NADH dehydrogenase iron-sulfur protein 8, mitochondrial

Overview
NameNADH dehydrogenase iron-sulfur protein 8, mitochondrial
Smed IDSMED30026732
Length (bp)857
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NADH dehydrogenase iron-sulfur protein 8, mitochondrial (SMED30026732) t-SNE clustered cells

Violin plots show distribution of expression levels for NADH dehydrogenase iron-sulfur protein 8, mitochondrial (SMED30026732) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NADH dehydrogenase iron-sulfur protein 8, mitochondrial (SMED30026732) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NADH dehydrogenase iron-sulfur protein 8, mitochondrial (SMED30026732) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026732

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30026732h1SMcG0008652 dd_Smed_v4_849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026732h1SMcG0008652 dd_Smed_v4_849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026732h1SMcG0008652 dd_Smed_v4_849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026732h1SMcG0008652 dd_Smed_v4_849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026732h1SMcG0008652 dd_Smed_v4_849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30026732h1SMcG0008652 dd_Smed_v6_849_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026732h1SMcG0008652 dd_Smed_v6_849_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Human
Match: NDUFS8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:HGNC Symbol;Acc:HGNC:7715])

HSP 1 Score: 295.049 bits (754), Expect = 8.638e-101
Identity = 137/186 (73.66%), Postives = 154/186 (82.80%), Query Frame = 2
Query:   83 RNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            R++ +      YK ++       +    D    ++   E+ +GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQADY+YR
Sbjct:   25 RSLHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR 210          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Human
Match: NDUFS8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:HGNC Symbol;Acc:HGNC:7715])

HSP 1 Score: 249.21 bits (635), Expect = 3.671e-83
Identity = 116/160 (72.50%), Postives = 130/160 (81.25%), Query Frame = 2
Query:   83 RNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYN 562
            R++ +      YK ++       +    D    ++   E+ +GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYN
Sbjct:   25 RSLHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYN 184          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Human
Match: NDUFS8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:HGNC Symbol;Acc:HGNC:7715])

HSP 1 Score: 188.734 bits (478), Expect = 5.945e-60
Identity = 86/110 (78.18%), Postives = 94/110 (85.45%), Query Frame = 2
Query:  149 SVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFC 478
             +    D    ++   E+ +GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFC
Sbjct:   29 DMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFC 138          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Human
Match: NDUFS8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:HGNC Symbol;Acc:HGNC:7715])

HSP 1 Score: 130.183 bits (326), Expect = 4.135e-38
Identity = 58/64 (90.62%), Postives = 62/64 (96.88%), Query Frame = 2
Query:  449 MTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            MTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQADY+YR
Sbjct:    1 MTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR 64          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Human
Match: NDUFS8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:HGNC Symbol;Acc:HGNC:7715])

HSP 1 Score: 129.028 bits (323), Expect = 6.959e-37
Identity = 58/100 (58.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:   83 RNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQ 382
            R++ +      YK ++       +    D    ++   E+ +GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQ
Sbjct:   25 RSLHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQ 124          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Celegans
Match: T20H4.5 (Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q22619])

HSP 1 Score: 291.967 bits (746), Expect = 5.084e-100
Identity = 136/184 (73.91%), Postives = 156/184 (84.78%), Query Frame = 2
Query:   92 STQNRLNCYKLISKSKEIN-SVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            + Q R N YK +    E + +++  ++ G+ ++   E+ +G GV LG +F EPATINYPFEKGPLS RFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAETR DGSRRTTRYDIDMTKCIYCG CQEACPVDAIVEGPNFEYSTETHEELLYNKEKLL NGDRWEPE+ +N+QA+Y+YR
Sbjct:   30 TIQKRSN-YKFVGMPNETDGTLAGDLNYGLHNVFFTELFRGFGVMLGHVFMEPATINYPFEKGPLSSRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETRPDGSRRTTRYDIDMTKCIYCGLCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLLNGDRWEPELASNLQAEYLYR 212          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Fly
Match: ND-23 (gene:FBgn0017567 transcript:FBtr0083191)

