KRR1 small subunit processome component

Overview
NameKRR1 small subunit processome component
Smed IDSMED30026733
Length (bp)1020
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of KRR1 small subunit processome component (SMED30026733) t-SNE clustered cells

Violin plots show distribution of expression levels for KRR1 small subunit processome component (SMED30026733) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of KRR1 small subunit processome component (SMED30026733) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for KRR1 small subunit processome component (SMED30026733) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026733

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026733h1SMcG0008614 SmedASXL_000752SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30026733h1SMcG0008614 dd_Smed_v4_30487_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of KRR1 small subunit processome component vs. Ensembl Human
Match: KRR1 (KRR1 small subunit processome component homolog [Source:HGNC Symbol;Acc:HGNC:5176])

HSP 1 Score: 191.43 bits (485), Expect = 3.043e-57
Identity = 116/267 (43.45%), Postives = 165/267 (61.80%), Query Frame = 3
Query:  168 VDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRLENDEIKEL--IEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLK-NKIHKQK 953
            + +P+ WK+  F  EDNP + L   S    L+PK  E YLKE +P +QK L+E+++ A L L++G M+V TT KTFDP+III+A  +I++LAR V +E+A+++LQ+DV  DII IG   R K+ F+KRR RL   +   L  +E + +C I   G +++ IG  S L  V+ +V D  + NIHPI+N+K   +    + D E+  + W   LP    K   KRK+P     KKEYTPFPP   ES+IDKEL SG + LK N+  +QK
Sbjct:   34 LTVPDGWKEPAFSKEDNP-RGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVVLDTMK-NIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQK 298          
BLAST of KRR1 small subunit processome component vs. Ensembl Human
Match: KRR1 (KRR1 small subunit processome component homolog [Source:HGNC Symbol;Acc:HGNC:5176])

HSP 1 Score: 155.221 bits (391), Expect = 6.086e-44
Identity = 83/189 (43.92%), Postives = 123/189 (65.08%), Query Frame = 3
Query:  168 VDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRLENDEIKEL--IEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLK 722
            + +P+ WK+  F  EDNP + L   S    L+PK  E YLKE +P +QK L+E+++ A L L++G M+V TT KTFDP+III+A  +I++LAR V +E+A+++LQ+DV  DII IG   R K+ F+KRR RL   +   L  +E + +C I   G +++ IG  S L  V+ +V D  + NIHPI+N+K
Sbjct:   34 LTVPDGWKEPAFSKEDNP-RGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVVLDTMK-NIHPIYNIK 220          
BLAST of KRR1 small subunit processome component vs. Ensembl Celegans
Match: krr-1 (KRR1 small subunit processome component [Source:UniProtKB/TrEMBL;Acc:O16311])

HSP 1 Score: 186.422 bits (472), Expect = 7.648e-56
Identity = 109/278 (39.21%), Postives = 171/278 (61.51%), Query Frame = 3
Query:  180 ENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRLENDEIKEL--IEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLL-------XXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLK---NKIHKQKNYFEPA 971
            E W    F  EDNP+  L   S    L+PK  EKY+KE +P ++K L E+++KA+L LL+G M VRTT KT+DP+II+KA  VI++L+R VPYE+AI++L++++Y +II I    R K+ F+KRR+RL  ++   L  +E +  C +   G ++  +G  + L ++  +V DC + NIHPI+N+K   +    S + E+   +W   L             K  K+KK + ++ KKE+TPFPPAPV SKIDK++ESG + ++    K++K++   E +
Sbjct:   43 EWWDINTFSKEDNPNG-LLQESSFSSLFPKYREKYIKESWPLIEKALGEHFLKADLDLLEGTMCVRTTRKTWDPYIIMKAREVIKLLSRSVPYEQAIRVLEDEIYCEIIKISSMVRNKERFVKRRARLIGNDGATLKALELLTQCYVCVQGGTVCAVGPLAGLKQINQIVTDCMK-NIHPIYNIKTMMIKRELSKNDELKDANWDAYLPNYRKKVQSATTTKEAKKKKAYKMKPKKEFTPFPPAPVMSKIDKQIESGEYFIRENERKMNKKRAKLEAS 318          
BLAST of KRR1 small subunit processome component vs. Ensembl Fly
Match: dbe (gene:FBgn0020305 transcript:FBtr0078030)

HSP 1 Score: 192.971 bits (489), Expect = 1.427e-58
Identity = 113/276 (40.94%), Postives = 175/276 (63.41%), Query Frame = 3
Query:  168 VDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRL--ENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNKIHKQKNYFEPADKKR 983
            VD   + K   FR EDNPH  +   S    L+PK  E+YLKE++P +++ L+E+++KAEL L++G M V+T+ KT+DP+IIIKA  +I+++AR VP+E+A ++LQ+D+  DII IG+   KK+ F+KRR RL   N    + IE +  C +   G +++ +G +  L +V+ +V +   NN+HPI+N+K   +      DP +A +DWS  LP    K   KRK+P   ++KKEYTPFPP+  ESK+DK+L SG + L  +  + K   E  +K++
Sbjct:   16 VDNAWSMKIPAFRQEDNPHG-MVEESSFATLFPKYRERYLKEVWPLVEQCLAEHHLKAELDLMEGSMVVKTSRKTWDPYIIIKARDMIKLMARSVPFEQAKRVLQDDIGCDIIKIGNLVHKKEKFVKRRQRLIGPNGATLKSIELLTDCYVLVQGNTVSALGPYKGLQQVRDIVLETM-NNVHPIYNIKALMIKRELMKDPRLANEDWSRFLPKFKNKNISKRKQPKVKKQKKEYTPFPPSQPESKVDKQLASGEYFLNQEQKQAKRNQERTEKQK 289          
BLAST of KRR1 small subunit processome component vs. Ensembl Zebrafish
Match: krr1 (KRR1 small subunit processome component homolog [Source:ZFIN;Acc:ZDB-GENE-060623-10])

