RING domain ligase2 isoform 3

Overview
NameRING domain ligase2 isoform 3
Smed IDSMED30026726
Length (bp)2953
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING domain ligase2 isoform 3 (SMED30026726) t-SNE clustered cells

Violin plots show distribution of expression levels for RING domain ligase2 isoform 3 (SMED30026726) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RING domain ligase2 isoform 3 (SMED30026726) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RING domain ligase2 isoform 3 (SMED30026726) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026726

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30026726SMESG000003596.1 dd_Smed_v4_6423_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30026726SMESG000003596.1 dd_Smed_v4_6423_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026726SMESG000003596.1 dd_Smed_v4_6423_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30026726SMESG000003596.1 dd_Smed_v4_6423_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026726SMESG000003596.1 dd_Smed_v4_6423_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30026726SMESG000003596.1 dd_Smed_v4_5871_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026726SMESG000003596.1 dd_Smed_v4_5871_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026726SMESG000003596.1 dd_Smed_v4_5871_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026726SMESG000003596.1 dd_Smed_v4_5871_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30026726SMESG000003596.1 dd_Smed_v4_5871_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026726SMESG000003596.1 dd_Smed_v4_5871_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30026726SMESG000003596.1 dd_Smed_v4_5871_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026726SMESG000003596.1 dd_Smed_v4_6423_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30026726SMESG000003596.1 dd_Smed_v4_5871_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026726SMESG000003596.1 dd_Smed_v4_5871_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the whole animalSMED30026726SMESG000003596.1 dd_Smed_v4_5871_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 93.5893 bits (231), Expect = 1.528e-18
Identity = 128/584 (21.92%), Postives = 232/584 (39.73%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIEFEKLCKSYDFMSQKLHTG-LTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALT----LSIKF---HGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            G  P+HIA   G +N+  LLLN    ++        P+H A+  GN  +VKLLL    +ID +T+   GLTP     +      +E+           T+N ++ +    + D +   +L   ++     +    LT L  AA     K+ K +LD     K+ N   K +           K  I    ++ +H A  +    + +          + + +AA  GH   +  +M       +  VR   A+  A      E+   + +     E++ K + T LH +      D+V+ +L        ++   +  T L L+    H      L  +  + +   K   TPLH A   G  +    L+ +S + D  G  GLT LH A     + V   +++ GA+     +  +      + +N++ I    +++      NA+T     S+      G + +  L    +   N  + +  + LH+A +  +  + + L++ GA VD     G +PL  + C+  +          I+I N L+ + A +N K+ N  T    A++  +  I+  LL NN
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLD-----KKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGL----------TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ--GASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDI--ATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLH-VGCHYGN----------IKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNN 769          

HSP 2 Score: 63.1586 bits (152), Expect = 3.034e-9
Identity = 29/93 (31.18%), Postives = 51/93 (54.84%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            L +  G  P+H+A ++  +N+  +L+N+  +++ +   GY P+H     GNI+IV  LLQH  +++ +TK   G TP   A +   T  I + 
Sbjct:  675 LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN--GYTPLHQAAQQGHTHIINVL 765          

HSP 3 Score: 53.1434 bits (126), Expect = 3.512e-6
Identity = 26/101 (25.74%), Postives = 47/101 (46.53%), Query Frame = 2
Query:  104 GKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKW 406
            GK + +++ L+           G+ P+H++  +G  ++   LL+   ++      G+ P+H A   G +E+  LLLQ     D    G  GLTP  +A  +
Sbjct:  493 GKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDA--AGKSGLTPLHVAAHY 591          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 92.8189 bits (229), Expect = 2.198e-18
Identity = 128/584 (21.92%), Postives = 232/584 (39.73%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIEFEKLCKSYDFMSQKLHTG-LTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALT----LSIKF---HGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            G  P+HIA   G +N+  LLLN    ++        P+H A+  GN  +VKLLL    +ID +T+   GLTP     +      +E+           T+N ++ +    + D +   +L   ++     +    LT L  AA     K+ K +LD     K+ N   K +           K  I    ++ +H A  +    + +          + + +AA  GH   +  +M       +  VR   A+  A      E+   + +     E++ K + T LH +      D+V+ +L        ++   +  T L L+    H      L  +  + +   K   TPLH A   G  +    L+ +S + D  G  GLT LH A     + V   +++ GA+     +  +      + +N++ I    +++      NA+T     S+      G + +  L    +   N  + +  + LH+A +  +  + + L++ GA VD     G +PL  + C+  +          I+I N L+ + A +N K+ N  T    A++  +  I+  LL NN
Sbjct:  229 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLD-----KKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGL----------TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ--GASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDI--ATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPL-HVGCHYGN----------IKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNN 780          

HSP 2 Score: 85.8853 bits (211), Expect = 2.958e-16
Identity = 126/569 (22.14%), Postives = 214/569 (37.61%), Query Frame = 2
Query:  182 IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKF------------HGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALL 1843
            +HIA  K       LLL  + N + E   G+ P+H A   GNI +  LLL     +D   +    +TP  +A K    + ++L                  ++  K    +  K   GLT L   A S  +++++ +LDR  P+ +K  N L    +  + D L+     C+    ++ QH        N  +          + L +AA  GH       + K + +K     A                 + +N         FT LH A   N   +++ +L H     + +  E+  T + +A  + H   +  L  +  + NT N   +T LH A  SG  +   YL+     ++       T LH +   G  ++ +Q++  GA+        +      + E           +A  L+++  +LSI              +GKL +  L    S + +A   +  + LH+A      ++   LLD GA       NG +PL              K N+M +I   L+ YGAD N  +   I     A++ E    M++LL
Sbjct:  200 LHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARN--DITPLHVASKRGNANMVKLL----------------LDRGAK----IDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLN-----CV---QLLLQHNVPVDDVTNDYL----------TALHVAAHCGHYK-----VAKVLLDKKANPNA-----------------KALN--------GFTPLHIACKKNRIKVMELLLKH--GASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGH-------EDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLH----------IAAKKNQM-DIATTLLEYGADANAVTRQGIASVHLAAQ-EGHVDMVSLL 677          

HSP 3 Score: 63.1586 bits (152), Expect = 2.907e-9
Identity = 29/93 (31.18%), Postives = 51/93 (54.84%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            L +  G  P+H+A ++  +N+  +L+N+  +++ +   GY P+H     GNI+IV  LLQH  +++ +TK   G TP   A +   T  I + 
Sbjct:  686 LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN--GYTPLHQAAQQGHTHIINVL 776          

HSP 4 Score: 53.1434 bits (126), Expect = 2.915e-6
Identity = 26/101 (25.74%), Postives = 47/101 (46.53%), Query Frame = 2
Query:  104 GKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKW 406
            GK + +++ L+           G+ P+H++  +G  ++   LL+   ++      G+ P+H A   G +E+  LLLQ     D    G  GLTP  +A  +
Sbjct:  504 GKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDA--AGKSGLTPLHVAAHY 602          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 92.0485 bits (227), Expect = 4.216e-18
Identity = 127/570 (22.28%), Postives = 220/570 (38.60%), Query Frame = 2
Query:  182 IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP-------FEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            +HIA  K       LLL  + N + +   G+ P+H A   GN+ +  LLL     +D   +   G+TP  +A K   T+ ++L                    L      +  K   GLT L  AA S  D++++ +L+R  P+  +  N L    +  + D +     EC+ +   + QH A                +   + L +AA  GH      ++ K     +  +R   A+  A      E+   +     L ++R +   T LH A     T++V+ +L H  + D  + N    T L ++          VL +   A +   K   TPLH A   G  D    L+ R    D  G  GLT LH A     + V   ++  GA+     +  +      + +N++ I         E +I+    +      S + H  +    LDK  +   + + G  +  LH+A +  +  +   L   GA  D     G +PL  + C+  +          +++ N L+  GA++N K+ N  T    A++  +  I+  LL + 
Sbjct:  175 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN--GITPLHVASKRGNTNMVKL--------------------LLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHV-----ECVKH---LLQHKAPVDDVT----------LDYLTALHVAAHCGHYRVTKLLLDKRANPNARALRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTS--LHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLI-VACHYGN----------VKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHG 689          

HSP 2 Score: 87.0409 bits (214), Expect = 1.368e-16
Identity = 119/523 (22.75%), Postives = 206/523 (39.39%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKL--------CKSYDFM----------SQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKL---SNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGH----ELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPL 1663
            G  P+H+A ++G  N+V LLL+    I+ +   G  P+H A  +G+ ++V+LLL+    +  RTK   GL+P  +A +    +C+     ++L+      D +  + L        C  Y             + +   G T L  AA +   ++++C+L     N  + D      EE   L   S L K  I+   ++ QH A      +AA  NG       + L I+A +G      + ++     ++  K  +   +  A      ++ + + +R    +S  K   T LH A   ++  +   +L+   +    + N    T L +A   +  +    L  Y   TN   K   TPLH A   G  D    L+++  NI      GLT LH A  +   NV + +  +GA+     +L +                             L ++  +     + FL K  +   NA+  N  + LH A +     +   LL  GAK +   +NGN+ L
Sbjct:  237 GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKN--GLSPLHMAAQGDHVECV-----KHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALRGETALHMAARAGQVEVVRCLL----RNGALVDARAR--EEQTPLHIASRLGKTEIV--QLLLQHMA----HPDAATTNG------YTPLHISAREGQVDVASVLLEAGAAHSLATKKGFT-PLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGY--TPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGY---------------------------TPLIVACHYGNVKMVNFLLKQGANV-NAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 703          

HSP 3 Score: 53.5286 bits (127), Expect = 2.176e-6
Identity = 29/101 (28.71%), Postives = 50/101 (49.50%), Query Frame = 2
Query:  104 GKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKW 406
            GKTE ++  L+           G+ P+HI+  +G +++  +LL            G+ P+H A   G++++ KLLLQ +   D  + G  GLTP  +A  +
Sbjct:  413 GKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAAD--SAGKNGLTPLHVAAHY 511          

HSP 4 Score: 52.7582 bits (125), Expect = 4.246e-6
Identity = 76/349 (21.78%), Postives = 126/349 (36.10%), Query Frame = 2
Query:  965 NFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQ-----------------------------QYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENE---ITIPFEKSIIALSLMENALT-LSIKFHGKLFLCF--------------LDKLNS--------------------TTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASK 1810
             FT L+ A  +N  D+VKY+L+  N  +  +  E   T LA+A    H + + +L                              Q +   + Q+K   TPLH A   G  +    L+NR   +D     G+T LH A  +G  N+ + +++ G               C +       + +  E+    L+  +N L+ L +   G    C               LD L +                       NAR     + LHMA +  Q E+ + LL +GA VD       +PL     +  SR+ +       EI  +L+ + A  +  +TN  T    +++
Sbjct:  109 GFTPLYMAAQENHIDVVKYLLE--NGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPL-----HIASRLGK------TEIVQLLLQHMAHPDAATTNGYTPLHISAR 444          

HSP 5 Score: 51.6026 bits (122), Expect = 9.564e-6
Identity = 26/78 (33.33%), Postives = 41/78 (52.56%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKK 403
            G+ P+ +AC  G + +V  LL +  N+  +   GY P+H A   G+  I+ +LLQH  + +  T    G T   IAK+
Sbjct:  633 GYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTAN--GNTALAIAKR 708          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 91.6633 bits (226), Expect = 5.522e-18
Identity = 132/586 (22.53%), Postives = 229/586 (39.08%), Query Frame = 2
Query:  164 DKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIE-FEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP-------FEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            + G  P+HIA   G +N+  LLLN    ++     G  P+H A+  GN  +VKLLL    +ID +T+   GLTP   A +      +EL           T+N ++ +    + D +E  + L +    +       LT L  AA     ++ K +LD     K  N   + +    +  + L   C   R  + +    +   I A   +G   I   +F+      GH   +  +++         +R   A+  A      E+   +     L ++R +   T LH A     T++V+ +L H  + D  + N    T L ++          VL +   A +   K   TPLH A   G  D    L+ R    D  G  GLT LH A     + V   ++  GA+     +  +      + +N++ I         E +I+    +      S + H  +    LDK  +   + + G  +  LH+A +  +  +   L   GA  D     G +PL  + C+  +          +++ N L+  GA++N K+ N  T    A++  +  I+  LL + 
Sbjct:  210 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD--GLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLD-----KRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFM------GHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTS--LHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLI-VACHYGN----------VKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHG 763          