HSP 1 Score: 287.73 bits (735), Expect = 4.043e-98
Identity = 133/170 (78.24%), Postives = 151/170 (88.82%), Query Frame = 2
Query:  134 SKEIN-SVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            +KE++   ++  D   S++   E+++G  VTL  IF+EPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL NGD+WE EI +N+QAD++YR
Sbjct:   48 NKELSMEFADITDRAASTMFFGELLRGFAVTLAHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLCNGDKWESEIASNLQADHLYR 217          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Zebrafish
Match: ndufs8a (NADH:ubiquinone oxidoreductase core subunit S8a [Source:ZFIN;Acc:ZDB-GENE-040426-2153])

HSP 1 Score: 294.278 bits (752), Expect = 1.220e-100
Identity = 136/189 (71.96%), Postives = 154/189 (81.48%), Query Frame = 2
Query:   74 NQCRNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            N  R  S        K ++  +E        D    ++ L E+++G+G+ +  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQAD++YR
Sbjct:   22 NLIRPFSLSAHRAGIKYVNNQEEATDWKSITDRAAQTLLLTELIRGMGMAVSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADFLYR 210          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Zebrafish
Match: ndufs8b (NADH:ubiquinone oxidoreductase core subunit S8b [Source:ZFIN;Acc:ZDB-GENE-050522-131])

HSP 1 Score: 293.893 bits (751), Expect = 1.275e-100
Identity = 139/190 (73.16%), Postives = 153/190 (80.53%), Query Frame = 2
Query:   71 LNQCRNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            L   R  S       YK ++     + +    D    ++ L E+ +GL + +  +FREPATINYPFEKGPLSPRFRGEHALRRYP GEERCIACKLCEA+CPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLL+NGDRWE EI ANIQADY+YR
Sbjct:   21 LGPVRPFSLTIHRGGYKYVNAEDLPSDLKSITDRAAQTLLLTELCRGLAMAVSYLFREPATINYPFEKGPLSPRFRGEHALRRYPNGEERCIACKLCEAVCPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLNNGDRWEVEIAANIQADYLYR 210          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Zebrafish
Match: ndufs8b (NADH:ubiquinone oxidoreductase core subunit S8b [Source:ZFIN;Acc:ZDB-GENE-050522-131])

HSP 1 Score: 55.8398 bits (133), Expect = 1.696e-9
Identity = 27/72 (37.50%), Postives = 38/72 (52.78%), Query Frame = 2
Query:   71 LNQCRNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLS 286
            L   R  S       YK ++     + +    D    ++ L E+ +GL + +  +FREPATINYPFEKGPLS
Sbjct:   23 LGPVRPFSLTIHRGGYKYVNAEDLPSDLKSITDRAAQTLLLTELCRGLAMAVSYLFREPATINYPFEKGPLS 94          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Xenopus
Match: mapre1 (microtubule associated protein RP/EB family member 1 [Source:Xenbase;Acc:XB-GENE-974542])

HSP 1 Score: 300.827 bits (769), Expect = 3.568e-103
Identity = 136/186 (73.12%), Postives = 158/186 (84.95%), Query Frame = 2
Query:   83 RNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            R +S  ++++ YK ++  +E   +    D    ++   E+ +GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEA+CPAQAITIEAE R DGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQAD++YR
Sbjct:   24 RPLSLASQMHSYKYVNAREEATDLKSVTDRAAQTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRTDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEVEIGANIQADFLYR 209          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Xenopus
Match: mapre1 (microtubule associated protein RP/EB family member 1 [Source:Xenbase;Acc:XB-GENE-974542])

HSP 1 Score: 300.442 bits (768), Expect = 5.506e-103
Identity = 136/186 (73.12%), Postives = 158/186 (84.95%), Query Frame = 2
Query:   83 RNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            R +S  ++++ YK ++  +E   +    D    ++   E+ +GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEA+CPAQAITIEAE R DGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQAD++YR
Sbjct:   22 RPLSLASQMHSYKYVNAREEATDLKSVTDRAAQTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRTDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEVEIGANIQADFLYR 207          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Xenopus
Match: mapre1 (microtubule associated protein RP/EB family member 1 [Source:Xenbase;Acc:XB-GENE-974542])