HSP 1 Score: 189.119 bits (479), Expect = 2.250e-56
Identity = 112/268 (41.79%), Postives = 163/268 (60.82%), Query Frame = 3
Query:  174 IPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRLENDEIKEL--IEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNKIHKQKNYFE 965
            +P++WK+  F   DNP K L   S    L+PK  E YLKE +P +QK L+E +I A L L++G M+V TT KTFDP+ II+A  +I++LAR VP+E+A+++L +D+  DII IG   R ++ F+KRR RL   +   L  +E + +C +   G +++ +G  + L  V+ +V D  + NIHPI+N+K   +    + DPE+  + W   LP    K   KRK+P   R KKEYTPFPP   ESKIDKEL +G F L+    ++K   E
Sbjct:   46 VPDDWKEPKFTKADNP-KGLLEESSFATLFPKYREAYLKECWPLVQKALAELFINATLDLIEGSMTVNTTKKTFDPYSIIRARDLIKLLARSVPFEQAVRILDDDMACDIIKIGTLVRNRERFVKRRQRLIGPKGSTLKALELLTNCYVMVQGNTVSALGPFNGLKEVRKVVLDTMK-NIHPIYNIKTLMIKRELANDPELRTQSWGRFLPNFRHKSLSKRKQPKKKRVKKEYTPFPPPQPESKIDKELATGEFFLRESEKRRKKMSE 311          
BLAST of KRR1 small subunit processome component vs. Ensembl Xenopus
Match: slc39a5 (solute carrier family 39 (zinc transporter), member 5 [Source:Xenbase;Acc:XB-GENE-952069])

HSP 1 Score: 202.216 bits (513), Expect = 1.946e-61
Identity = 115/270 (42.59%), Postives = 168/270 (62.22%), Query Frame = 3
Query:  168 VDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRLENDEIKEL--IEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNKIHKQKNYFE 965
            + +P+ WK+ PF  EDNP + L   S    L+PK  E YLKE +P +QK L+E ++KAEL L++G M+V TT KTFDP++I++A  +I++LAR VP+E+A+++LQ+D+  DII IG   R ++ F+KRR RL   +   L  +E + +C I   G +++ +G  S L  V+ +V D  + NIHPI+N+K   +    + DPE+  K W   LP    K   KRK+P     KK+YTPFPP   ES+IDKEL SG + LK    ++K   E
Sbjct:   35 LTVPDGWKEDPFTKEDNP-RGLLEESSFATLFPKYREAYLKECWPLVQKALNESFVKAELDLIEGSMTVTTTKKTFDPYVIVRARDLIKLLARSVPFEQAVRILQDDMACDIIKIGSLVRNRERFIKRRQRLLGPKGSTLKALELLTNCYIMVQGNTVSALGPFSGLKEVRKVVWDTMK-NIHPIYNIKALMIKRELAKDPELRSKSWERFLPQFKHKNVSKRKEPKKKSVKKDYTPFPPPQPESQIDKELASGEYFLKESQKRRKKLEE 302          
BLAST of KRR1 small subunit processome component vs. Ensembl Xenopus
Match: slc39a5 (solute carrier family 39 (zinc transporter), member 5 [Source:Xenbase;Acc:XB-GENE-952069])

HSP 1 Score: 201.445 bits (511), Expect = 2.852e-61
Identity = 114/266 (42.86%), Postives = 167/266 (62.78%), Query Frame = 3
Query:  168 VDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRLENDEIKEL--IEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNKIHKQK 953
            + +P+ WK+ PF  EDNP + L   S    L+PK  E YLKE +P +QK L+E ++KAEL L++G M+V TT KTFDP++I++A  +I++LAR VP+E+A+++LQ+D+  DII IG   R ++ F+KRR RL   +   L  +E + +C I   G +++ +G  S L  V+ +V D  + NIHPI+N+K   +    + DPE+  K W   LP    K   KRK+P     KK+YTPFPP   ES+IDKEL SG + LK    ++K
Sbjct:   30 LTVPDGWKEDPFTKEDNP-RGLLEESSFATLFPKYREAYLKECWPLVQKALNESFVKAELDLIEGSMTVTTTKKTFDPYVIVRARDLIKLLARSVPFEQAVRILQDDMACDIIKIGSLVRNRERFIKRRQRLLGPKGSTLKALELLTNCYIMVQGNTVSALGPFSGLKEVRKVVWDTMK-NIHPIYNIKALMIKRELAKDPELRSKSWERFLPQFKHKNVSKRKEPKKKSVKKDYTPFPPPQPESQIDKELASGEYFLKESQKRRK 293          
BLAST of KRR1 small subunit processome component vs. Ensembl Mouse
Match: Krr1 (KRR1, small subunit (SSU) processome component, homolog (yeast) [Source:MGI Symbol;Acc:MGI:1289274])