HSP 2 Score: 65.0846 bits (157), Expect = 7.084e-10
Identity = 108/485 (22.27%), Postives = 171/485 (35.26%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSN---NETLGTALALAHSLHHRKCIKV---LQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN--NPIFKNFSSKD-FQMAFDNHWFQYAECLLKLLSDSFLESNITNEAFVQCKTEPNLIXXXXXXXXXXXQRAIIETLLWNAIRKNDKKLFDFFIKIEISSPKLFSNGENLFTQILKVRKIHFAWKVLESKNKMKFVNLKNKTNQTPLQVAIEIDEMDLVDALIHESNEFDCEDING 2368
            +++ KV    LH A   +DT     +L + +N D+ S    N T  +     H   H   + V   L     A +   +   TPLH A   G  +    L++R   ID     GLT LHCA   G + V E ++  GA  +   +  L+ L    Q    E      K ++      + +T             LD L +             LH+A  C    + K LLD  A  +    NG +PL  + C  N           I++  +L+ YGA I   + + +T    A+ + +  I+L LL N  +P   N   +    MA      +   CLL+            N A V  +                      +T L  A R    ++    ++         +NG        +  ++  A  +LE+       +L  K   TPL VA +   +D+   L+      D    NG
Sbjct:  165 DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECV----KHLLQHKAPVDDVT-------------LDYLTA-------------LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPL-HIACKKNR----------IKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLR------------NGALVDARAREE------------------QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAH---SLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNG 575          

HSP 3 Score: 63.1586 bits (152), Expect = 2.992e-9
Identity = 46/163 (28.22%), Postives = 71/163 (43.56%), Query Frame = 2
Query:  152 KLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF--HTENLIAAIKKN-DPIEFEKLCKSYDFMSQKLHT----------GLTILQTAADSNADKIIKCILDR 601
            + I + G  PIH+A   G LNIV+LLL    + +  +I G   +H A   G +E+V+ LL++   +D R +     TP  IA +  +T+ ++L   H  +  AA      P+         D  S  L            G T L  AA   +  + K +L R
Sbjct:  404 QAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREE--QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQR 564          

HSP 4 Score: 53.5286 bits (127), Expect = 2.515e-6
Identity = 29/101 (28.71%), Postives = 50/101 (49.50%), Query Frame = 2
Query:  104 GKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKW 406
            GKTE ++  L+           G+ P+HI+  +G +++  +LL            G+ P+H A   G++++ KLLLQ +   D  + G  GLTP  +A  +
Sbjct:  487 GKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAAD--SAGKNGLTPLHVAAHY 585          

HSP 5 Score: 51.6026 bits (122), Expect = 8.584e-6
Identity = 26/86 (30.23%), Postives = 43/86 (50.00%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIE 427
            G+ P+ +AC  G + +V  LL +  N+  +   GY P+H A   G+  I+ +LLQH  + +  T    G T   IAK+      ++
Sbjct:  707 GYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTAN--GNTALAIAKRLGYISVVD 790          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 91.6633 bits (226), Expect = 6.145e-18
Identity = 132/586 (22.53%), Postives = 229/586 (39.08%), Query Frame = 2
Query:  164 DKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIE-FEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP-------FEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            + G  P+HIA   G +N+  LLLN    ++     G  P+H A+  GN  +VKLLL    +ID +T+   GLTP   A +      +EL           T+N ++ +    + D +E  + L +    +       LT L  AA     ++ K +LD     K  N   + +    +  + L   C   R  + +    +   I A   +G   I   +F+      GH   +  +++         +R   A+  A      E+   +     L ++R +   T LH A     T++V+ +L H  + D  + N    T L ++          VL +   A +   K   TPLH A   G  D    L+ R    D  G  GLT LH A     + V   ++  GA+     +  +      + +N++ I         E +I+    +      S + H  +    LDK  +   + + G  +  LH+A +  +  +   L   GA  D     G +PL  + C+  +          +++ N L+  GA++N K+ N  T    A++  +  I+  LL + 
Sbjct:  210 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD--GLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLD-----KRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFM------GHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTS--LHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLI-VACHYGN----------VKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHG 763          

HSP 2 Score: 63.929 bits (154), Expect = 1.542e-9
Identity = 109/489 (22.29%), Postives = 173/489 (35.38%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSN---NETLGTALALAHSLHHRKCIKV---LQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN--NPIFKNFSSKD-FQMAFDNHWFQYAECLLKLLSDSFLESNITNEAFVQCKTEPNLIXXXXXXXXXXXQRAIIETLLWNAIRKNDKKLFDFFIKIEISSPKLFSNGENLFTQILKVRKIHFAWKVLESKNKMKFVNLKNKTNQTPLQVAIEIDEMDLVDALIHESNEFDCEDINGNSVL 2380
            +++ KV    LH A   +DT     +L + +N D+ S    N T  +     H   H   + V   L     A +   +   TPLH A   G  +    L++R   ID     GLT LHCA   G + V E ++  GA  +   +  L+ L    Q    E      K ++      + +T             LD L +             LH+A  C    + K LLD  A  +    NG +PL  + C  N           I++  +L+ YGA I   + + +T    A+ + +  I+L LL N  +P   N   +    MA      +   CLL+            N A V  +                      +T L  A R    ++    ++         +NG        +  ++  A  +LE+       +L  K   TPL VA +   +D+   L+      D    NG + L
Sbjct:  165 DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECV----KHLLQHKAPVDDVT-------------LDYLTA-------------LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLH-IACKKNR----------IKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLR------------NGALVDARAREE------------------QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAH---SLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPL 579          

HSP 3 Score: 62.3882 bits (150), Expect = 5.129e-9
Identity = 46/163 (28.22%), Postives = 71/163 (43.56%), Query Frame = 2
Query:  152 KLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF--HTENLIAAIKKN-DPIEFEKLCKSYDFMSQKLHT----------GLTILQTAADSNADKIIKCILDR 601
            + I + G  PIH+A   G LNIV+LLL    + +  +I G   +H A   G +E+V+ LL++   +D R +     TP  IA +  +T+ ++L   H  +  AA      P+         D  S  L            G T L  AA   +  + K +L R
Sbjct:  404 QAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREE--QTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQR 564          

HSP 4 Score: 53.1434 bits (126), Expect = 3.311e-6
Identity = 29/101 (28.71%), Postives = 50/101 (49.50%), Query Frame = 2
Query:  104 GKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKW 406
            GKTE ++  L+           G+ P+HI+  +G +++  +LL            G+ P+H A   G++++ KLLLQ +   D  + G  GLTP  +A  +
Sbjct:  487 GKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAAD--SAGKNGLTPLHVAAHY 585          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 73.1738 bits (178), Expect = 9.488e-13
Identity = 119/558 (21.33%), Postives = 223/558 (39.96%), Query Frame = 2
Query:  161 DDKG--HFP-IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCIL--DRPVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIF 1795
            D KG    P +HIA +K       LLL    N +     G+ P+H A   G+  + +LLL+    ++ + +    ++P  +A KW RT+   L  +   I                  D  ++ L   LT L  AA S  D+++  ++    P+  K  N L    +  + D + +  +  + +R+ +      +   ++ A   G H    +  L+ +A+  +   ++G     I  K   ++ +            E + +     E+  +   T LH A      ++V Y+L    N D+++      T L LA   +    ++VL +     + Q +  QTPLH A   G  D    L+    N +       + LH A  +G E V   ++++ A+     +  F      S    + +     E+        +N +T L +  H    K+ +  L+  N  ++ A   N  + LH+A K  Q E+  +LL   A  +  +  G +PL          ++ ++ ++  EI+ +LI  G+D+  K+ N +T  
Sbjct:  188 DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQAR--HNISPLHVATKWGRTNMANLLLSRGAI-----------------IDSRTKDL---LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHV-DAARTLLYHRAPVDDVTVDYLTPLHVAAHCG-HVRVAKLLLDRSADP-NSRALNGFTPLHIACKKNRIKVV------------ELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLE--NGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLH---------LSAQEGHK--EISGLLIENGSDVGAKANNGLTAM 693          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 73.1738 bits (178), Expect = 9.488e-13
Identity = 119/558 (21.33%), Postives = 223/558 (39.96%), Query Frame = 2
Query:  161 DDKG--HFP-IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCIL--DRPVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIF 1795
            D KG    P +HIA +K       LLL    N +     G+ P+H A   G+  + +LLL+    ++ + +    ++P  +A KW RT+   L  +   I                  D  ++ L   LT L  AA S  D+++  ++    P+  K  N L    +  + D + +  +  + +R+ +      +   ++ A   G H    +  L+ +A+  +   ++G     I  K   ++ +            E + +     E+  +   T LH A      ++V Y+L    N D+++      T L LA   +    ++VL +     + Q +  QTPLH A   G  D    L+    N +       + LH A  +G E V   ++++ A+     +  F      S    + +     E+        +N +T L +  H    K+ +  L+  N  ++ A   N  + LH+A K  Q E+  +LL   A  +  +  G +PL          ++ ++ ++  EI+ +LI  G+D+  K+ N +T  
Sbjct:  188 DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQAR--HNISPLHVATKWGRTNMANLLLSRGAI-----------------IDSRTKDL---LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHV-DAARTLLYHRAPVDDVTVDYLTPLHVAAHCG-HVRVAKLLLDRSADP-NSRALNGFTPLHIACKKNRIKVV------------ELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLE--NGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLH---------LSAQEGHK--EISGLLIENGSDVGAKANNGLTAM 693          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 73.1738 bits (178), Expect = 9.623e-13
Identity = 119/558 (21.33%), Postives = 223/558 (39.96%), Query Frame = 2
Query:  161 DDKG--HFP-IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCIL--DRPVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIF 1795
            D KG    P +HIA +K       LLL    N +     G+ P+H A   G+  + +LLL+    ++ + +    ++P  +A KW RT+   L  +   I                  D  ++ L   LT L  AA S  D+++  ++    P+  K  N L    +  + D + +  +  + +R+ +      +   ++ A   G H    +  L+ +A+  +   ++G     I  K   ++ +            E + +     E+  +   T LH A      ++V Y+L    N D+++      T L LA   +    ++VL +     + Q +  QTPLH A   G  D    L+    N +       + LH A  +G E V   ++++ A+     +  F      S    + +     E+        +N +T L +  H    K+ +  L+  N  ++ A   N  + LH+A K  Q E+  +LL   A  +  +  G +PL          ++ ++ ++  EI+ +LI  G+D+  K+ N +T  
Sbjct:  188 DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQAR--HNISPLHVATKWGRTNMANLLLSRGAI-----------------IDSRTKDL---LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHV-DAARTLLYHRAPVDDVTVDYLTPLHVAAHCG-HVRVAKLLLDRSADP-NSRALNGFTPLHIACKKNRIKVV------------ELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLE--NGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLH---------LSAQEGHK--EISGLLIENGSDVGAKANNGLTAM 693          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 73.1738 bits (178), Expect = 9.623e-13
Identity = 119/558 (21.33%), Postives = 223/558 (39.96%), Query Frame = 2
Query:  161 DDKG--HFP-IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCIL--DRPVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIF 1795
            D KG    P +HIA +K       LLL    N +     G+ P+H A   G+  + +LLL+    ++ + +    ++P  +A KW RT+   L  +   I                  D  ++ L   LT L  AA S  D+++  ++    P+  K  N L    +  + D + +  +  + +R+ +      +   ++ A   G H    +  L+ +A+  +   ++G     I  K   ++ +            E + +     E+  +   T LH A      ++V Y+L    N D+++      T L LA   +    ++VL +     + Q +  QTPLH A   G  D    L+    N +       + LH A  +G E V   ++++ A+     +  F      S    + +     E+        +N +T L +  H    K+ +  L+  N  ++ A   N  + LH+A K  Q E+  +LL   A  +  +  G +PL          ++ ++ ++  EI+ +LI  G+D+  K+ N +T  
Sbjct:  188 DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQAR--HNISPLHVATKWGRTNMANLLLSRGAI-----------------IDSRTKDL---LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHV-DAARTLLYHRAPVDDVTVDYLTPLHVAAHCG-HVRVAKLLLDRSADP-NSRALNGFTPLHIACKKNRIKVV------------ELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLE--NGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLH---------LSAQEGHK--EISGLLIENGSDVGAKANNGLTAM 693          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 73.1738 bits (178), Expect = 1.010e-12
Identity = 119/558 (21.33%), Postives = 223/558 (39.96%), Query Frame = 2
Query:  161 DDKG--HFP-IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCIL--DRPVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIF 1795
            D KG    P +HIA +K       LLL    N +     G+ P+H A   G+  + +LLL+    ++ + +    ++P  +A KW RT+   L  +   I                  D  ++ L   LT L  AA S  D+++  ++    P+  K  N L    +  + D + +  +  + +R+ +      +   ++ A   G H    +  L+ +A+  +   ++G     I  K   ++ +            E + +     E+  +   T LH A      ++V Y+L    N D+++      T L LA   +    ++VL +     + Q +  QTPLH A   G  D    L+    N +       + LH A  +G E V   ++++ A+     +  F      S    + +     E+        +N +T L +  H    K+ +  L+  N  ++ A   N  + LH+A K  Q E+  +LL   A  +  +  G +PL          ++ ++ ++  EI+ +LI  G+D+  K+ N +T  
Sbjct:  188 DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQAR--HNISPLHVATKWGRTNMANLLLSRGAI-----------------IDSRTKDL---LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHV-DAARTLLYHRAPVDDVTVDYLTPLHVAAHCG-HVRVAKLLLDRSADP-NSRALNGFTPLHIACKKNRIKVV------------ELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLE--NGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLH---------LSAQEGHK--EISGLLIENGSDVGAKANNGLTAM 693          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 89.7373 bits (221), Expect = 7.740e-18
Identity = 129/572 (22.55%), Postives = 228/572 (39.86%), Query Frame = 2
Query:  182 IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQ-------SFLEIAAEQGH----ELFIDGIMKKTIYNKSIWVRAIXXXXXXXXX------EIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLEN 1819
            +HIA +K  +    LLL+ + N +     G+ P+H A+  GN  I  LL+Q    ++   K    ++P  +A KW +T+ + L         ++K   IE     K+ D        GLT L  AA S  ++++  +L+R  P+  K  N L                      + +H  A G  + ++AA I   H+           + L +AA  GH    +L +D        N     RA+               ++ E +        +  +   T LH A      ++V Y+L H  + D+ +      T L LA   +    I++L +     + + +  QTPLH A   G  D    L+     +D       T LH A  +G + V   ++ NGA      +  F      +    I +     +K     +  +N +T L +  H    ++ L  L+K  S  + A++G  ++ LH+A +  Q ++  +LL+ GA  +  +  G +PL       ++           EI+N+LI + A +N  + N +T     ++ +N
Sbjct:  176 LHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAK--HNISPLHVAAKWGKTNMVSLL--------LEKGGNIE----AKTRD--------GLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGL----------------------APLHMAAQG--EHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLD-------RNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE--TPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNG--HTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHA-----------EISNLLIEHKAAVNHPAKNGLTPMHLCAQEDN 679          