HSP 1 Score: 292.352 bits (747), Expect = 4.584e-100
Identity = 136/194 (70.10%), Postives = 158/194 (81.44%), Query Frame = 2
Query:   65 NLLNQCRNISTQNRLNCY--KLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            +L  Q +     N L+ +  + ++  +E   +    D    ++   E+ +GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEA+CPAQAITIEAE R DGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQAD++YR
Sbjct:    1 HLSQQMQPKRKTNTLHLFSTEYVNAREEATDLKSVTDRAAQTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRTDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEVEIGANIQADFLYR 194          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Xenopus
Match: mapre1 (microtubule associated protein RP/EB family member 1 [Source:Xenbase;Acc:XB-GENE-974542])

HSP 1 Score: 290.426 bits (742), Expect = 3.945e-99
Identity = 135/187 (72.19%), Postives = 153/187 (81.82%), Query Frame = 2
Query:   80 CRNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            C  I     L   + ++  +E   +    D    ++   E+ +GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEA+CPAQAITIEAE R DGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQAD++YR
Sbjct:   14 CITIPPTLHLFSTEYVNAREEATDLKSVTDRAAQTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRTDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEVEIGANIQADFLYR 200          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Xenopus
Match: mapre1 (microtubule associated protein RP/EB family member 1 [Source:Xenbase;Acc:XB-GENE-974542])

HSP 1 Score: 290.041 bits (741), Expect = 6.918e-99
Identity = 132/172 (76.74%), Postives = 149/172 (86.63%), Query Frame = 2
Query:  125 ISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            ++  +E   +    D    ++   E+ +GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEA+CPAQAITIEAE R DGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQAD++YR
Sbjct:   39 VNAREEATDLKSVTDRAAQTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRTDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEVEIGANIQADFLYR 210          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Mouse
Match: Ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:MGI Symbol;Acc:MGI:2385079])

HSP 1 Score: 299.286 bits (765), Expect = 1.269e-102
Identity = 139/177 (78.53%), Postives = 155/177 (87.57%), Query Frame = 2
Query:  116 YKLISKSKEINSV--SEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            YK ++K ++ + V    A D     +   E+++GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQADY+YR
Sbjct:   36 YKYVNKKEQESEVDMKSATDNAARILMWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR 212          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Mouse
Match: Ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:MGI Symbol;Acc:MGI:2385079])

HSP 1 Score: 299.286 bits (765), Expect = 1.269e-102
Identity = 139/177 (78.53%), Postives = 155/177 (87.57%), Query Frame = 2
Query:  116 YKLISKSKEINSV--SEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            YK ++K ++ + V    A D     +   E+++GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQADY+YR
Sbjct:   36 YKYVNKKEQESEVDMKSATDNAARILMWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR 212          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Mouse
Match: Ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:MGI Symbol;Acc:MGI:2385079])

HSP 1 Score: 299.286 bits (765), Expect = 1.269e-102
Identity = 139/177 (78.53%), Postives = 155/177 (87.57%), Query Frame = 2
Query:  116 YKLISKSKEINSV--SEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            YK ++K ++ + V    A D     +   E+++GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQADY+YR
Sbjct:   36 YKYVNKKEQESEVDMKSATDNAARILMWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR 212          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Mouse
Match: Ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:MGI Symbol;Acc:MGI:2385079])

HSP 1 Score: 299.286 bits (765), Expect = 1.269e-102
Identity = 139/177 (78.53%), Postives = 155/177 (87.57%), Query Frame = 2
Query:  116 YKLISKSKEINSV--SEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            YK ++K ++ + V    A D     +   E+++GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQADY+YR
Sbjct:   36 YKYVNKKEQESEVDMKSATDNAARILMWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR 212          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Mouse
Match: Ndufs8 (NADH:ubiquinone oxidoreductase core subunit S8 [Source:MGI Symbol;Acc:MGI:2385079])