HSP 1 Score: 192.2 bits (487), Expect = 8.964e-58
Identity = 114/266 (42.86%), Postives = 164/266 (61.65%), Query Frame = 3
Query:  168 VDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRLENDEIKEL--IEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNKIHKQK 953
            + +P+ WK+  F  EDNP + L   S    L+PK  E YLKE +P +QK L+E+++KA L L++G M+V TT KTFDP+III+A  +I++LAR V +E+A+++LQ+DV  DII IG   R K+ F+KRR RL   +   L  +E + +C +   G +++ IG  S L  V+ +V D  + NIHPI+N+K   +    + D E+  + W   LP    K   KRK+P     KKEYTPFPP   ES+IDKEL SG + LK    K++
Sbjct:   33 LTVPDGWKEPAFSKEDNP-RGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVKATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYVMVQGNTVSAIGPFSGLKEVRKVVLDTMK-NIHPIYNIKTLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKSVKKEYTPFPPPQPESQIDKELASGEYFLKASQKKRQ 296          
BLAST of KRR1 small subunit processome component vs. Ensembl Mouse
Match: Krr1 (KRR1, small subunit (SSU) processome component, homolog (yeast) [Source:MGI Symbol;Acc:MGI:1289274])

HSP 1 Score: 157.147 bits (396), Expect = 6.478e-45
Identity = 84/190 (44.21%), Postives = 125/190 (65.79%), Query Frame = 3
Query:  168 VDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRL---ENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLK 722
            + +P+ WK+  F  EDNP + L   S    L+PK  E YLKE +P +QK L+E+++KA L L++G M+V TT KTFDP+III+A  +I++LAR V +E+A+++LQ+DV  DII IG   R K+ F+KRR RL   +   +K L E + +C +   G +++ IG  S L  V+ +V D  + NIHPI+N+K
Sbjct:   33 LTVPDGWKEPAFSKEDNP-RGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVKATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKAL-ELLTNCYVMVQGNTVSAIGPFSGLKEVRKVVLDTMK-NIHPIYNIK 219          
BLAST of KRR1 small subunit processome component vs. UniProt/SwissProt
Match: sp|B4JDU5|KRR1_DROGR (KRR1 small subunit processome component homolog OS=Drosophila grimshawi OX=7222 GN=dbe PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 7.445e-59
Identity = 111/254 (43.70%), Postives = 166/254 (65.35%), Query Frame = 3
Query:  201 FRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRL--ENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNKIHKQ 950
            F+ EDNPH  +   S    L+PK  EKYLKE++P +Q+ ++E++++AEL L++G M V+TT KT+DP+IIIK+  +I+++AR VP+E+A ++LQ++   DII IG+   KK+ F+KRR RL   N    + IE +  C +   G ++A +G +  L +V+ +V +   NN+HPI+N+K   +      DP++A +DWS  LP    K   KRK+P + + K EYTPFPPA  ESKIDK+L SG + L NK  KQ
Sbjct:   28 FKAEDNPHG-MVEESSFATLFPKYREKYLKEVWPLVQQTVAEHHLRAELDLIEGSMVVKTTRKTWDPYIIIKSRDMIKLMARSVPFEQAKRVLQDETGCDIIKIGNLVHKKEKFVKRRQRLIGPNGATLKSIELLTDCYVLVQGNTVAALGPYKGLQQVRDIVLETM-NNVHPIYNIKALMIKRELMKDPQLANEDWSRFLPKFKNKNISKRKQPKSRKPKGEYTPFPPAQPESKIDKQLASGEYFL-NKEQKQ 278          
BLAST of KRR1 small subunit processome component vs. UniProt/SwissProt
Match: sp|B4KF66|KRR1_DROMO (KRR1 small subunit processome component homolog OS=Drosophila mojavensis OX=7230 GN=dbe PE=3 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 2.234e-58
Identity = 115/254 (45.28%), Postives = 167/254 (65.75%), Query Frame = 3
Query:  201 FRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRL--ENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNKIHKQ 950
            F+ EDNPH  L   S    L+PK  EKYLKE++P +++ L+E+++KAEL L++G M V+TT KT+DP+IIIK+  +I+++AR VP+E+A ++LQ+D   DII IG+   KK+ F+KRR RL   N    + IE +  C +   G +++ +G +  L +V+ +V D   NN+HPI+N+K   +      DP++AG+DWS  LP    K   KRK+P N + KKEYTPFPP   ESKIDK+L +G + L NK  KQ
Sbjct:   28 FKPEDNPHG-LVEESSFATLFPKYREKYLKEVWPLVEQCLAEHHLKAELDLIEGSMVVKTTRKTWDPYIIIKSRDMIKLMARSVPFEQAKRVLQDDTGCDIIKIGNLVHKKEKFVKRRQRLIGPNGATLKSIELLTDCYVLVQGNTVSALGPYKGLQQVRDIVLDTM-NNVHPIYNIKALMIKRELMKDPKLAGEDWSRFLPKFKNKNISKRKQPKNKKPKKEYTPFPPQQPESKIDKQLATGEYFL-NKEQKQ 278          
BLAST of KRR1 small subunit processome component vs. UniProt/SwissProt
Match: sp|B3N899|KRR1_DROER (KRR1 small subunit processome component homolog OS=Drosophila erecta OX=7220 GN=dbe PE=3 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 6.693e-58
Identity = 111/265 (41.89%), Postives = 171/265 (64.53%), Query Frame = 3
Query:  201 FRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRL--ENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNKIHKQKNYFEPADKKR 983
            FR EDNPH  +   S    L+PK  E+YLKE++P +++ L+E+++KAEL L++G M VRT+ KT+DP+IIIKA  +I+++AR VP+E+A ++LQ+D+  DII IG+   KK+ F+KRR RL   N    + IE +  C +   G +++ +G +  L +V+ +V +   NN+HPI+N+K   +      DP +A +DWS  LP    K   KRK+P   ++KKEYTPFPP+  ESK+DK+L SG + L  +  + K   E  +K++
Sbjct:   27 FREEDNPHG-MVEESSFATLFPKYRERYLKEVWPLVEQCLAEHHLKAELDLMEGSMVVRTSRKTWDPYIIIKARDMIKLMARSVPFEQAKRVLQDDIGCDIIKIGNLVHKKEKFVKRRQRLIGPNGATLKSIELLTDCYVLVQGNTVSALGPYKGLQQVRDIVLETM-NNVHPIYNIKALMIKRELMKDPRLANEDWSRFLPKFKNKNISKRKQPKVKKQKKEYTPFPPSQPESKVDKQLASGEYFLNQEQKQAKRNQERTEKQK 289          
BLAST of KRR1 small subunit processome component vs. UniProt/SwissProt
Match: sp|Q9VPU8|KRR1_DROME (KRR1 small subunit processome component homolog OS=Drosophila melanogaster OX=7227 GN=dbe PE=1 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.431e-57
Identity = 113/276 (40.94%), Postives = 175/276 (63.41%), Query Frame = 3
Query:  168 VDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRL--ENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNKIHKQKNYFEPADKKR 983
            VD   + K   FR EDNPH  +   S    L+PK  E+YLKE++P +++ L+E+++KAEL L++G M V+T+ KT+DP+IIIKA  +I+++AR VP+E+A ++LQ+D+  DII IG+   KK+ F+KRR RL   N    + IE +  C +   G +++ +G +  L +V+ +V +   NN+HPI+N+K   +      DP +A +DWS  LP    K   KRK+P   ++KKEYTPFPP+  ESK+DK+L SG + L  +  + K   E  +K++
Sbjct:   16 VDNAWSMKIPAFRQEDNPHG-MVEESSFATLFPKYRERYLKEVWPLVEQCLAEHHLKAELDLMEGSMVVKTSRKTWDPYIIIKARDMIKLMARSVPFEQAKRVLQDDIGCDIIKIGNLVHKKEKFVKRRQRLIGPNGATLKSIELLTDCYVLVQGNTVSALGPYKGLQQVRDIVLETM-NNVHPIYNIKALMIKRELMKDPRLANEDWSRFLPKFKNKNISKRKQPKVKKQKKEYTPFPPSQPESKVDKQLASGEYFLNQEQKQAKRNQERTEKQK 289          
BLAST of KRR1 small subunit processome component vs. UniProt/SwissProt
Match: sp|B4P2Y8|KRR1_DROYA (KRR1 small subunit processome component homolog OS=Drosophila yakuba OX=7245 GN=dbe PE=3 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 2.303e-57
Identity = 111/254 (43.70%), Postives = 167/254 (65.75%), Query Frame = 3
Query:  201 FRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRL--ENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNKIHKQ 950