HSP 2 Score: 62.3882 bits (150), Expect = 2.043e-9
Identity = 79/344 (22.97%), Postives = 140/344 (40.70%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSENEIT--IPFEKSIIALSLMENALTLSIKFH-GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFE---MFC-------------------NSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQMAF 1897
            ++R KV    LH A   +D      +LD+ +N D+ S +    T L +A    ++    +L Q     N   K++ +PLH A   G  +    L+ +  NI+     GLT LHCA   G E V + ++  GA      +  L  L    Q    +    + + ++ +    ++    L +  H G + +  L    +  +NAR  N  + LH+A K  + ++ + LL  GA +     +G +PL     M C                      + +         +I  IL+  GA ++ ++  + T    AS+L N  I++ LL +     + ++KD   A 
Sbjct:  166 DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGF--TPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQV-DATTKDMYTAL 506          

HSP 3 Score: 59.6918 bits (143), Expect = 1.514e-8
Identity = 33/88 (37.50%), Postives = 44/88 (50.00%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            G  P+HIAC+K  L +V LLL    +I      G  P+H A   G + IV  LLQH    D  T    G TP  +A + ++TD I + 
Sbjct:  370 GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPT--VRGETPLHLAARANQTDIIRIL 455          

HSP 4 Score: 58.9214 bits (141), Expect = 2.394e-8
Identity = 30/90 (33.33%), Postives = 44/90 (48.89%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHT 439
            G+ P+H+A   G  N+V  LL    N++     GY P+H     G+  IV LLL+HK   + +T    G TP  IA+K      ++   T
Sbjct:  700 GYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVN--GQTPLHIARKLGYISVLDSLKT 787          

HSP 5 Score: 57.7658 bits (138), Expect = 4.924e-8
Identity = 42/143 (29.37%), Postives = 66/143 (46.15%), Query Frame = 2
Query:  179 PIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDC--IELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR 601
            P+H+A + G  N+V LLL +  NIE +   G  P+H A  +G+ ++V +LL+    I  +TK   GL P  +A +    D   I L+H            P+  +++   Y          LT L  AA     ++ K +LDR
Sbjct:  241 PLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKN--GLAPLHMAAQGEHVDAARILLYH----------RAPV--DEVTVDY----------LTALHVAAHCGHVRVAKLLLDR 359          

HSP 6 Score: 55.0694 bits (131), Expect = 3.677e-7
Identity = 26/90 (28.89%), Postives = 46/90 (51.11%), Query Frame = 2
Query:  164 DKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            + G  P+H+A   G +NIVI LL  + + +   + G  P+H A      +I+++LL++  ++D R +     TP  IA +    D + L 
Sbjct:  401 ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQ--QTPLHIASRLGNVDIVMLL 488          

HSP 7 Score: 53.9138 bits (128), Expect = 8.587e-7
Identity = 27/88 (30.68%), Postives = 43/88 (48.86%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            GH P+HIA  K  ++I   LL        E   G+ P+H ++  G+ EI  LL++HK  ++   K   GLTP  +  +    +  E+ 
Sbjct:  601 GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKN--GLTPMHLCAQEDNVNVAEIL 686          

HSP 8 Score: 53.1434 bits (126), Expect = 1.490e-6
Identity = 33/104 (31.73%), Postives = 51/104 (49.04%), Query Frame = 2
Query:  167 KGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTEN---LIAAIKKN 469
            +G  P+H+A      +I+ +LL     ++        P+H A+  GN++IV LLLQH  ++D  TK  +  T   IA K  + +   +   EN   L AA KK 
Sbjct:  435 RGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMY--TALHIAAKEGQDEVAAVL-IENGAALDAATKKG 535          

HSP 9 Score: 50.8322 bits (120), Expect = 7.401e-6
Identity = 70/294 (23.81%), Postives = 111/294 (37.76%), Query Frame = 2
Query:  968 FTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGA--NYMKFVELNFLQFTCQSSENEIT-IPFEKSIIALSLMENALTLSIKFHGKLFLCFL-DKLNSTTSNARDGNNNSL--------LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKL 1813
            +T LH A  +   ++   +++  N   LD+  +   T L L     H K  ++L Q E   + Q K   TPLH A           L+ +  +       G T LH A  K   ++   ++  GA  N         L  + Q    EI+ +  E         +N LT        + LC   D +N      ++G N  +        LH+A    Q  + + LL +GA VD   S G +PL +     +             I N+L+ + A+ N ++ N  T    A KL
Sbjct:  503 YTALHIAAKEGQDEVAAVLIE--NGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLT-------PMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGH-----------CHIVNLLLEHKANANAQTVNGQTPLHIARKL 776          

HSP 10 Score: 50.447 bits (119), Expect = 9.384e-6
Identity = 79/360 (21.94%), Postives = 141/360 (39.17%), Query Frame = 2
Query:  788 LEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVN------FTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLG--TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALL 1843
            L  AA  GHE  +D ++++      I  +              E +     L   R  V+       T LH A       + K +LD     + D+N   L   T L +A   +  K +++L ++  + +   +   TPLH A   G  +   YL+    + D     G T LH A      ++   ++ NGA           Q   ++ E +   P     IA  L    + + +  HG        ++++TT +       + LH+A K  Q E+   L+++GA +D     G +PL          +T +  +  I++  +L+   AD++ +  N +T    A    N+++ L LL
Sbjct:  275 LHCAARSGHEQVVDMLLER---GAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDR----NADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGA-----------QVDARAREQQ--TPLH---IASRLGNVDIVMLLLQHGA-------QVDATTKDMY-----TALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLH---------LTAKYGH--IKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLL 588          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334061)

HSP 1 Score: 88.1965 bits (217), Expect = 2.575e-17
Identity = 129/572 (22.55%), Postives = 228/572 (39.86%), Query Frame = 2
Query:  182 IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQ-------SFLEIAAEQGH----ELFIDGIMKKTIYNKSIWVRAIXXXXXXXXX------EIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLEN 1819
            +HIA +K  +    LLL+ + N +     G+ P+H A+  GN  I  LL+Q    ++   K    ++P  +A KW +T+ + L         ++K   IE     K+ D        GLT L  AA S  ++++  +L+R  P+  K  N L                      + +H  A G  + ++AA I   H+           + L +AA  GH    +L +D        N     RA+               ++ E +        +  +   T LH A      ++V Y+L H  + D+ +      T L LA   +    I++L +     + + +  QTPLH A   G  D    L+     +D       T LH A  +G + V   ++ NGA      +  F      +    I +     +K     +  +N +T L +  H    ++ L  L+K  S  + A++G  ++ LH+A +  Q ++  +LL+ GA  +  +  G +PL       ++           EI+N+LI + A +N  + N +T     ++ +N
Sbjct:  326 LHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAK--HNISPLHVAAKWGKTNMVSLL--------LEKGGNIE----AKTRD--------GLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGL----------------------APLHMAAQG--EHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLD-------RNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE--TPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNG--HTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHA-----------EISNLLIEHKAAVNHPAKNGLTPMHLCAQEDN 829          

HSP 2 Score: 60.8474 bits (146), Expect = 5.830e-9
Identity = 79/344 (22.97%), Postives = 140/344 (40.70%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSENEIT--IPFEKSIIALSLMENALTLSIKFH-GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFE---MFC-------------------NSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQMAF 1897
            ++R KV    LH A   +D      +LD+ +N D+ S +    T L +A    ++    +L Q     N   K++ +PLH A   G  +    L+ +  NI+     GLT LHCA   G E V + ++  GA      +  L  L    Q    +    + + ++ +    ++    L +  H G + +  L    +  +NAR  N  + LH+A K  + ++ + LL  GA +     +G +PL     M C                      + +         +I  IL+  GA ++ ++  + T    AS+L N  I++ LL +     + ++KD   A 
Sbjct:  316 DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGF--TPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQV-DATTKDMYTAL 656          

HSP 3 Score: 59.3066 bits (142), Expect = 2.151e-8
Identity = 33/88 (37.50%), Postives = 44/88 (50.00%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            G  P+HIAC+K  L +V LLL    +I      G  P+H A   G + IV  LLQH    D  T    G TP  +A + ++TD I + 
Sbjct:  520 GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPT--VRGETPLHLAARANQTDIIRIL 605          

HSP 4 Score: 58.5362 bits (140), Expect = 3.314e-8
Identity = 30/90 (33.33%), Postives = 44/90 (48.89%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHT 439
            G+ P+H+A   G  N+V  LL    N++     GY P+H     G+  IV LLL+HK   + +T    G TP  IA+K      ++   T
Sbjct:  850 GYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQT--VNGQTPLHIARKLGYISVLDSLKT 937          

HSP 5 Score: 58.151 bits (139), Expect = 4.613e-8
Identity = 42/143 (29.37%), Postives = 66/143 (46.15%), Query Frame = 2
Query:  179 PIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDC--IELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR 601
            P+H+A + G  N+V LLL +  NIE +   G  P+H A  +G+ ++V +LL+    I  +TK   GL P  +A +    D   I L+H            P+  +++   Y          LT L  AA     ++ K +LDR
Sbjct:  391 PLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKN--GLAPLHMAAQGEHVDAARILLYH----------RAPV--DEVTVDY----------LTALHVAAHCGHVRVAKLLLDR 509          