HSP 1 Score: 105.916 bits (263), Expect = 6.997e-29
Identity = 46/67 (68.66%), Postives = 54/67 (80.60%), Query Frame = 2
Query:  152 VSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIAC 352
            +  A D     +   E+++GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIAC
Sbjct:    1 MKSATDNAARILMWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIAC 67          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. UniProt/SwissProt
Match: sp|Q8K3J1|NDUS8_MOUSE (NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs8 PE=1 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 8.874e-102
Identity = 139/177 (78.53%), Postives = 155/177 (87.57%), Query Frame = 2
Query:  116 YKLISKSKEINSV--SEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            YK ++K ++ + V    A D     +   E+++GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQADY+YR
Sbjct:   36 YKYVNKKEQESEVDMKSATDNAARILMWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR 212          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. UniProt/SwissProt
Match: sp|Q60HE3|NDUS8_MACFA (NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Macaca fascicularis OX=9541 GN=NDUFS8 PE=2 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 3.827e-101
Identity = 136/186 (73.12%), Postives = 154/186 (82.80%), Query Frame = 2
Query:   83 RNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            R + +      YK ++  +    +    D    ++   E+ +GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEA+CPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQADY+YR
Sbjct:   25 RTLHSSAVAATYKYVNMQESKTDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR 210          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. UniProt/SwissProt
Match: sp|P0CB97|NDUS8_PONAB (NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Pongo abelii OX=9601 GN=NDUFS8 PE=2 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 4.559e-101
Identity = 138/186 (74.19%), Postives = 156/186 (83.87%), Query Frame = 2
Query:   83 RNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            R++ +      YK ++  +    +    D    ++ L E+ +GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQADY+YR
Sbjct:   25 RSLHSSAVAATYKYVNMQEPEMDMKSVTDRAARTLLLTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR 210          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. UniProt/SwissProt
Match: sp|P42028|NDUS8_BOVIN (NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Bos taurus OX=9913 GN=NDUFS8 PE=1 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 1.680e-100
Identity = 136/186 (73.12%), Postives = 155/186 (83.33%), Query Frame = 2
Query:   83 RNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            R + +      YK ++  +    +    D    ++   E+++GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEA+CPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQADY+YR
Sbjct:   27 RGLHSSAVAATYKYVNLREPSMDMKSVTDRAAQTLLWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR 212          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. UniProt/SwissProt
Match: sp|P0CB98|NDUS8_PONPY (NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Pongo pygmaeus OX=9600 GN=NDUFS8 PE=2 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 4.148e-100
Identity = 137/186 (73.66%), Postives = 154/186 (82.80%), Query Frame = 2
Query:   83 RNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            R++ +      YK ++       +    D    ++   E+ +GLG+TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQADY+YR
Sbjct:   25 RSLHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR 210          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. TrEMBL
Match: A0A131XSB1 (Putative ubiquinone oxidoreductase ndufs8/23 kDa subunit OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 1.830e-106