            FR EDNPH  +   S    L+PK  E+YLKE++P +++ LSE+++KAEL L++G M V+T+ KT+DP+IIIKA  +I+++AR VP+E+A ++LQ+D+  DII IG+   KK+ F+KRR RL   N    + IE +  C +   G +++ +G +  L +V+ +V +   NN+HPI+N+K   +      DP +A +DWS  LP    K   KRK+P   ++KKEYTPFPP+  ESK+DK+L SG + L N+  KQ
Sbjct:   27 FRQEDNPHG-VVEESSFATLFPKYRERYLKEVWPLVEQCLSEHHLKAELDLMEGSMVVKTSRKTWDPYIIIKARDMIKLMARSVPFEQAKRVLQDDIGCDIIKIGNLVHKKEKFVKRRQRLIGPNGATLKSIELLTDCYVLVQGNTVSALGPYKGLQQVRDIVLETM-NNVHPIYNIKALMIKRELMKDPRLANEDWSRFLPKFKNKNISKRKQPKVKKQKKEYTPFPPSQPESKVDKQLASGEYFL-NQEQKQ 277          
BLAST of KRR1 small subunit processome component vs. TrEMBL
Match: A0A075AIP0 (KRR1 small subunit processome component OS=Opisthorchis viverrini OX=6198 GN=T265_01901 PE=3 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 2.145e-74
Identity = 131/289 (45.33%), Postives = 189/289 (65.40%), Query Frame = 3
Query:   72 YPYVKGWVPFQGLKIAQXXXXXXXXXXXXXXXVDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGHRKKDTFLKRRSRL---ENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHL 929
            +P V+GWVP+             ++   +    ++P++WK+  F+ EDNPH RLFA+S    L+PK  EKY+KEI+P L+KVL E++I+AEL L +  M VRTTPKTFDPFII+KA  V+R+LAR VP+E+AI++LQ+D++ D+I I    ++ F+KRR+RL   E + +K L E   +C I   GK+++ IG + +L +V+ +V  C  +NIHP +++KR  +I    ADP      W   LP + KK   +R+KPH VR+KKEYTPFPP    SK+D ELE GT+ L
Sbjct:   12 FPDVQGWVPYTAF--------SKNRDSSEPTYAEVPKDWKEPEFKPEDNPHGRLFALSSFITLFPKYREKYIKEIWPALKKVLLEHHIRAELDLTESSMEVRTTPKTFDPFIILKARDVMRLLARSVPFEQAIRVLQDDIFSDVIEINLTNRERFIKRRNRLIGYEGETLKAL-ELSTNCYIVVQGKTVSAIGHYEDLKQVRKIVLGCIYDNIHPAYSIKRLLIIKKLQADPTKKDVSWDRFLPKLKKKVLSRRRKPHKVRKKKEYTPFPPPITPSKVDIELEKGTYFL 291          
BLAST of KRR1 small subunit processome component vs. TrEMBL
Match: A0A4S2LMD0 (KRR1 small subunit processome component OS=Opisthorchis felineus OX=147828 GN=CRM22_006192 PE=3 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 4.047e-74
Identity = 134/289 (46.37%), Postives = 193/289 (66.78%), Query Frame = 3
Query:   72 YPYVKGWVPFQGLKIAQXXXXXXXXXXXXXXXVDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGHRKKDTFLKRRSRL---ENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHL 929
            +P V+GWVP+       K+K EL     ++   ++P++WK+  F+ EDNPH RLFA+S    L+PK  EKY+KEI+P L+KVL E++I+AEL L +  M VRTTPKTFDPFII+KA  V+R+LAR VP+E+AI++LQ+D++ D+I I    ++ F+KRR+RL   E + +K L E   +C I   GK+++ IG + +L +V+ +V  C  +NIHP +++KR  +I    ADP      W   LP + KK   +R+KPH VR+KK+YTPFPP    SK+D ELE GT+ L
Sbjct:   12 FPDVQGWVPYTAF---SKNKQELLGDSSETTYAEVPKDWKEPEFKPEDNPHGRLFALSSFITLFPKYREKYIKEIWPALKKVLLEHHIRAELDLTESSMEVRTTPKTFDPFIILKARDVMRLLARSVPFEQAIRVLQDDIFSDVIEINLTNRERFIKRRNRLIGYEGETLKAL-ELSTNCYIVVQGKTVSAIGHYEDLKQVRKIVLGCIYDNIHPAYSIKRLLIIKKLQADPTKKDVSWDRFLPKLKKKVLSRRRKPHKVRKKKDYTPFPPPITPSKVDIELEKGTYFL 296          
BLAST of KRR1 small subunit processome component vs. TrEMBL
Match: A0A3R7JZM5 (KRR1 small subunit processome component OS=Clonorchis sinensis OX=79923 GN=KRR1 PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 4.327e-74
Identity = 135/289 (46.71%), Postives = 193/289 (66.78%), Query Frame = 3
Query:   72 YPYVKGWVPFQGLKIAQXXXXXXXXXXXXXXXVDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGHRKKDTFLKRRSRL---ENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHL 929
            +P V+GWVP+       K+K EL     ++   ++P++WK+  F+ EDNPH RLFA+S    L+PK  EKY+KEI+P L+KVL E++I+AEL L +  M VRTTPKTFDPFII+KA  V+R+LAR VP+E+AI++LQ+D++ D+I I    ++ F+KRR+RL   E + +K L E   +C I   GK+++ IG + +L +V+ +V  C  +NIHP +++KR  +I    ADP      W   LP + KK   +R+KPH VR+KKEYTPFPP    SK+D ELE GT+ L
Sbjct:   56 FPDVQGWVPYTAF---SKNKQELLGDSSETTYAEVPKDWKEPEFKPEDNPHGRLFALSSFITLFPKYREKYIKEIWPALKKVLLEHHIRAELDLTESSMEVRTTPKTFDPFIILKARDVMRLLARSVPFEQAIRVLQDDIFSDVIEINLTNRERFIKRRNRLIGYEGETLKAL-ELSTNCYIVVQGKTVSAIGHYEDLKQVRKIVLGCIYDNIHPAYSIKRLLIIKKLQADPTKKDVSWDRFLPKLKKKVLSRRRKPHKVRKKKEYTPFPPPITPSKVDIELEKGTYFL 340          
BLAST of KRR1 small subunit processome component vs. TrEMBL
Match: A0A3Q0KC66 (KRR1 small subunit processome component OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 3.060e-73
Identity = 125/288 (43.40%), Postives = 184/288 (63.89%), Query Frame = 3
Query:   72 YPYVKGWVPFQGLKIAQXXXXXXXXXXXXXXXVDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGHRKKDTFLKRRSRL--ENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHL 929
            +P V GWVP++     +  +    +        ++P++WK+  F  EDNPH RLFA S    L+PK  EKYL EI+P L++++ E++I+ E+ + +  M VRTTPKTFDPFII+KA  VIR+LAR VP E+AI++L ++ + DII I    ++ F+KRR+RL   + E  + +E   +C I   GK+++V+G +++L  V+ +V  C  +NIHP +++KR  +I   S DP      W   LP + KK   +R+KPH VR+KKEY PFPP PV+SKID ELE GT+ L
Sbjct:   12 FPVVPGWVPYKAFSAKKLHEVSEPQY------AEVPKDWKEPKFNPEDNPHGRLFASSSYTTLFPKYREKYLTEIWPVLRRIMMEHHIRVEIDVAESTMEVRTTPKTFDPFIILKARDVIRLLARSVPMEQAIRVLDDETFADIIEINLTNRERFVKRRNRLIGHDGETLKALELSTNCYIVVQGKTVSVVGRYNDLKEVRKIVQGCIYDNIHPAYSIKRLLIIKKLSMDPTKQNISWDRFLPKMKKKVLSRRRKPHKVRKKKEYNPFPPPPVQSKIDIELEKGTYFL 293          
BLAST of KRR1 small subunit processome component vs. TrEMBL
Match: A0A4E0REH8 (KRR1 small subunit processome component OS=Fasciola hepatica OX=6192 GN=D915_008732 PE=3 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 4.830e-73
Identity = 133/292 (45.55%), Postives = 192/292 (65.75%), Query Frame = 3
Query:   63 TSKYPYVKGWVPFQGLKIAQXXXXXXXXXXXXXXXVDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGHRKKDTFLKRRSRL---ENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHL 929
            T  +P V+GW P++      K+K EL K     E V++P++WK+  F+ EDNP+ RLFA S    L+PK  EKY+KEI+P L+KVL E++I+ EL L +  M VRTTPKTFDPFII+KA  VIR+LAR VP+E+AI++LQ+D++ DII I    ++ F+KRR+RL   E + +K L E   +  I   GK+++ +G + +L +V+ +V  C  +N+HP +++KR  ++     DP      W   LP + KK   +R KPH +R+KKEYTPFPPAP+ SK+D EL  GT+ L
Sbjct:    9 TLNFPEVQGWTPYKAF---SKNKEELFKDLPSHEYVEVPKDWKEPEFKPEDNPYGRLFAASSYATLFPKYREKYIKEIWPALKKVLLEHHIRGELDLTESSMEVRTTPKTFDPFIILKARDVIRLLARSVPFEQAIRVLQDDIFADIIEINLTNRERFIKRRNRLIGYEGETLKAL-ELSTNSYIVIQGKTVSAVGRYEDLKQVRKIVWGCIYDNVHPAYSIKRLLIVKKLQTDPTKQNISWDRFLPKLKKKVLSRRHKPHKIRKKKEYTPFPPAPIPSKVDIELAKGTYFL 296          
BLAST of KRR1 small subunit processome component vs. Ensembl Cavefish
Match: krr1 (KRR1 small subunit processome component homolog [Source:NCBI gene;Acc:103033892])