HSP 6 Score: 54.6842 bits (130), Expect = 5.572e-7
Identity = 26/90 (28.89%), Postives = 46/90 (51.11%), Query Frame = 2
Query:  164 DKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            + G  P+H+A   G +NIVI LL  + + +   + G  P+H A      +I+++LL++  ++D R +     TP  IA +    D + L 
Sbjct:  551 ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQ--QTPLHIASRLGNVDIVMLL 638          

HSP 7 Score: 53.9138 bits (128), Expect = 9.423e-7
Identity = 27/88 (30.68%), Postives = 43/88 (48.86%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            GH P+HIA  K  ++I   LL        E   G+ P+H ++  G+ EI  LL++HK  ++   K   GLTP  +  +    +  E+ 
Sbjct:  751 GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKN--GLTPMHLCAQEDNVNVAEIL 836          

HSP 8 Score: 52.7582 bits (125), Expect = 2.054e-6
Identity = 33/104 (31.73%), Postives = 51/104 (49.04%), Query Frame = 2
Query:  167 KGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTEN---LIAAIKKN 469
            +G  P+H+A      +I+ +LL     ++        P+H A+  GN++IV LLLQH  ++D  TK  +  T   IA K  + +   +   EN   L AA KK 
Sbjct:  585 RGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMY--TALHIAAKEGQDEVAAVL-IENGAALDAATKKG 685          

HSP 9 Score: 50.8322 bits (120), Expect = 8.313e-6
Identity = 70/294 (23.81%), Postives = 111/294 (37.76%), Query Frame = 2
Query:  968 FTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGA--NYMKFVELNFLQFTCQSSENEIT-IPFEKSIIALSLMENALTLSIKFHGKLFLCFL-DKLNSTTSNARDGNNNSL--------LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKL 1813
            +T LH A  +   ++   +++  N   LD+  +   T L L     H K  ++L Q E   + Q K   TPLH A           L+ +  +       G T LH A  K   ++   ++  GA  N         L  + Q    EI+ +  E         +N LT        + LC   D +N      ++G N  +        LH+A    Q  + + LL +GA VD   S G +PL +     +             I N+L+ + A+ N ++ N  T    A KL
Sbjct:  653 YTALHIAAKEGQDEVAAVLIE--NGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLT-------PMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGH-----------CHIVNLLLEHKANANAQTVNGQTPLHIARKL 926          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303118)

HSP 1 Score: 87.8113 bits (216), Expect = 4.267e-17
Identity = 129/562 (22.95%), Postives = 225/562 (40.04%), Query Frame = 2
Query:  182 IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQ-------SFLEIAAEQGH----ELFIDGIMKKTIYNKSIWVRAIXXXXX------XXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRIT 1789
            +HIA +K  +    LLL+ + N +     G+ P+H A+  GN  I  LL+Q    ++   K    ++P  +A KW +T+ + L         ++K   IE     K+ D        GLT L  AA S  ++++  +L+R  P+  K  N L                      + +H  A G  + ++AA I   H+           + L +AA  GH    +L +D        N     RA+           K   ++ E +        +  +   T LH A      ++V Y+L H  + D+ +      T L LA   +    I++L +     + + +  QTPLH A   G  D    L+     +D       T LH A  +G + V   ++ NGA      +  F      +    I +     +K     +  +N +T L +  H    ++ L  L+K  S  + A++G  ++ LH+A +  Q ++  +LL+ GA  +  +  G +PL       ++           EI+N+LI + A +N  + N +T
Sbjct:  176 LHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAK--HNISPLHVAAKWGKTNMVSLL--------LEKGGNIE----AKTRD--------GLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGL----------------------APLHMAAQG--EHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLD-------RNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE--TPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNG--HTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHA-----------EISNLLIEHKAAVNHPAKNGLT 669          

HSP 2 Score: 61.2326 bits (147), Expect = 5.672e-9
Identity = 80/345 (23.19%), Postives = 141/345 (40.87%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLG-TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSENEIT--IPFEKSIIALSLMENALTLSIKFH-GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFE---MFC-------------------NSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQMAF 1897
            ++R KV    LH A   +D      +LD+ +N D+ S +   G T L +A    ++    +L Q     N   K++ +PLH A   G  +    L+ +  NI+     GLT LHCA   G E V + ++  GA      +  L  L    Q    +    + + ++ +    ++    L +  H G + +  L    +  +NAR  N  + LH+A K  + ++ + LL  GA +     +G +PL     M C                      + +         +I  IL+  GA ++ ++  + T    AS+L N  I++ LL +     + ++KD   A 
Sbjct:  166 DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKS---GFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQV-DATTKDMYTAL 506          

HSP 3 Score: 60.4622 bits (145), Expect = 9.104e-9
Identity = 33/88 (37.50%), Postives = 44/88 (50.00%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            G  P+HIAC+K  L +V LLL    +I      G  P+H A   G + IV  LLQH    D  T    G TP  +A + ++TD I + 
Sbjct:  370 GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPT--VRGETPLHLAARANQTDIIRIL 455          

HSP 4 Score: 59.3066 bits (142), Expect = 2.102e-8
Identity = 30/90 (33.33%), Postives = 44/90 (48.89%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHT 439
            G+ P+H+A   G  N+V  LL    N++     GY P+H     G+  IV LLL+HK   + +T    G TP  IA+K      ++   T
Sbjct:  700 GYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQT--VNGQTPLHIARKLGYISVLDSLKT 787          

HSP 5 Score: 57.7658 bits (138), Expect = 6.802e-8
Identity = 31/88 (35.23%), Postives = 48/88 (54.55%), Query Frame = 2
Query:  179 PIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDC--IELFH 436
            P+H+A + G  N+V LLL +  NIE +   G  P+H A  +G+ ++V +LL+    I  +TK   GL P  +A +    D   I L+H
Sbjct:  241 PLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKN--GLAPLHMAAQGEHVDAARILLYH 326          

HSP 6 Score: 55.4546 bits (132), Expect = 2.812e-7
Identity = 26/90 (28.89%), Postives = 46/90 (51.11%), Query Frame = 2
Query:  164 DKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            + G  P+H+A   G +NIVI LL  + + +   + G  P+H A      +I+++LL++  ++D R +     TP  IA +    D + L 
Sbjct:  401 ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQ--QTPLHIASRLGNVDIVMLL 488          

HSP 7 Score: 54.6842 bits (130), Expect = 5.767e-7
Identity = 27/88 (30.68%), Postives = 43/88 (48.86%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            GH P+HIA  K  ++I   LL        E   G+ P+H ++  G+ EI  LL++HK  ++   K   GLTP  +  +    +  E+ 
Sbjct:  601 GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKN--GLTPMHLCAQEDNVNVAEIL 686          

HSP 8 Score: 54.299 bits (129), Expect = 7.816e-7
Identity = 34/104 (32.69%), Postives = 51/104 (49.04%), Query Frame = 2
Query:  167 KGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTEN---LIAAIKKN 469
            +G  P+H+A      +I+ +LL     ++        P+H A+  GN++IV LLLQH  ++D  TK  +  T   IA K  + D +     EN   L AA KK 
Sbjct:  435 RGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMY--TALHIAAKEGQ-DEVAAVLIENGAALDAATKKG 535          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0344224)

HSP 1 Score: 87.8113 bits (216), Expect = 4.680e-17
Identity = 130/578 (22.49%), Postives = 233/578 (40.31%), Query Frame = 2
Query:  182 IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQ-------SFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIX------XXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN 1849
            +HIA +K  +    LLL+ + N +     G+ P+H A+  GN  I  LL+Q    ++   K    ++P  +A KW +T+ + L         ++K   IE             K   GLT L  AA S  ++++  +L+R  P+  K  N L                      + +H  A G  + ++AA I   H+           + L +AA  GH      ++ +   N     RA+        A  K   ++ E +        +  +   T LH A      ++V Y+L H  + D+ +      T L LA   +    I++L +     + + +  QTPLH A   G  D    L+     +D       T LH A  +G + V   ++ NGA      +  F      +    I +     +K     +  +N +T L +  H    ++ L  L+K  S  + A++G  ++ LH+A +  Q ++  +LL+ GA  +  +  G +PL          ++ ++ +   EI+N+LI + A +N  + N +T     ++ +N  +   L  N
Sbjct:  176 LHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAK--HNISPLHVAAKWGKTNMVSLL--------LEKGGNIE------------AKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGL----------------------APLHMAAQG--EHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDR---NADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE--TPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNG--HTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPL---------HLSSQEGH--AEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKN 689          

HSP 2 Score: 61.2326 bits (147), Expect = 6.783e-9
Identity = 76/328 (23.17%), Postives = 134/328 (40.85%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSENEIT--IPFEKSIIALSLMENALTLSIKFH-GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFE---MFC-------------------NSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN 1849
            ++R KV    LH A   +D      +LD+ +N D+ S +    T L +A    ++    +L Q     N   K++ +PLH A   G  +    L+ +  NI+     GLT LHCA   G E V + ++  GA      +  L  L    Q    +    + + ++ +    ++    L +  H G + +  L    +  +NAR  N  + LH+A K  + ++ + LL  GA +     +G +PL     M C                      + +         +I  IL+  GA ++ ++  + T    AS+L N  I++ LL +
Sbjct:  166 DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGF--TPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQH 491          

HSP 3 Score: 56.225 bits (134), Expect = 2.185e-7
Identity = 29/78 (37.18%), Postives = 41/78 (52.56%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKK 403
            G+ P+H+A   G  N+V  LL    N++     GY P+H     G+  IV LLL+HK   + +T    G TP  IA+K
Sbjct:  700 GYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVN--GQTPLHIARK 775          

HSP 4 Score: 55.0694 bits (131), Expect = 4.009e-7
Identity = 33/88 (37.50%), Postives = 44/88 (50.00%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            G  P+HIAC+K  L +V LLL    +I      G  P+H A   G + IV  LLQH    D  T    G TP  +A + ++TD I + 
Sbjct:  370 GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVR--GETPLHLAARANQTDIIRIL 455          

HSP 5 Score: 52.373 bits (124), Expect = 3.186e-6
Identity = 83/368 (22.55%), Postives = 148/368 (40.22%), Query Frame = 2
Query:  167 KGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTEN---LIAAIKKN-DPIEFEK-----------LCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR---PVENKEINDLMKEITEENDKLSNLTKECILYRSIIH-QHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGH----ELFID--GIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLG-TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEA 1192
            +G  P+H+A      +I+ +LL     ++        P+H A+  GN++IV LLLQH  ++D  TK  +  T   IA K  + D +     EN   L AA KK   P+               L K  D  +Q    G+T L  A   N  ++   +L++   P    +       I    +++ ++    + Y ++ + +  AGF                    L +++++GH     L I+    +     N    +    +  +    EI E+    +++     K  +T LH A      +MV+++L +  N+D  +   ++G T L       H   + +L +++   N Q    QTPLH A
Sbjct:  435 RGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMY--TALHIAAKEGQ-DEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQG-KNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQM-DIATTLLEYGALANAESKAGFTP------------------LHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDM---ATKAGYTPLHVASHFGQANMVRFLLQNGANVDAAT---SIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA 773          

HSP 6 Score: 51.9878 bits (123), Expect = 3.835e-6
Identity = 31/88 (35.23%), Postives = 48/88 (54.55%), Query Frame = 2
Query:  179 PIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDC--IELFH 436
            P+H+A + G  N+V LLL +  NIE +   G  P+H A  +G+ ++V +LL+    I  +TK   GL P  +A +    D   I L+H
Sbjct:  241 PLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKN--GLAPLHMAAQGEHVDAARILLYH 326          

