTNKFSYNDDTSNRSCLSDFNEKSVSRVEVDVNDMDIGY
LCRNNSSYYSEYNDPTESQSVVFVDVISKNHSTETDMHQNSRKPIIESPN
SNSSNKSNKRNFSFQKHIKPNANNVVISNALNSSKPEFYFPTNTNGDILP
VSSQFRIRKRIVAANSLHSSTVSHS*
back to top

protein sequence of SMED30026738-orf-2

>SMED30026738-orf-2 ID=SMED30026738-orf-2|Name=SMED30026738-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=308bp
MDAGDMVLERIQDPQMYNPRLPMIENPEPIQFLVEEVQLEQSQSLTSTKS
LKVLSRIRVQLRINRLRLQNQRFRQFKQFRTNLRKFPIISHTNNNHSPSP
LLLSSILKCKKIHILNATSSLSLHQNLMYQNISKIGYNLKQSPPVYVHQI
LIILCLLRKIFKNICLLFEIKIQPMKVKLTEIHLKFRQITIKSLLLDYRV
IQDIPKETSISILRNVIGKLKRILCLLILQLRMTISNTIFLHQEYRRINF
HTMTTLPIDHVFLISMRRAFQELKLTSMTWILDTFVGIIVPIIVNIMTQQ
NLRVWFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR033207CCP110
Vocabulary: cellular component
TermDefinition
GO:0005814centriole
Vocabulary: biological process
TermDefinition
GO:0007099centriole replication
GO:0032465regulation of cytokinesis
GO:0051298centrosome duplication
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 11..31
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 650..746
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 560..575
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 560..746
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 932..958
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 942..958
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 620..642
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 242..265
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 586..611
IPR033207Centriolar coiled-coil protein of 110kDaPANTHERPTHR13594FAMILY NOT NAMEDcoord: 268..647