HSP 1 Score: 193.356 bits (490), Expect = 3.071e-58
Identity = 113/280 (40.36%), Postives = 170/280 (60.71%), Query Frame = 3
Query:  168 VDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRLENDEIKEL--IEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNKIHKQKNYFEPADKKRKIND 995
            + +P+ WK+  F   DNP + L   S    L+PK  E YLKE +P +QK L E +I A L L++G ++V TT KTFDP+ I++A  +I++LAR VP+E+A+++LQ+D+  DII IG   R ++ F+KRR RL   +   L  +E + +C +   G +++V+G HS L  V+ +V D  + NIHPI+N+K   +    ++DPE+  + W   LP    K   KR+KP   + KKEYTPFPP   ESK+D+EL SG F L+          E   ++RK+N+
Sbjct:   35 LTVPDGWKEPEFTWADNP-RGLLEESSFATLFPKYREAYLKECWPLVQKALGEIFINASLDLIEGSITVSTTKKTFDPYAILRARDLIKLLARSVPFEQAVRILQDDMACDIIKIGTLVRNRERFVKRRQRLIGPKGSTLKALELLSNCYVLVQGNTVSVLGPHSGLKEVRKVVLDTMK-NIHPIYNIKTLMIKRELASDPELRSQSWDRFLPKFKHKSLAKRQKPKKKKVKKEYTPFPPPQPESKVDRELASGEFFLR----------ESEKRRRKLNE 302          
BLAST of KRR1 small subunit processome component vs. Ensembl Yeast
Match: KRR1 (Nucleolar protein required for rRNA synthesis and ribosomal assembly; required for the synthesis of 18S rRNA and for the assembly of 40S ribosomal subunit; essential gene [Source:SGD;Acc:S000000564])