HSP 7 Score: 51.2174 bits (121), Expect = 5.843e-6
Identity = 71/301 (23.59%), Postives = 114/301 (37.87%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGA--NYMKFVELNFLQFTCQSSENEIT-IPFEKSIIALSLMENALTLSIKFHGKLFLCFL-DKLNSTTSNARDGNNNSL--------LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKL 1813
            ++  K  +T LH A  +   ++   +++  N   LD+  +   T L L     H K  ++L Q E   + Q K   TPLH A           L+ +  +       G T LH A  K   ++   ++  GA  N         L  + Q    EI+ +  E         +N LT        + LC   D +N      ++G N  +        LH+A    Q  + + LL +GA VD   S G +PL +     +             I N+L+ + A+ N ++ N  T    A KL
Sbjct:  496 DATTKDMYTALHIAAKEGQDEVAAVLIE--NGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLT-------PMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHC-----------HIVNLLLEHKANANAQTVNGQTPLHIARKL 776          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303125)

HSP 1 Score: 87.0409 bits (214), Expect = 8.141e-17
Identity = 130/578 (22.49%), Postives = 233/578 (40.31%), Query Frame = 2
Query:  182 IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQ-------SFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIX------XXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN 1849
            +HIA +K  +    LLL+ + N +     G+ P+H A+  GN  I  LL+Q    ++   K    ++P  +A KW +T+ + L         ++K   IE             K   GLT L  AA S  ++++  +L+R  P+  K  N L                      + +H  A G  + ++AA I   H+           + L +AA  GH      ++ +   N     RA+        A  K   ++ E +        +  +   T LH A      ++V Y+L H  + D+ +      T L LA   +    I++L +     + + +  QTPLH A   G  D    L+     +D       T LH A  +G + V   ++ NGA      +  F      +    I +     +K     +  +N +T L +  H    ++ L  L+K  S  + A++G  ++ LH+A +  Q ++  +LL+ GA  +  +  G +PL          ++ ++ +   EI+N+LI + A +N  + N +T     ++ +N  +   L  N
Sbjct:  176 LHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAK--HNISPLHVAAKWGKTNMVSLL--------LEKGGNIE------------AKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGL----------------------APLHMAAQG--EHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDR---NADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE--TPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNG--HTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPL---------HLSSQEGH--AEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKN 689          

HSP 2 Score: 60.8474 bits (146), Expect = 8.542e-9
Identity = 76/328 (23.17%), Postives = 134/328 (40.85%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSENEIT--IPFEKSIIALSLMENALTLSIKFH-GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFE---MFC-------------------NSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN 1849
            ++R KV    LH A   +D      +LD+ +N D+ S +    T L +A    ++    +L Q     N   K++ +PLH A   G  +    L+ +  NI+     GLT LHCA   G E V + ++  GA      +  L  L    Q    +    + + ++ +    ++    L +  H G + +  L    +  +NAR  N  + LH+A K  + ++ + LL  GA +     +G +PL     M C                      + +         +I  IL+  GA ++ ++  + T    AS+L N  I++ LL +
Sbjct:  166 DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGF--TPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQH 491          

HSP 3 Score: 55.8398 bits (133), Expect = 2.572e-7
Identity = 29/78 (37.18%), Postives = 41/78 (52.56%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKK 403
            G+ P+H+A   G  N+V  LL    N++     GY P+H     G+  IV LLL+HK   + +T    G TP  IA+K
Sbjct:  700 GYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVN--GQTPLHIARK 775          

HSP 4 Score: 55.0694 bits (131), Expect = 4.410e-7
Identity = 33/88 (37.50%), Postives = 44/88 (50.00%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            G  P+HIAC+K  L +V LLL    +I      G  P+H A   G + IV  LLQH    D  T    G TP  +A + ++TD I + 
Sbjct:  370 GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVR--GETPLHLAARANQTDIIRIL 455          

HSP 5 Score: 51.9878 bits (123), Expect = 4.399e-6
Identity = 31/88 (35.23%), Postives = 48/88 (54.55%), Query Frame = 2
Query:  179 PIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDC--IELFH 436
            P+H+A + G  N+V LLL +  NIE +   G  P+H A  +G+ ++V +LL+    I  +TK   GL P  +A +    D   I L+H
Sbjct:  241 PLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKN--GLAPLHMAAQGEHVDAARILLYH 326          

HSP 6 Score: 51.2174 bits (121), Expect = 7.110e-6
Identity = 70/294 (23.81%), Postives = 111/294 (37.76%), Query Frame = 2
Query:  968 FTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGA--NYMKFVELNFLQFTCQSSENEIT-IPFEKSIIALSLMENALTLSIKFHGKLFLCFL-DKLNSTTSNARDGNNNSL--------LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKL 1813
            +T LH A  +   ++   +++  N   LD+  +   T L L     H K  ++L Q E   + Q K   TPLH A           L+ +  +       G T LH A  K   ++   ++  GA  N         L  + Q    EI+ +  E         +N LT        + LC   D +N      ++G N  +        LH+A    Q  + + LL +GA VD   S G +PL +     +             I N+L+ + A+ N ++ N  T    A KL
Sbjct:  503 YTALHIAAKEGQDEVAAVLIE--NGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLT-------PMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHC-----------HIVNLLLEHKANANAQTVNGQTPLHIARKL 776          

HSP 7 Score: 50.8322 bits (120), Expect = 7.801e-6
Identity = 27/88 (30.68%), Postives = 43/88 (48.86%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            GH P+HIA  K  ++I   LL        E   G+ P+H ++  G+ EI  LL++HK  ++   K   GLTP  +  +    +  E+ 
Sbjct:  601 GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKN--GLTPMHLCAQEDNVNVAEIL 686          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Zebrafish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 95.5153 bits (236), Expect = 2.329e-19
Identity = 129/558 (23.12%), Postives = 217/558 (38.89%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENL-IAAIKKN--DPIEFEKLCKSYDFMSQKLHTG----------LTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKEC----ILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLG--TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADI 1762
            ++   G  P+HIA     LN+  LLLN   ++      G  P+H A+  GN+ +V+LLL    +ID +TK    LTP   A +      IE+   +   I A  KN   PI         D + Q L             LT L  AA     ++ K +LD+           K  T   +  + L   C    +    ++ +H+A  +    + +          + L +++  GH   +  +M+K     +  V+    +  A      E+ E + +     +++ K + T LH A      +MVK +L+H  N    SN+ T    T L +A    H +   +L           K   TPLH A   G  D    L+ R  N +  G +GLT LH AV     +V   +++ G +        +      S +N+  +       A SL++         HG             ++NA      + LH+A +  QP++   L+   A V++ N +G +PL  +    +           + I +IL+ +GA +
Sbjct:  201 VLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDE--LTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGA---------KPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGL----------TPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKAN----SNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEV-------ASSLLQ---------HG------------ASANAESLQGVTPLHLASQEGQPDMVLLLISKQANVNLGNKSGLTPLHLVAQEGH-----------VGIADILVKHGASV 694          

HSP 2 Score: 72.4034 bits (176), Expect = 2.558e-12
Identity = 123/556 (22.12%), Postives = 221/556 (39.75%), Query Frame = 2
Query:  137 LEFVNKLID---------DKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIEL---------FHTENLIA----AIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIA-----------TQSF-----LEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXE----IQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLC--FLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPL 1663
            LE V  L+D         + G  P+ +A ++G  N+V LL+N     +         +H A  N +     +LLQ+    D  +K   G TP  IA  +   +  +L         F  +N I     A ++ + I    L      +  K    LT L  AA +   +II+ +LD+  P++ K  N L    +  + D L +  ++ + Y + I          ++ A   G H++A           T++      L IA ++ H   +D ++K +   +++    +       F      ++  + +  +   S +KV  T LH A      ++ +++L +   +D  + ++   T L  A  + H + +K+L +++  +N+      TPLH A   G       L++ +  + ++   G T LH A   G  +V   ++  GAN                       P     + L+ +  A+      H  L +    L K  S  S AR+G   + LH+A K  Q E+  SLL  GA  +  +  G +PL
Sbjct:  124 LEVVKFLLDNGANQTIPTEDGFTPLAVALQQGHENVVALLINHGTKGKVR----LPALHIAARNDDTRTAAVLLQNDPNPDVLSK--TGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHL-DCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVE-TPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQ--TPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGAN-----------------------PNAAGKVGLTPLHVAV-----HHNNLDVVNLLLSKGGSPHSAARNG--YTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPL 639          

HSP 3 Score: 60.8474 bits (146), Expect = 9.226e-9
Identity = 28/93 (30.11%), Postives = 48/93 (51.61%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            L +  G  P+H+  ++G + I  +L+    ++      GY P+H A   GNI++VK LLQ +  ++C+T+     TP   A +   TD + L 
Sbjct:  663 LGNKSGLTPLHLVAQEGHVGIADILVKHGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNCKTR--MSYTPLHQAAQQGHTDIVTLL 753          

HSP 4 Score: 58.151 bits (139), Expect = 6.134e-8
Identity = 28/88 (31.82%), Postives = 46/88 (52.27%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            G+ P+H+AC  G + +V  LL +  N+ C+    Y P+H A   G+ +IV LLL+H  + +  T    G +   IAK+      I++ 
Sbjct:  701 GYTPLHVACHYGNIKMVKFLLQQQANVNCKTRMSYTPLHQAAQQGHTDIVTLLLKHGAQPNEVTSN--GTSALAIAKRLGYISVIDVL 786          

HSP 5 Score: 50.8322 bits (120), Expect = 9.786e-6
Identity = 84/333 (25.23%), Postives = 130/333 (39.04%), Query Frame = 2
Query: 1025 LDH-PNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLM-----ENALTLSIKFHG-----KLFLCFLDKLNSTTSNAR-----DGNNNSL-------LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN-PI---FKNFSSKDFQMAFDNHWFQYAECLLKLL 1942
            LDH  N ID+++ N+     L LA    H K +  L  + +   T  K   T LH A  +G +     L+N   N++     G T L+ A  +    V + +++NGAN                     TIP E     L++      EN + L I  HG     +L    +   N  T  A      D N + L       LH+A       + + LL+ GA V+    NG +PL       N           + +  +L+  GA I+ K+ + +T    A++  + RI+  LL    PI    KN  S     A  +H     +C+ +LL
Sbjct:   29 LDHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHHGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLDNGANQ--------------------TIPTEDGFTPLAVALQQGHENVVALLIN-HGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGN-----------VIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHL----DCIRQLL 325          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 91.6633 bits (226), Expect = 2.722e-18
Identity = 131/622 (21.06%), Postives = 240/622 (38.59%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENL-IAAIKKN--DPIEFEKLCKSYDFMSQKLHTG----------LTILQTAADSNADKIIKCILDRPVE--NKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQMAFDNHW---FQYAECLLKLLSDSF 1954
            ++   G  P+HIA     L++  LLLN   N+      G  P+H A+  GN+ +V+LLL    +ID +TK    LTP   A +      +E+   +   + A  KN   PI         D + Q L             LT L  AA     +++K +LD+  +   + +N      I  + + + ++         ++ +H+A  +    + +          + L +AA  GH   +  ++++     +  V+    +  A      E+ + + +     +++ K + T LH A      ++VK +++H  N   DS      T L +A    H +  ++L           K   TPLH A   G  D    L+ R  N +  G  GLT LH AV     +V + +V+ G +        +      + +N++        +A SL++                         +N+      + LH+A +  QP++   L+   A V++ N NG +PL  +    +           + I ++L+  GA +   S    T    A    N +++  LL       N  ++   +  D  +   F  + C L+  + SF
Sbjct:  234 VLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDE--LTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSM--------DLLLKHSASLEAVTESGL----------TPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANP--DSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLE-------VASSLLQYG---------------------ANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGH-----------VGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQ-AHVNSKTRVSVLLLDASYTGLFSVSVCTLRTFAFSF 793          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 91.2781 bits (225), Expect = 5.154e-18
Identity = 124/585 (21.20%), Postives = 226/585 (38.63%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENL-IAAIKKN--DPIEFEKLCKSYDFMSQKLHTG----------LTILQTAADSNADKIIKCILDRPVE--NKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKT------IYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALL 1843
            ++   G  P+HIA     L++  LLLN   N+      G  P+H A+  GN+ +V+LLL    +ID +TK    LTP   A +      +E+   +   + A  KN   PI         D + Q L             LT L  AA     +++K +LD+  +   + +N      I  + + + ++         ++ +H+A  +    + +          + L +AA  GH   +  ++++       I++       +  A      E+ + + +     +++ K + T LH A      ++VK +++H  N   DS      T L +A    H +  ++L           K   TPLH A   G  D    L+ R  N +  G  GLT LH AV     +V + +V+ G +        +      + +N++        +A SL++                         +N+      + LH+A +  QP++   L+   A V++ N NG +PL  +    +           + I ++L+  GA +   S    T    A    N +++  LL
Sbjct:  231 VLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDE--LTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSM--------DLLLKHSASLEAVTESGL----------TPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANP--DSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLE-------VASSLLQYG---------------------ANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGH-----------VGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLL 754          