Identity = 149/206 (72.33%), Postives = 171/206 (83.01%), Query Frame = 2
Query:   26 MFRLSYKKI-LISHNLLNQCRNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            M  L  +KI L++  +    R +ST N L+CYK +   +  N++ E +D     + L E+ +GL VT G +F+EPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEY+TETHEELLYNKEKLL+NGD+WEPE+ ANIQADY+YR
Sbjct:    1 MASLCSRKIPLVTSAVWRSSRPLSTGNVLSCYKQMHPPEAGNTMKENVDAVSKRVFLTELFRGLAVTTGTLFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYTTETHEELLYNKEKLLNNGDKWEPELAANIQADYLYR 206          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. TrEMBL
Match: A0A023GFZ0 (Putative nadh:ubiquinone oxidoreductase ndufs8/23 kDa subunit OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 6.874e-106
Identity = 148/206 (71.84%), Postives = 171/206 (83.01%), Query Frame = 2
Query:   26 MFRLSYKKILISHNLLNQC-RNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            M  L  + + +  N + +C R +ST N   CYK +  ++  NS+ E +DT    + + E+ +GL V +G +F+EPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELL+NKEKLL+NGD+WEPEI ANIQADY+YR
Sbjct:    1 MASLCRRNVPLVTNAVWRCSRPLSTTNARLCYKQVHPAEPGNSLKENVDTAAQVVFITELFRGLAVVVGNLFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLFNKEKLLNNGDKWEPEIAANIQADYLYR 206          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. TrEMBL
Match: A0A1E1X7U6 (Putative ubiquinone oxidoreductase ndufs8/23 kDa subunit OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 3.829e-105
Identity = 147/206 (71.36%), Postives = 169/206 (82.04%), Query Frame = 2
Query:   26 MFRLSYKKILISHNLLNQC-RNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            M  L  +K+ +  + + +C R +ST N   CYK +   +   S+ E++DT    +   E+ +GL V +G IF+EPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE R DGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELL+NKEKLL+NGD+WEPEI ANIQADY+YR
Sbjct:    1 MASLCSRKVPLVTSAVWRCSRPLSTTNAWLCYKQVHPPEPGTSLKESVDTASQVVFATELFRGLAVVMGTIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEEREDGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLFNKEKLLNNGDKWEPEIAANIQADYLYR 206          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. TrEMBL
Match: A0A224YWG1 (NADH dehydrogenase (Ubiquinone) Fe-S protein 8 OS=Rhipicephalus zambeziensis OX=60191 PE=3 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 8.510e-105
Identity = 146/206 (70.87%), Postives = 171/206 (83.01%), Query Frame = 2
Query:   26 MFRLSYKKILISHNLLNQC-RNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            M  L  +K+ +  + + +C R +ST + L+CYK +   +   S+ E +D     + L E+ +GL +T G +F+EPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEY+TETHEELLYNKEKLL+NGD+WEPE+ ANIQADY+YR
Sbjct:    1 MASLCSRKVPLVTSAVWRCSRPLSTASVLSCYKQVHPPEPGTSMKEKVDDLSKRVFLTELFRGLAITTGTLFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYTTETHEELLYNKEKLLNNGDKWEPELAANIQADYLYR 206          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. TrEMBL
Match: A0A0R3TLH2 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS8090 PE=3 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 9.685e-105
Identity = 148/201 (73.63%), Postives = 166/201 (82.59%), Query Frame = 2
Query:   38 SYKKILISHNLLNQCRNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            S+ K L+S      CR ++    L  YK+ISK  E +S +E +DT    + L EI+KG G+TLG + +EPATINYPFEKGPLSPRFRGEHALRRY +GEERCIACKLCEAICPAQAITIEAE R DGSRRTTRYDIDMTKCI+CGFCQEACPVDAIVEGPNFE+STETHEEL+YNKEKLLDNGDRWE EI ANI ADY+YR
Sbjct:    9 SFAKSLVS----TACRTLACSASLGNYKIISKPLETDSYAEGVDTLARKLLLTEIVKGFGITLGYLMKEPATINYPFEKGPLSPRFRGEHALRRYASGEERCIACKLCEAICPAQAITIEAEPREDGSRRTTRYDIDMTKCIFCGFCQEACPVDAIVEGPNFEFSTETHEELMYNKEKLLDNGDRWEVEIAANIDADYLYR 205          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Cavefish
Match: ENSAMXT00000036194.1 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial-like [Source:NCBI gene;Acc:111195707])