HSP 1 Score: 169.474 bits (428), Expect = 1.208e-50
Identity = 106/274 (38.69%), Postives = 162/274 (59.12%), Query Frame = 3
Query:  180 ENWKDTPFRIEDNPHKRLFAV-SQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRL--ENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXX--XXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNKIHKQKNYFEPADKK 980
            + WK   F+ EDN   + FA  S    L+PK  E YLK I+  + + L ++ I   L L++G M+V+TT KT+DP II+KA  +I++LAR VP+ +A+K+LQ+D+  D+I IG+    K+ F+KRR RL   N    + +E +  C I   G +++ +G    L  V+ +V DC + NIHPI+++K   +    +  PE+A +DWS  LP   K+   ++  KK  NV EKK YTPFPPA +  K+D E+ESG + L  +  + K   E  +K+
Sbjct:   17 DKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMK-NIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNV-EKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQ 288          
BLAST of KRR1 small subunit processome component vs. Ensembl Nematostella
Match: EDO40336 (KRR1 small subunit processome component [Source:UniProtKB/TrEMBL;Acc:A7S7I3])

HSP 1 Score: 171.4 bits (433), Expect = 4.276e-51
Identity = 110/287 (38.33%), Postives = 170/287 (59.23%), Query Frame = 3
Query:  180 ENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRL--ENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNK------IHKQKNYFEPADKKRKINDN*FYL 1010
            ++W+   F  +DNP+  +   S    L+PK  EKYLKE++P ++K L E+ +K +L L++G M+V TT KTFDP+IIIKA  +I+++AR V +E+A ++L+++V  DII I    R K+ F+KRR RL   N    + +E +  C I   G +++ +G +  L +V+ +V +  + N+HPI+N+K   +    + DP++  + W   LP   KK   K+KK      KKEYTPFPP   ESK+DKEL SG + LK K       H++K     A +KRK+     Y+
Sbjct:    7 DHWRVDKFSADDNPYG-VVEESSFATLFPKYREKYLKEVWPLVEKELKEHNLKCQLDLIEGSMTVFTTRKTFDPYIIIKARDMIKLMARSVQFEQAKRILEDEVACDIIKIASLVRNKERFVKRRQRLIGPNCATLKALELLTECYIMVQGNTVSALGPYKGLKQVRKVVEETMK-NVHPIYNIKTLMIKRELAKDPDLKNESWDRFLPKFRKKAVKKKKKVPKT--KKEYTPFPPPQPESKMDKELASGEYFLKEKERKAQAQHERKQRQAAAAEKRKVTREQAYI 289          
BLAST of KRR1 small subunit processome component vs. Ensembl Medaka
Match: krr1 (KRR1 small subunit processome component homolog [Source:NCBI gene;Acc:101155260])