HSP 2 Score: 61.6178 bits (148), Expect = 5.134e-9
Identity = 27/88 (30.68%), Postives = 47/88 (53.41%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            G  P+H+  ++G + I  +L+ +  ++      GY P+H A   GNI++VK LLQ +  ++ +T+   G TP   A +   TD + L 
Sbjct:  701 GLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTR--LGYTPLHQAAQQGHTDIVTLL 786          

HSP 3 Score: 57.3806 bits (137), Expect = 1.001e-7
Identity = 28/88 (31.82%), Postives = 46/88 (52.27%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            G+ P+H+AC  G + +V  LL +  ++  +   GY P+H A   G+ +IV LLL+H    +  T    G +P  IAK+      I++ 
Sbjct:  734 GYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTN--GTSPLGIAKRLGYISVIDVL 819          

HSP 4 Score: 50.8322 bits (120), Expect = 9.723e-6
Identity = 88/378 (23.28%), Postives = 152/378 (40.21%), Query Frame = 2
Query:  788 LEIAAEQGH-----ELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDD--NCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKS--IIALSLMENALTLSIKF--------------HGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            L +A+++GH     EL  +GI  +T   K     A+  A     +++  E+        ++ +  F+ L+ A  +N  ++VKY+L+H  N  L +  E   T LA+A    H   + +L  Y     T+ K     LH  IA+  DD      L+    N D +   G T LH A      +V + ++N GAN         + FT ++    + I   +   I+   L++    +  K               H ++    LD+       A+  N  S +HMA +    +  + LL   A++D +  +  +PL       + RM +           +L+  GA  N ++ N  T    A K  + R M  LL ++
Sbjct:   79 LHLASKEGHVKMVLELLHNGIDLETTTKKG--NTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPT--EDGFTPLAVALQQGHENVVALLINY----GTKGKVRLPALH--IAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGAN---------VNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQ--GAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVK-----------VLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHS 424          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Zebrafish
Match: ank2b (ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041010-165])

HSP 1 Score: 90.8929 bits (224), Expect = 5.302e-18
Identity = 132/583 (22.64%), Postives = 227/583 (38.94%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIE-FEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALT---------LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALL 1843
            G  P+HIA   G +N+  LLLN    ++     G  P+H A+  GN  +V LLL    +ID +T+   GLTP   A +      +EL           T+N ++ +    + D +E  + L +    +       LT L  AA     ++ K +LD     K  N   + +    +  + L   C   R  + +    +  FI A   +G   I   +F+      GH   +  +++         +R   A+  A      E+   +     + ++R + + T LH A     T++V+ +L H  + D  + N    T L +A    H     VL +   A +   K   TPLH A   G  +    L+ R    D  G  GLT LH A     + V   +++ GA+     +  +      + +N++ I    +++      N  T          S + H ++    L +        + G  +  LH+A +  +  + + L+  GA +D     G +PL       N++M            N L+  GA +N K+ N  T    A++  N  I+  LL
Sbjct:  214 GFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRD--GLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLD-----KRANPNARAL----NGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFM------GHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGY--TPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEI--ATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTS--LHLAAQEDKVGVGEILVKQGANLDQQTKLGYTPLIVACHYGNAKM-----------VNFLLKSGASVNDKTKNGYTPLHQAAQQGNTHIINVLL 762          

HSP 2 Score: 85.1149 bits (209), Expect = 3.813e-16
Identity = 122/556 (21.94%), Postives = 212/556 (38.13%), Query Frame = 2
Query:  182 IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXX---XXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASK 1810
            +HIA  K       LLL  + N + +   G+ P+H A   GN+ +  LLL     +D   +   G+TP  +A K   T+ + L          K  D                    GLT L  AA S  D  ++ +L+R  P+  +  N L    +  + D +     EC+ +   + QH A                +   + L +AA  GH      ++ K     +  +           K   ++ E + +     ++  +   T +H A      ++V  +L   N    D +N    TAL +A      + ++ L +     + + +  QTPLH A   G  +    L+    + D     G T LH A  +G  +V   ++  GA +    +  F      S    + +     ++     S  +N LT L +  H    K+ L  LDK  S  + A++G   + LH+A K  Q E+  +LL  GA+ ++    G  P+       +S           E+  +L+  GA +NV + + +T    A++
Sbjct:  185 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN--GITPLHVASKRGNTNMVHLLLDRGAQIDAKTRD--------------------GLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHV-----ECVKH---LLQHKAPVDDVT----------LDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQ--NGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNG--YTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHS-----------EMAALLLQRGAQVNVTTKSGLTSLHLAAQ 685          

HSP 3 Score: 79.337 bits (194), Expect = 1.836e-14
Identity = 125/551 (22.69%), Postives = 196/551 (35.57%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWF-------------------------------GLTPFDIAKKWSRTDCIELF-HTENLIAAIKKND--PIEFEKLCKSYDFMSQKLHTGL----------TILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKL-----SNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGH----ELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPL 1663
            G  P+H A   G    V LLL     +      G  P+H A    ++E VK LLQHK  +D  T  +                                G TP  IA K +R   +EL       I AI ++   PI         + +   L  G           T L  AA +   ++++C+L         N  M +     D+      S L K  I+   ++ QH A      +AA  NG       + L IAA +GH     + ++     ++  K  +   +  A      E+ + + +R    +S  K   T LH A   ++  +   +LD   +    + N    T L +A   +  +    L QY   TN Q K    P+H A   G  +    L+ R   ++     GLT LH A  +    V E +V  GAN  +  +L +                             L ++  +     + FL K  ++  N +  N  + LH A +     +   LL  GAK + +  NGN+ L
Sbjct:  280 GLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLR--------NGAMVDARAREDQTPLHIASRLGKTEIV--QLLLQHMA----HPDAATANG------YTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFT-PLHVASKYGSLEVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGY--TPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTKLGY---------------------------TPLIVACHYGNAKMVNFLLKSGASV-NDKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTAL 779          

HSP 4 Score: 63.5438 bits (153), Expect = 1.385e-9
Identity = 95/422 (22.51%), Postives = 169/422 (40.05%), Query Frame = 2
Query:  788 LEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSN-----------------------NETLG----TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSS---ENEITIPFEKSIIALSLMENALT-LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN--NPIFKNFSSKD-FQMAFDNHWFQYAECLLK 1936
            L +AA++GH   +  ++ +     S   +   A+  A      ++ + +++R     ++ +  FT L+ A  +N  D+V+Y+L++  N  + +                        N+T G     AL +A      K   +L Q +   + Q+K   TPLH A   G  +    L+NR   +D     G+T LH A  +G  N+   +++ GA              C +    +  + +  E+    L+  +N L+ L +   G    C +  L    +   D   + L  LH+A  C    + K LLD  A  +    NG +PL  + C  N           +++  +LI YGA I   + + +T    A+ + +  I+L LL N  +P   N   +    MA      +   CLL+
Sbjct:   57 LHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVEC-VKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPL-HIACKKNR----------VKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLR 466          

HSP 5 Score: 62.3882 bits (150), Expect = 2.967e-9
Identity = 90/371 (24.26%), Postives = 145/371 (39.08%), Query Frame = 2
Query:  152 KLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF--HTENLIAAIKKN-DPIEFEKLCKSYDFMSQKLHT----------GLTILQTAADSNADKIIKCILDR--PVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAA---GFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLG-TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASG 1204
            + I + G  PIH+A   G LNIV+LLL    + +  +I G   +H A   G +E+V+ LL++   +D R +     TP  IA +  +T+ ++L   H  +  AA      P+         D  +  L            G T L  A+   + ++ K +L R  P ++   N L    +    D   N     +L       HA    G+     AA  N   +IAT + L+  AE             T       V  I  A  +   E+   + +R        K   T LH A  ++   + + ++    N+D  +    LG T L +A    + K +  L +   + N + K   TPLH+A   G
Sbjct:  406 QAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAR--EDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKNGLTPLHVAAHYD---NQKVALLLLDKGASPHATAKNGYTPLHIAAKKN-QMEIAT-TLLQYGAE-------------TNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTK---LGYTPLIVACHYGNAKMVNFLLKSGASVNDKTKNGYTPLHQAAQQG 753          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 90.8929 bits (224), Expect = 5.546e-18
Identity = 124/585 (21.20%), Postives = 226/585 (38.63%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENL-IAAIKKN--DPIEFEKLCKSYDFMSQKLHTG----------LTILQTAADSNADKIIKCILDRPVE--NKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKT------IYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALL 1843
            ++   G  P+HIA     L++  LLLN   N+      G  P+H A+  GN+ +V+LLL    +ID +TK    LTP   A +      +E+   +   + A  KN   PI         D + Q L             LT L  AA     +++K +LD+  +   + +N      I  + + + ++         ++ +H+A  +    + +          + L +AA  GH   +  ++++       I++       +  A      E+ + + +     +++ K + T LH A      ++VK +++H  N   DS      T L +A    H +  ++L           K   TPLH A   G  D    L+ R  N +  G  GLT LH AV     +V + +V+ G +        +      + +N++        +A SL++                         +N+      + LH+A +  QP++   L+   A V++ N NG +PL  +    +           + I ++L+  GA +   S    T    A    N +++  LL
Sbjct:  212 VLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDE--LTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSM--------DLLLKHSASLEAVTESGL----------TPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANP--DSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLE-------VASSLLQYG---------------------ANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGH-----------VGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLL 735          

HSP 2 Score: 61.2326 bits (147), Expect = 6.226e-9
Identity = 27/88 (30.68%), Postives = 47/88 (53.41%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            G  P+H+  ++G + I  +L+ +  ++      GY P+H A   GNI++VK LLQ +  ++ +T+   G TP   A +   TD + L 
Sbjct:  682 GLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTR--LGYTPLHQAAQQGHTDIVTLL 767          

HSP 3 Score: 56.9954 bits (136), Expect = 1.214e-7
Identity = 28/88 (31.82%), Postives = 46/88 (52.27%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            G+ P+H+AC  G + +V  LL +  ++  +   GY P+H A   G+ +IV LLL+H    +  T    G +P  IAK+      I++ 
Sbjct:  715 GYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTN--GTSPLGIAKRLGYISVIDVL 800          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 87.8113 bits (216), Expect = 7.629e-17
Identity = 139/589 (23.60%), Postives = 235/589 (39.90%), Query Frame = 2
Query:  164 DKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAIK---KNDPIEFEK-LCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALT---------LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN 1849
            + G  P+HIA   G +N+  LLLN    ++     G  P+H A+  GN  +VKLLL    +ID +T+   GLTP   A +      +EL           T+N ++ +    + D +E  K L +    +       LT L  AA     ++ K +LD     K  N   + +    +  + L   C   R  + +    +   I A   +G   I   +F+      GH   +  +++         +R   A+  A      E+   +     L ++R +   T LH A     T++V+ +L H  + D  + N    T L ++          VL +   A +   K   TPLH A   G  D    L+ R    D  G  GLT LH A     + V   +++ GA+     +  +      S +N++ I    +++      N LT          + + H  +    L+K     +N   G  N L  LH+A +  +  + + L  +GA +D     G SPL  + C+  +          I++ N L+ +GA++N K+ N  T    A++  +  I+  LL N
Sbjct:  231 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD--GLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLD-----KRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFM------GHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIA--TTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNK----QANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLI-VACHYGN----------IKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQN 783          