HSP 1 Score: 298.13 bits (762), Expect = 2.326e-102
Identity = 139/186 (74.73%), Postives = 154/186 (82.80%), Query Frame = 2
Query:   83 RNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            R  S   +   YK ++  +    +    D    ++   E+ +GLG+T+  +FREPATINYPFEKGPLSPRFRGEHALRRYP GEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGDRWE EI ANIQADY+YR
Sbjct:   24 RAFSVTIQREGYKYVNAQELPIDMKSVTDRAAQTLLWTELFRGLGMTMSYLFREPATINYPFEKGPLSPRFRGEHALRRYPNGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDRWEAEIAANIQADYLYR 209          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Cavefish
Match: ndufs8a (NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial [Source:NCBI gene;Acc:103023629])

HSP 1 Score: 293.123 bits (749), Expect = 2.492e-100
Identity = 137/193 (70.98%), Postives = 157/193 (81.35%), Query Frame = 2
Query:   62 HNLLNQCRNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            H+L+   R +S       +K ++  +    +    D    ++   E+ +GLG+T+  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+ TETHEELLYNKEKLL+NGD+WE EI ANIQADY+YR
Sbjct:   17 HSLV---RPLSLSAHREGFKYVNAQEIPTDMKSITDRAAQTLLWTELFRGLGMTMSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFCTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR 206          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Sea Lamprey
Match: ndufs8a (NADH:ubiquinone oxidoreductase core subunit S8a [Source:ZFIN;Acc:ZDB-GENE-040426-2153])

HSP 1 Score: 296.204 bits (757), Expect = 2.933e-102
Identity = 135/186 (72.58%), Postives = 154/186 (82.80%), Query Frame = 2
Query:   83 RNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            R +S     + YK ++   E   +    D    ++   E+ +GL +TL  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEA+CPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLL+NGD+WE EI +N+QAD++YR
Sbjct:   25 RPLSLSATAHSYKYVNALDENMDLKAVTDRAAQTLMWTELFRGLAMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEARADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLNNGDKWEAEIASNLQADFLYR 210          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Nematostella
Match: EDO39320 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAJ7])

HSP 1 Score: 287.73 bits (735), Expect = 4.947e-99
Identity = 130/163 (79.75%), Postives = 148/163 (90.80%), Query Frame = 2
Query:  152 VSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            +  + D   +++   E+++GL +TL  +F+EPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAE RADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE++TETHEELLYNKEKLL+NGDRWE EI AN+QAD++YR
Sbjct:   20 MQTSTDRNATTLFFGELLRGLAMTLSKLFQEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFATETHEELLYNKEKLLNNGDRWEAEIAANLQADFLYR 182          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Medaka
Match: ENSORLT00000018539.2 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial [Source:NCBI gene;Acc:101175628])

HSP 1 Score: 298.901 bits (764), Expect = 1.138e-102
Identity = 138/189 (73.02%), Postives = 157/189 (83.07%), Query Frame = 2
Query:   74 NQCRNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            N  R  S  ++   +K ++  +    +    D    ++   E+ +GLG+T+  +FREPATINYPFEKGPLSPRFRGEHALRRYP+GEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQADY+YR
Sbjct:   22 NAVRCFSVSHQRCGFKYVNAQEVPTDMKSITDRAAQTLLWTELFRGLGMTMSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR 210          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Medaka
Match: ENSORLT00000047128.1 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial [Source:NCBI gene;Acc:101175628])

HSP 1 Score: 249.21 bits (635), Expect = 3.512e-83
Identity = 117/158 (74.05%), Postives = 130/158 (82.28%), Query Frame = 2
Query:  167 DTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            D    ++   E+ +GLG+T+  +FREPATINYPFEKGPLSPRFRGEHA   +    E C+A K     C  QAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE+STETHEELLYNKEKLL+NGD+WE EI ANIQADY+YR
Sbjct:   45 DRAAQTLLWTELFRGLGMTMSYLFREPATINYPFEKGPLSPRFRGEHA---FALKRENCVANKNPTPNCVFQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR 199          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Medaka
Match: NDUFS8 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial-like [Source:NCBI gene;Acc:101164653])

HSP 1 Score: 246.899 bits (629), Expect = 2.287e-82
Identity = 119/186 (63.98%), Postives = 137/186 (73.66%), Query Frame = 2
Query:   83 RNISTQNRLNCYKLISKSKEINSVSEAIDTGVSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            R +S   +   YK ++  +    +    D   +++   E+ +GLG+T+  +FREPATINYPFEKGPLSPRFRGEHALRRYP GEERCIACKLCEAICPAQAITIEAETRADGSRRTT                  CPVDA VEGPNFE+STE+HEELLYNKEKLL+NGDRWE EI ANIQADY+YR
Sbjct:   27 RTLSVSVQRGGYKYVNAQELPTDLRSITDRAATTLLWTELFRGLGMTMSYLFREPATINYPFEKGPLSPRFRGEHALRRYPNGEERCIACKLCEAICPAQAITIEAETRADGSRRTT-----------------PCPVDAFVEGPNFEFSTESHEELLYNKEKLLNNGDRWESEIAANIQADYLYR 195          
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Planmine SMEST
Match: SMESG000002076.1 (SMESG000002076.1)