HSP 1 Score: 197.593 bits (501), Expect = 8.118e-60
Identity = 111/270 (41.11%), Postives = 168/270 (62.22%), Query Frame = 3
Query:  168 VDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGH--RKKDTFLKRRSRLENDEIKEL--IEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNKIHKQKNYFE 965
            + +P+ WK+  F  EDNP + L   S    L+PK  E YLKE +P ++K L + +IKA L L++G M+V TT KTFDP+ I++A  +I++LAR VP+E+A+++LQ+D+  DII IG   R ++ F+KRR RL   +   L  +E + +C +   G +++ +G ++ L  V+ +V D  + NIHPI+N+K   +    S DPE+  ++W   +P    K   KRK+P     KKEYTPFPP+  ESKIDKEL +G F L+  + K+K   E
Sbjct:   32 MTVPDGWKEPAFSREDNP-RGLLEESSFATLFPKYREAYLKECWPLVEKALGDSHIKASLDLIEGSMTVCTTKKTFDPYAIVRARDLIKLLARSVPFEQAVRILQDDMACDIIKIGTMVRNRERFVKRRQRLIGPKGSTLKALELLTNCYVMVQGNTVSALGPYNGLKEVRKVVMDTMK-NIHPIYNIKTLMIKQELSRDPELRTQNWERFMPKFRHKNLSKRKEPKKKSVKKEYTPFPPSQPESKIDKELATGEFFLRESVKKRKKMEE 299          
BLAST of KRR1 small subunit processome component vs. Planmine SMEST
Match: SMESG000026804.1 (SMESG000026804.1)