HSP 2 Score: 60.077 bits (144), Expect = 2.467e-8
Identity = 85/341 (24.93%), Postives = 130/341 (38.12%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSN---NETLGTALALAHSLHHRKCIKV---LQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN--NPIFKNFSSKD-FQMAFDNHWFQYAECLLK 1936
            +++ KV    LH A   +DT     +L + +N D+ S    N T  +     H   H   + V   L     A +   +   TPLH A   G  +    L++R   ID     GLT LHCA   G + V E ++  GA  +   +  L+ L    Q    E      K ++      + +T             LD L S             LH+A  C    + K LLD  A  +    NG +PL  + C  N           I++  +L+ YGA I   + + +T    A+ + +  I+L LL N  +P   N   +    MA      +   CLL+
Sbjct:  186 DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECV----KHLLQHKAPVDDVT-------------LDYLTS-------------LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPL-HIACKKNR----------IKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLR 485          

HSP 3 Score: 56.6102 bits (135), Expect = 3.000e-7
Identity = 31/92 (33.70%), Postives = 50/92 (54.35%), Query Frame = 2
Query:  158 IDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            I + G  PIH+A   G LNIV+LLL    + +  +I G   +H A   G +E+V+ LL++   +D R +     TP  IA +  +T+ ++L 
Sbjct:  427 ITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARARE--EQTPLHIASRLGKTEIVQLL 516          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 87.8113 bits (216), Expect = 7.964e-17
Identity = 139/589 (23.60%), Postives = 235/589 (39.90%), Query Frame = 2
Query:  164 DKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAIK---KNDPIEFEK-LCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALT---------LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN 1849
            + G  P+HIA   G +N+  LLLN    ++     G  P+H A+  GN  +VKLLL    +ID +T+   GLTP   A +      +EL           T+N ++ +    + D +E  K L +    +       LT L  AA     ++ K +LD     K  N   + +    +  + L   C   R  + +    +   I A   +G   I   +F+      GH   +  +++         +R   A+  A      E+   +     L ++R +   T LH A     T++V+ +L H  + D  + N    T L ++          VL +   A +   K   TPLH A   G  D    L+ R    D  G  GLT LH A     + V   +++ GA+     +  +      S +N++ I    +++      N LT          + + H  +    L+K     +N   G  N L  LH+A +  +  + + L  +GA +D     G SPL  + C+  +          I++ N L+ +GA++N K+ N  T    A++  +  I+  LL N
Sbjct:  210 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD--GLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLD-----KRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFM------GHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIA--TTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNK----QANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLI-VACHYGN----------IKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQN 762          

HSP 2 Score: 60.077 bits (144), Expect = 2.641e-8
Identity = 85/341 (24.93%), Postives = 130/341 (38.12%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSN---NETLGTALALAHSLHHRKCIKV---LQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN--NPIFKNFSSKD-FQMAFDNHWFQYAECLLK 1936
            +++ KV    LH A   +DT     +L + +N D+ S    N T  +     H   H   + V   L     A +   +   TPLH A   G  +    L++R   ID     GLT LHCA   G + V E ++  GA  +   +  L+ L    Q    E      K ++      + +T             LD L S             LH+A  C    + K LLD  A  +    NG +PL  + C  N           I++  +L+ YGA I   + + +T    A+ + +  I+L LL N  +P   N   +    MA      +   CLL+
Sbjct:  165 DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECV----KHLLQHKAPVDDVT-------------LDYLTS-------------LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPL-HIACKKNR----------IKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLR 464          

HSP 3 Score: 56.6102 bits (135), Expect = 3.131e-7
Identity = 31/92 (33.70%), Postives = 50/92 (54.35%), Query Frame = 2
Query:  158 IDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            I + G  PIH+A   G LNIV+LLL    + +  +I G   +H A   G +E+V+ LL++   +D R +     TP  IA +  +T+ ++L 
Sbjct:  406 ITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARARE--EQTPLHIASRLGKTEIVQLL 495          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 87.4261 bits (215), Expect = 9.825e-17
Identity = 139/589 (23.60%), Postives = 235/589 (39.90%), Query Frame = 2
Query:  164 DKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAIK---KNDPIEFEK-LCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALT---------LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN 1849
            + G  P+HIA   G +N+  LLLN    ++     G  P+H A+  GN  +VKLLL    +ID +T+   GLTP   A +      +EL           T+N ++ +    + D +E  K L +    +       LT L  AA     ++ K +LD     K  N   + +    +  + L   C   R  + +    +   I A   +G   I   +F+      GH   +  +++         +R   A+  A      E+   +     L ++R +   T LH A     T++V+ +L H  + D  + N    T L ++          VL +   A +   K   TPLH A   G  D    L+ R    D  G  GLT LH A     + V   +++ GA+     +  +      S +N++ I    +++      N LT          + + H  +    L+K     +N   G  N L  LH+A +  +  + + L  +GA +D     G SPL  + C+  +          I++ N L+ +GA++N K+ N  T    A++  +  I+  LL N
Sbjct:  210 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD--GLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLD-----KRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFM------GHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIA--TTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNK----QANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLI-VACHYGN----------IKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQN 762          

HSP 2 Score: 59.6918 bits (143), Expect = 2.799e-8
Identity = 85/341 (24.93%), Postives = 130/341 (38.12%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSN---NETLGTALALAHSLHHRKCIKV---LQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN--NPIFKNFSSKD-FQMAFDNHWFQYAECLLK 1936
            +++ KV    LH A   +DT     +L + +N D+ S    N T  +     H   H   + V   L     A +   +   TPLH A   G  +    L++R   ID     GLT LHCA   G + V E ++  GA  +   +  L+ L    Q    E      K ++      + +T             LD L S             LH+A  C    + K LLD  A  +    NG +PL  + C  N           I++  +L+ YGA I   + + +T    A+ + +  I+L LL N  +P   N   +    MA      +   CLL+
Sbjct:  165 DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECV----KHLLQHKAPVDDVT-------------LDYLTS-------------LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPL-HIACKKNR----------IKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLR 464          

HSP 3 Score: 56.225 bits (134), Expect = 3.235e-7
Identity = 31/92 (33.70%), Postives = 50/92 (54.35%), Query Frame = 2
Query:  158 IDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            I + G  PIH+A   G LNIV+LLL    + +  +I G   +H A   G +E+V+ LL++   +D R +     TP  IA +  +T+ ++L 
Sbjct:  406 ITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARARE--EQTPLHIASRLGKTEIVQLL 495          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 87.4261 bits (215), Expect = 1.238e-16
Identity = 140/589 (23.77%), Postives = 235/589 (39.90%), Query Frame = 2
Query:  164 DKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAIK---KNDPIEFEK-LCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALT---------LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN 1849
            + G  P+HIA   G +N+  LLLN    ++     G  P+H A+  GN  +VKLLL    +ID +T+   GLTP   A +      +EL           T+N ++ +    + D +E  K L +    +       LT L  AA     ++ K +LD     K  N   + +    +  + L   C   R  + +    +   I A   +G   I       +AA  GH   +  +++         +R   A+  A      E+   +     L ++R +   T LH A     T++V+ +L H  + D  + N    T L ++          VL +   A +   K   TPLH A   G  D    L+ R    D  G  GLT LH A     + V   +++ GA+     +  +      S +N++ I    +++      N LT          + + H  +    L+K     +N   G  N L  LH+A +  +  + + L  +GA +D     G SPL  + C+  +          I++ N L+ +GA++N K+ N  T    A++  +  I+  LL N
Sbjct:  227 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD--GLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLD-----KRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPI------HVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIA--TTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNK----QANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLI-VACHYGN----------IKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQN 779          

HSP 2 Score: 59.6918 bits (143), Expect = 3.354e-8
Identity = 85/341 (24.93%), Postives = 130/341 (38.12%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSN---NETLGTALALAHSLHHRKCIKV---LQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN--NPIFKNFSSKD-FQMAFDNHWFQYAECLLK 1936
            +++ KV    LH A   +DT     +L + +N D+ S    N T  +     H   H   + V   L     A +   +   TPLH A   G  +    L++R   ID     GLT LHCA   G + V E ++  GA  +   +  L+ L    Q    E      K ++      + +T             LD L S             LH+A  C    + K LLD  A  +    NG +PL  + C  N           I++  +L+ YGA I   + + +T    A+ + +  I+L LL N  +P   N   +    MA      +   CLL+
Sbjct:  182 DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECV----KHLLQHKAPVDDVT-------------LDYLTS-------------LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPL-HIACKKNR----------IKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLR 481          

HSP 3 Score: 56.225 bits (134), Expect = 3.413e-7
Identity = 31/92 (33.70%), Postives = 50/92 (54.35%), Query Frame = 2
Query:  158 IDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            I + G  PIH+A   G LNIV+LLL    + +  +I G   +H A   G +E+V+ LL++   +D R +     TP  IA +  +T+ ++L 
Sbjct:  423 ITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARARE--EQTPLHIASRLGKTEIVQLL 512          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 87.4261 bits (215), Expect = 1.248e-16
Identity = 140/589 (23.77%), Postives = 235/589 (39.90%), Query Frame = 2
Query:  164 DKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAIK---KNDPIEFEK-LCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALT---------LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN 1849
            + G  P+HIA   G +N+  LLLN    ++     G  P+H A+  GN  +VKLLL    +ID +T+   GLTP   A +      +EL           T+N ++ +    + D +E  K L +    +       LT L  AA     ++ K +LD     K  N   + +    +  + L   C   R  + +    +   I A   +G   I       +AA  GH   +  +++         +R   A+  A      E+   +     L ++R +   T LH A     T++V+ +L H  + D  + N    T L ++          VL +   A +   K   TPLH A   G  D    L+ R    D  G  GLT LH A     + V   +++ GA+     +  +      S +N++ I    +++      N LT          + + H  +    L+K     +N   G  N L  LH+A +  +  + + L  +GA +D     G SPL  + C+  +          I++ N L+ +GA++N K+ N  T    A++  +  I+  LL N
Sbjct:  227 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD--GLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTSLHVAAHCGHYRVTKLLLD-----KRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPI------HVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAPPDAAGKNGLTPLHVAAHYDNQKVALLLLDKGASPQVTAKNGYTPLHIASKKNQMQIA--TTLLNYGAETNILTNQGVTPLHLAAQEGHADMVTLLLNK----QANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLI-VACHYGN----------IKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQN 779          

HSP 2 Score: 59.6918 bits (143), Expect = 3.354e-8
Identity = 85/341 (24.93%), Postives = 130/341 (38.12%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSN---NETLGTALALAHSLHHRKCIKV---LQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN--NPIFKNFSSKD-FQMAFDNHWFQYAECLLK 1936
            +++ KV    LH A   +DT     +L + +N D+ S    N T  +     H   H   + V   L     A +   +   TPLH A   G  +    L++R   ID     GLT LHCA   G + V E ++  GA  +   +  L+ L    Q    E      K ++      + +T             LD L S             LH+A  C    + K LLD  A  +    NG +PL  + C  N           I++  +L+ YGA I   + + +T    A+ + +  I+L LL N  +P   N   +    MA      +   CLL+
Sbjct:  182 DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECV----KHLLQHKAPVDDVT-------------LDYLTS-------------LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPL-HIACKKNR----------IKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLR 481          

HSP 3 Score: 56.225 bits (134), Expect = 3.442e-7
Identity = 31/92 (33.70%), Postives = 50/92 (54.35%), Query Frame = 2
Query:  158 IDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            I + G  PIH+A   G LNIV+LLL    + +  +I G   +H A   G +E+V+ LL++   +D R +     TP  IA +  +T+ ++L 
Sbjct:  423 ITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARARE--EQTPLHIASRLGKTEIVQLL 512          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 97.4413 bits (241), Expect = 6.950e-20
Identity = 134/593 (22.60%), Postives = 235/593 (39.63%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIEFEKLCKSYDFMSQKLHTG-LTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLT-------KECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALT----LSIKF---HGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            G  P+HIA   G +N+  LLLN    ++        P+H A+  GN  +VKLLL    +ID +T+   GLTP     +      +E+           T+N ++ +    + D +   +L   ++     +    LT L  AA     K+ K +LD            K+ +     L+  T       K  I    ++ +H A  +    + +          + + +AA  GH   +  +M       +  VR   A+  A      E+   + +     E++ K + T LH +      D+V+ +L        ++   +  T L LA    H      L  +  + +   K   TPLH A   G  +    L+ +S + D  G  GLT LH A     + V   +++ GA+     +  +      + +N++ I    S++      NA+T     S+      G + +  L  L S  +N    N + L  LH+A +  +  + + L++ GA VD     G +PL  + C+  +          I+I N L+ + A +N K+ N  T    A++  +  I+  LL NN
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLD------------KKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGL----------TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ--GASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDI--ATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSL--LLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPL-HVGCHYGN----------IKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNN 769          