HSP 1 Score: 308.916 bits (790), Expect = 1.193e-107
Identity = 146/146 (100.00%), Postives = 146/146 (100.00%), Query Frame = 2
Query:  203 MKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 640
            MKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR
Sbjct:    1 MKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQADYMYR 146          
The following BLAST results are available for this feature:
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NDUFS88.638e-10173.66NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
NDUFS83.671e-8372.50NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
NDUFS85.945e-6078.18NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
NDUFS84.135e-3890.63NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
NDUFS86.959e-3758.00NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
back to top
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T20H4.55.084e-10073.91Probable NADH dehydrogenase [ubiquinone] iron-sulf... [more]
back to top
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ND-234.043e-9878.24gene:FBgn0017567 transcript:FBtr0083191[more]
back to top
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ndufs8a1.220e-10071.96NADH:ubiquinone oxidoreductase core subunit S8a [S... [more]
ndufs8b1.275e-10073.16NADH:ubiquinone oxidoreductase core subunit S8b [S... [more]
ndufs8b1.696e-937.50NADH:ubiquinone oxidoreductase core subunit S8b [S... [more]
back to top
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapre13.568e-10373.12microtubule associated protein RP/EB family member... [more]
mapre15.506e-10373.12microtubule associated protein RP/EB family member... [more]
mapre14.584e-10070.10microtubule associated protein RP/EB family member... [more]
mapre13.945e-9972.19microtubule associated protein RP/EB family member... [more]
mapre16.918e-9976.74microtubule associated protein RP/EB family member... [more]
back to top
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ndufs81.269e-10278.53NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
Ndufs81.269e-10278.53NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
Ndufs81.269e-10278.53NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
Ndufs81.269e-10278.53NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
Ndufs86.997e-2968.66NADH:ubiquinone oxidoreductase core subunit S8 [So... [more]
back to top
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K3J1|NDUS8_MOUSE8.874e-10278.53NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
sp|Q60HE3|NDUS8_MACFA3.827e-10173.12NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
sp|P0CB97|NDUS8_PONAB4.559e-10174.19NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
sp|P42028|NDUS8_BOVIN1.680e-10073.12NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
sp|P0CB98|NDUS8_PONPY4.148e-10073.66NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
back to top
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A131XSB11.830e-10672.33Putative ubiquinone oxidoreductase ndufs8/23 kDa s... [more]
A0A023GFZ06.874e-10671.84Putative nadh:ubiquinone oxidoreductase ndufs8/23 ... [more]
A0A1E1X7U63.829e-10571.36Putative ubiquinone oxidoreductase ndufs8/23 kDa s... [more]
A0A224YWG18.510e-10570.87NADH dehydrogenase (Ubiquinone) Fe-S protein 8 OS=... [more]
A0A0R3TLH29.685e-10573.63Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
back to top
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000036194.12.326e-10274.73NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
ndufs8a2.492e-10070.98NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
back to top
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndufs8a2.933e-10272.58NADH:ubiquinone oxidoreductase core subunit S8a [S... [more]
back to top
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO393204.947e-9979.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000018539.21.138e-10273.02NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
ENSORLT00000047128.13.512e-8374.05NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
NDUFS82.287e-8263.98NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
back to top
BLAST of NADH dehydrogenase iron-sulfur protein 8, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000002076.11.193e-107100.00SMESG000002076.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026732 ID=SMED30026732|Name=NADH dehydrogenase iron-sulfur protein 8, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=857bp
ATTTCTTTACTCTTACTAATTAATTATGTTTAGATTAAGTTACAAAAAGA
TATTAATTTCACATAATCTTTTAAACCAATGTCGAAATATTTCAACTCAA
AATCGTTTGAATTGTTATAAGTTAATTAGTAAGAGTAAAGAAATAAATTC
GGTTTCAGAAGCAATTGATACAGGAGTGAGTAGTATTGCTTTAGTGGAAA
TAATGAAAGGTCTTGGTGTAACATTGGGAATGATCTTTCGTGAACCTGCT
ACTATCAATTATCCTTTTGAAAAAGGTCCTTTAAGCCCTAGATTTAGGGG
GGAACATGCTTTGCGAAGGTATCCAACCGGAGAAGAGAGATGTATTGCTT
GCAAATTATGTGAAGCCATTTGTCCAGCACAAGCGATCACAATTGAAGCT
GAAACTCGTGCAGACGGAAGCAGAAGAACGACAAGATATGATATCGACAT
GACAAAATGCATTTATTGTGGATTCTGTCAAGAAGCGTGTCCAGTTGACG
CGATTGTTGAGGGGCCTAATTTTGAATACTCAACAGAAACTCATGAAGAA
TTGCTTTATAACAAAGAGAAATTACTGGATAATGGTGATAGATGGGAGCC
AGAGATCCAAGCAAACATACAAGCTGATTATATGTATCGATAAATTGTTC
ATTTAGATTCATTTGCGCTATATAGGTTGCAATATATTAACTCGAGTTGT
CTTATTGATTTAAAAAAATTTTGTAGGTCATCCAATCATAATAATGATAA
ATCATCCAATCAGTTTAGCTGAGTTCATTTGTTTCTTTTATTTCCATCGA
TTATAAATTAATTGAATCAATAATTAAATTTTCATTTTTATGTCAATTCA
GATTTTG
back to top