HSP 1 Score: 338.191 bits (866), Expect = 7.161e-116
Identity = 180/308 (58.44%), Postives = 235/308 (76.30%), Query Frame = 3
Query:   75 PYVKGWVPFQGLKIAQXXXXXXXXXXXXXXXVDIPENWKDTPFRIEDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLDGEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIPIGHRKKDTFLKRRSRLENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLHRVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLXXXXXXXXXXXXXXHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNKIHKQKNYFEPADKKRKINDN 998
            P+VKGWVPF+G K+ +       ++  K   VD+P +WKDT  +  +NPH RLFA+S+ K LYPKAL+ YLKE+FP ++K L E+YIK EL+ LDGE+ V++TPKTFDP  I+KAHS+ ++LARYVP EEA+ +L E++ EDIIPI HRKKD+FL+R+SRL+NDE+K LI+E+L+CK+F SGKS+A IG   NL +V+ +V +CF+ NIHPI++LKRFQ++N     PEMA KDW+  LPPIPK KNVKRKKP  +R KKEY+ FPP P ESKID+EL SG FHLK +  K KNY+EP  KK K N +
Sbjct:    4 PFVKGWVPFKGSKLNKDKNVNEKEVIGK---VDVPNDWKDTSLKTGENPHGRLFALSEFKVLYPKALDIYLKEVFPIIKKSLQEFYIKVELNRLDGEIVVKSTPKTFDPVAILKAHSLAKLLARYVPVEEALTVLNEELSEDIIPIDHRKKDSFLRRKSRLDNDEMKALIKEILNCKVFISGKSVAAIGSFENLKKVRKVVLECFERNIHPIYHLKRFQIMNKLMEMPEMADKDWNDFLPPIPKSKNVKRKKPAKIRNKKEYSAFPPEPQESKIDRELASGVFHLKYQ-KKNKNYYEPVAKKAKTNSS 307          
The following BLAST results are available for this feature:
BLAST of KRR1 small subunit processome component vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
KRR13.043e-5743.45KRR1 small subunit processome component homolog [S... [more]
KRR16.086e-4443.92KRR1 small subunit processome component homolog [S... [more]
back to top
BLAST of KRR1 small subunit processome component vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
krr-17.648e-5639.21KRR1 small subunit processome component [Source:U... [more]
back to top
BLAST of KRR1 small subunit processome component vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dbe1.427e-5840.94gene:FBgn0020305 transcript:FBtr0078030[more]
back to top
BLAST of KRR1 small subunit processome component vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
krr12.250e-5641.79KRR1 small subunit processome component homolog [S... [more]
back to top
BLAST of KRR1 small subunit processome component vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc39a51.946e-6142.59solute carrier family 39 (zinc transporter), membe... [more]
slc39a52.852e-6142.86solute carrier family 39 (zinc transporter), membe... [more]
back to top
BLAST of KRR1 small subunit processome component vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Krr18.964e-5842.86KRR1, small subunit (SSU) processome component, ho... [more]
Krr16.478e-4544.21KRR1, small subunit (SSU) processome component, ho... [more]
back to top
BLAST of KRR1 small subunit processome component vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B4JDU5|KRR1_DROGR7.445e-5943.70KRR1 small subunit processome component homolog OS... [more]
sp|B4KF66|KRR1_DROMO2.234e-5845.28KRR1 small subunit processome component homolog OS... [more]
sp|B3N899|KRR1_DROER6.693e-5841.89KRR1 small subunit processome component homolog OS... [more]
sp|Q9VPU8|KRR1_DROME1.431e-5740.94KRR1 small subunit processome component homolog OS... [more]
sp|B4P2Y8|KRR1_DROYA2.303e-5743.70KRR1 small subunit processome component homolog OS... [more]
back to top
BLAST of KRR1 small subunit processome component vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A075AIP02.145e-7445.33KRR1 small subunit processome component OS=Opistho... [more]
A0A4S2LMD04.047e-7446.37KRR1 small subunit processome component OS=Opistho... [more]
A0A3R7JZM54.327e-7446.71KRR1 small subunit processome component OS=Clonorc... [more]
A0A3Q0KC663.060e-7343.40KRR1 small subunit processome component OS=Schisto... [more]
A0A4E0REH84.830e-7345.55KRR1 small subunit processome component OS=Fasciol... [more]
back to top
BLAST of KRR1 small subunit processome component vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
krr13.071e-5840.36KRR1 small subunit processome component homolog [S... [more]
back to top
BLAST of KRR1 small subunit processome component vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of KRR1 small subunit processome component vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
KRR11.208e-5038.69Nucleolar protein required for rRNA synthesis and ... [more]
back to top
BLAST of KRR1 small subunit processome component vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO403364.276e-5138.33KRR1 small subunit processome component [Source:U... [more]
back to top
BLAST of KRR1 small subunit processome component vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
krr18.118e-6041.11KRR1 small subunit processome component homolog [S... [more]
back to top
BLAST of KRR1 small subunit processome component vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000026804.17.161e-11658.44SMESG000026804.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026733 ID=SMED30026733|Name=KRR1 small subunit processome component|organism=Schmidtea mediterranea sexual|type=transcript|length=1020bp
TGATTAGTAAAATATATAATTTGTTTAAATAATTATAATTCTGAAATTTA
AAATTTCTCATGACATCAAAGTATCCATATGTCAAAGGTTGGGTTCCATT
CCAAGGTCTAAAAATTGCACAAAAATCCAAAAGCGAATTAGATAAATTAA
AAGAAAAATCCGAAAAAGTCGACATTCCTGAGAATTGGAAAGACACTCCA
TTTAGAATAGAAGATAATCCTCATAAAAGATTATTCGCAGTTTCTCAACA
AAAAGAACTTTATCCAAAAGCCTTAGAAAAATATCTTAAAGAAATATTCC
CATTTTTACAAAAAGTTCTTAGTGAATATTATATCAAAGCCGAACTAAGT
TTATTAGATGGTGAAATGTCAGTCAGAACGACTCCAAAAACCTTTGATCC
GTTTATTATTATCAAAGCGCATAGTGTTATTAGAGTCTTAGCTCGTTATG
TGCCATATGAAGAAGCGATTAAGTTGCTTCAGGAAGACGTTTATGAGGAC
ATTATTCCCATCGGACATAGAAAAAAAGATACTTTTTTAAAGAGAAGATC
TCGATTAGAGAATGATGAAATAAAAGAATTGATTGAAGAAGTGTTGCATT
GCAAAATTTTCCCTTCTGGTAAATCTATTGCAGTTATCGGTGAACACTCA
AACCTTCACCGAGTTCAAACTTTGGTTAATGATTGCTTTCAAAATAATAT
CCATCCAATTTTTAATCTAAAAAGATTTCAACTAATAAATGCATTTTCCG
CTGACCCAGAGATGGCGGGCAAAGATTGGAGCCACTTGTTGCCGCCAATA
CCCAAGAAAAAGAATGTAAAAAGAAAGAAACCTCATAATGTTAGGGAAAA
GAAAGAATACACTCCTTTCCCTCCGGCTCCAGTTGAAAGTAAAATAGATA
AAGAACTTGAAAGCGGGACTTTCCATTTGAAAAATAAAATTCACAAACAA
AAGAATTATTTTGAGCCTGCTGATAAGAAAAGAAAAATAAATGATAATTA
ATTTTATTTAATTAAAATTC
back to top

protein sequence of SMED30026733-orf-1

>SMED30026733-orf-1 ID=SMED30026733-orf-1|Name=SMED30026733-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=314bp
MTSKYPYVKGWVPFQGLKIAQKSKSELDKLKEKSEKVDIPENWKDTPFRI
EDNPHKRLFAVSQQKELYPKALEKYLKEIFPFLQKVLSEYYIKAELSLLD
GEMSVRTTPKTFDPFIIIKAHSVIRVLARYVPYEEAIKLLQEDVYEDIIP
IGHRKKDTFLKRRSRLENDEIKELIEEVLHCKIFPSGKSIAVIGEHSNLH
RVQTLVNDCFQNNIHPIFNLKRFQLINAFSADPEMAGKDWSHLLPPIPKK
KNVKRKKPHNVREKKEYTPFPPAPVESKIDKELESGTFHLKNKIHKQKNY
FEPADKKRKINDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036612KH_dom_type_1_sf
IPR041174KH_8
IPR024166rRNA_assembly_KRR1
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: biological process
TermDefinition
GO:0006364rRNA processing
GO:0042254ribosome biogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 143..242
e-value: 3.2E-19
score: 70.7
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 56..142
e-value: 2.5E-25
score: 89.9
IPR041174Krr1, KH1 domainPFAMPF17903KH_8coord: 65..141
e-value: 6.8E-21
score: 74.2
IPR024166Ribosomal RNA assembly KRR1PANTHERPTHR12581HIV-1 REV BINDING PROTEIN 2, 3coord: 22..308