protein sequence of SMED30026732-orf-1

>SMED30026732-orf-1 ID=SMED30026732-orf-1|Name=SMED30026732-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=206bp
MFRLSYKKILISHNLLNQCRNISTQNRLNCYKLISKSKEINSVSEAIDTG
VSSIALVEIMKGLGVTLGMIFREPATINYPFEKGPLSPRFRGEHALRRYP
TGEERCIACKLCEAICPAQAITIEAETRADGSRRTTRYDIDMTKCIYCGF
CQEACPVDAIVEGPNFEYSTETHEELLYNKEKLLDNGDRWEPEIQANIQA
DYMYR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR010226NADH_quinone_OxRdtase_chainI
IPR0178964Fe4S_Fe-S-bd
IPR0179004Fe4S_Fe_S_CS
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0016651oxidoreductase activity, acting on NAD(P)H
GO:00515394 iron, 4 sulfur cluster binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.70.3270coord: 79..204
e-value: 4.5E-42
score: 145.4
NoneNo IPR availablePANTHERPTHR10849:SF25NADH DEHYDROGENASE [UBIQUINONE] IRON-SULFUR PROTEIN 8, MITOCHONDRIALcoord: 28..205
NoneNo IPR availableSUPERFAMILYSSF548624Fe-4S ferredoxinscoord: 79..188
IPR0178964Fe-4S ferredoxin-type, iron-sulphur binding domainPFAMPF12838Fer4_7coord: 105..159
e-value: 1.1E-12
score: 48.4
IPR0178964Fe-4S ferredoxin-type, iron-sulphur binding domainPROSITEPS513794FE4S_FER_2coord: 136..165
score: 10.743
IPR0178964Fe-4S ferredoxin-type, iron-sulphur binding domainPROSITEPS513794FE4S_FER_2coord: 97..126
score: 9.995
IPR010226NADH-quinone oxidoreductase, chain ITIGRFAMTIGR01971TIGR01971coord: 62..183
e-value: 6.7E-49
score: 162.5
IPR010226NADH-quinone oxidoreductase, chain IPANTHERPTHR10849NADH DEHYDROGENASE UBIQUINONE IRON-SULFUR PROTEIN 8, MITOCHONDRIALcoord: 28..205
IPR0179004Fe-4S ferredoxin, iron-sulphur binding, conserved sitePROSITEPS001984FE4S_FER_1coord: 106..117
IPR0179004Fe-4S ferredoxin, iron-sulphur binding, conserved sitePROSITEPS001984FE4S_FER_1coord: 145..156