HSP 2 Score: 59.3066 bits (142), Expect = 2.717e-8
Identity = 28/93 (30.11%), Postives = 50/93 (53.76%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            L +  G  P+H+A ++  +N+  +L+N+  +++ +   GY P+H     GNI+IV  LLQH  +++ +TK   G T    A +   T  I + 
Sbjct:  675 LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN--GYTALHQAAQQGHTHIINVL 765          

HSP 3 Score: 54.6842 bits (130), Expect = 6.883e-7
Identity = 27/101 (26.73%), Postives = 47/101 (46.53%), Query Frame = 2
Query:  104 GKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKW 406
            GK + +++ L+           G+ P+H+A  +G  ++   LL+   ++      G+ P+H A   G +E+  LLLQ     D    G  GLTP  +A  +
Sbjct:  493 GKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDA--AGKSGLTPLHVAAHY 591          

HSP 4 Score: 53.1434 bits (126), Expect = 2.366e-6
Identity = 76/326 (23.31%), Postives = 129/326 (39.57%), Query Frame = 2
Query:  965 NFTILHSAICDNDTDMVKYILD-----------------------HPNNIDLDSNNETLG----TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSS---ENEITIPFEKSIIALSLMENALT-LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALL 1843
             FT L+ A  +N  ++V+++LD                       H   + L   N+T G     AL +A      K   +L Q +   + ++K   TPLH A   G  +    L+NR+  +D      +T LH A  +G  N+ + +++ GA              C +    E  + +  ++S   LS  +N L+ L +   G    C    L        D  N+ L  LH+A  C   ++ K LLD  A  +    NG +PL  + C  N           I +  +L+ +GA I   + + +T    A+ + +  I+  L+
Sbjct:  123 GFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVP-VDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPL-HIACKKNR----------IRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 436          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 97.0561 bits (240), Expect = 7.672e-20
Identity = 134/593 (22.60%), Postives = 235/593 (39.63%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIEFEKLCKSYDFMSQKLHTG-LTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLT-------KECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALT----LSIKF---HGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            G  P+HIA   G +N+  LLLN    ++        P+H A+  GN  +VKLLL    +ID +T+   GLTP     +      +E+           T+N ++ +    + D +   +L   ++     +    LT L  AA     K+ K +LD            K+ +     L+  T       K  I    ++ +H A  +    + +          + + +AA  GH   +  +M       +  VR   A+  A      E+   + +     E++ K + T LH +      D+V+ +L        ++   +  T L LA    H      L  +  + +   K   TPLH A   G  +    L+ +S + D  G  GLT LH A     + V   +++ GA+     +  +      + +N++ I    S++      NA+T     S+      G + +  L  L S  +N    N + L  LH+A +  +  + + L++ GA VD     G +PL  + C+  +          I+I N L+ + A +N K+ N  T    A++  +  I+  LL NN
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLD------------KKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGL----------TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ--GASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDI--ATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSL--LLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLH-VGCHYGN----------IKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNN 769          

HSP 2 Score: 59.3066 bits (142), Expect = 3.003e-8
Identity = 23/73 (31.51%), Postives = 44/73 (60.27%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWF 373
            L +  G  P+H+A ++  +N+  +L+N+  +++ +   GY P+H     GNI+IV  LLQH  +++ +TK  +
Sbjct:  675 LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY 747          

HSP 3 Score: 54.6842 bits (130), Expect = 8.203e-7
Identity = 27/101 (26.73%), Postives = 47/101 (46.53%), Query Frame = 2
Query:  104 GKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKW 406
            GK + +++ L+           G+ P+H+A  +G  ++   LL+   ++      G+ P+H A   G +E+  LLLQ     D    G  GLTP  +A  +
Sbjct:  493 GKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDA--AGKSGLTPLHVAAHY 591          

HSP 4 Score: 53.1434 bits (126), Expect = 2.302e-6
Identity = 76/326 (23.31%), Postives = 129/326 (39.57%), Query Frame = 2
Query:  965 NFTILHSAICDNDTDMVKYILD-----------------------HPNNIDLDSNNETLG----TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSS---ENEITIPFEKSIIALSLMENALT-LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALL 1843
             FT L+ A  +N  ++V+++LD                       H   + L   N+T G     AL +A      K   +L Q +   + ++K   TPLH A   G  +    L+NR+  +D      +T LH A  +G  N+ + +++ GA              C +    E  + +  ++S   LS  +N L+ L +   G    C    L        D  N+ L  LH+A  C   ++ K LLD  A  +    NG +PL  + C  N           I +  +L+ +GA I   + + +T    A+ + +  I+  L+
Sbjct:  123 GFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVP-VDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLH-IACKKN----------RIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 436          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 97.0561 bits (240), Expect = 8.791e-20
Identity = 134/593 (22.60%), Postives = 235/593 (39.63%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIEFEKLCKSYDFMSQKLHTG-LTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLT-------KECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALT----LSIKF---HGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            G  P+HIA   G +N+  LLLN    ++        P+H A+  GN  +VKLLL    +ID +T+   GLTP     +      +E+           T+N ++ +    + D +   +L   ++     +    LT L  AA     K+ K +LD            K+ +     L+  T       K  I    ++ +H A  +    + +          + + +AA  GH   +  +M       +  VR   A+  A      E+   + +     E++ K + T LH +      D+V+ +L        ++   +  T L LA    H      L  +  + +   K   TPLH A   G  +    L+ +S + D  G  GLT LH A     + V   +++ GA+     +  +      + +N++ I    S++      NA+T     S+      G + +  L  L S  +N    N + L  LH+A +  +  + + L++ GA VD     G +PL  + C+  +          I+I N L+ + A +N K+ N  T    A++  +  I+  LL NN
Sbjct:  229 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLD------------KKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGL----------TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ--GASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDI--ATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSL--LLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPL-HVGCHYGN----------IKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNN 780          

HSP 2 Score: 59.3066 bits (142), Expect = 2.772e-8
Identity = 28/93 (30.11%), Postives = 50/93 (53.76%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            L +  G  P+H+A ++  +N+  +L+N+  +++ +   GY P+H     GNI+IV  LLQH  +++ +TK   G T    A +   T  I + 
Sbjct:  686 LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN--GYTALHQAAQQGHTHIINVL 776          

HSP 3 Score: 55.0694 bits (131), Expect = 6.504e-7
Identity = 27/101 (26.73%), Postives = 47/101 (46.53%), Query Frame = 2
Query:  104 GKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKW 406
            GK + +++ L+           G+ P+H+A  +G  ++   LL+   ++      G+ P+H A   G +E+  LLLQ     D    G  GLTP  +A  +
Sbjct:  504 GKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDA--AGKSGLTPLHVAAHY 602          

HSP 4 Score: 52.7582 bits (125), Expect = 3.299e-6
Identity = 76/326 (23.31%), Postives = 129/326 (39.57%), Query Frame = 2
Query:  965 NFTILHSAICDNDTDMVKYILD-----------------------HPNNIDLDSNNETLG----TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSS---ENEITIPFEKSIIALSLMENALT-LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALL 1843
             FT L+ A  +N  ++V+++LD                       H   + L   N+T G     AL +A      K   +L Q +   + ++K   TPLH A   G  +    L+NR+  +D      +T LH A  +G  N+ + +++ GA              C +    E  + +  ++S   LS  +N L+ L +   G    C    L        D  N+ L  LH+A  C   ++ K LLD  A  +    NG +PL  + C  N           I +  +L+ +GA I   + + +T    A+ + +  I+  L+
Sbjct:  134 GFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVP-VDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPL-HIACKKN----------RIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 447          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 97.0561 bits (240), Expect = 9.736e-20
Identity = 134/593 (22.60%), Postives = 235/593 (39.63%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIEFEKLCKSYDFMSQKLHTG-LTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLT-------KECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALT----LSIKF---HGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            G  P+HIA   G +N+  LLLN    ++        P+H A+  GN  +VKLLL    +ID +T+   GLTP     +      +E+           T+N ++ +    + D +   +L   ++     +    LT L  AA     K+ K +LD            K+ +     L+  T       K  I    ++ +H A  +    + +          + + +AA  GH   +  +M       +  VR   A+  A      E+   + +     E++ K + T LH +      D+V+ +L        ++   +  T L LA    H      L  +  + +   K   TPLH A   G  +    L+ +S + D  G  GLT LH A     + V   +++ GA+     +  +      + +N++ I    S++      NA+T     S+      G + +  L  L S  +N    N + L  LH+A +  +  + + L++ GA VD     G +PL  + C+  +          I+I N L+ + A +N K+ N  T    A++  +  I+  LL NN
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLD------------KKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGL----------TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ--GASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDI--ATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSL--LLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLH-VGCHYGN----------IKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNN 769          

HSP 2 Score: 59.3066 bits (142), Expect = 2.954e-8
Identity = 23/73 (31.51%), Postives = 44/73 (60.27%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWF 373
            L +  G  P+H+A ++  +N+  +L+N+  +++ +   GY P+H     GNI+IV  LLQH  +++ +TK  +
Sbjct:  675 LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY 747          

HSP 3 Score: 54.6842 bits (130), Expect = 7.042e-7
Identity = 27/101 (26.73%), Postives = 47/101 (46.53%), Query Frame = 2
Query:  104 GKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKW 406
            GK + +++ L+           G+ P+H+A  +G  ++   LL+   ++      G+ P+H A   G +E+  LLLQ     D    G  GLTP  +A  +
Sbjct:  493 GKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDA--AGKSGLTPLHVAAHY 591          

HSP 4 Score: 52.7582 bits (125), Expect = 3.280e-6
Identity = 76/326 (23.31%), Postives = 129/326 (39.57%), Query Frame = 2
Query:  965 NFTILHSAICDNDTDMVKYILD-----------------------HPNNIDLDSNNETLG----TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSS---ENEITIPFEKSIIALSLMENALT-LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALL 1843
             FT L+ A  +N  ++V+++LD                       H   + L   N+T G     AL +A      K   +L Q +   + ++K   TPLH A   G  +    L+NR+  +D      +T LH A  +G  N+ + +++ GA              C +    E  + +  ++S   LS  +N L+ L +   G    C    L        D  N+ L  LH+A  C   ++ K LLD  A  +    NG +PL  + C  N           I +  +L+ +GA I   + + +T    A+ + +  I+  L+
Sbjct:  123 GFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVP-VDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLH-IACKKN----------RIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 436          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 96.6709 bits (239), Expect = 1.069e-19
Identity = 134/593 (22.60%), Postives = 235/593 (39.63%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIEFEKLCKSYDFMSQKLHTG-LTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLT-------KECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALT----LSIKF---HGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            G  P+HIA   G +N+  LLLN    ++        P+H A+  GN  +VKLLL    +ID +T+   GLTP     +      +E+           T+N ++ +    + D +   +L   ++     +    LT L  AA     K+ K +LD            K+ +     L+  T       K  I    ++ +H A  +    + +          + + +AA  GH   +  +M       +  VR   A+  A      E+   + +     E++ K + T LH +      D+V+ +L        ++   +  T L LA    H      L  +  + +   K   TPLH A   G  +    L+ +S + D  G  GLT LH A     + V   +++ GA+     +  +      + +N++ I    S++      NA+T     S+      G + +  L  L S  +N    N + L  LH+A +  +  + + L++ GA VD     G +PL  + C+  +          I+I N L+ + A +N K+ N  T    A++  +  I+  LL NN
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLD------------KKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGL----------TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ--GASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDI--ATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSL--LLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLH-VGCHYGN----------IKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNN 769          

HSP 2 Score: 59.3066 bits (142), Expect = 3.018e-8
Identity = 23/73 (31.51%), Postives = 44/73 (60.27%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWF 373
            L +  G  P+H+A ++  +N+  +L+N+  +++ +   GY P+H     GNI+IV  LLQH  +++ +TK  +
Sbjct:  675 LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY 747          

HSP 3 Score: 54.6842 bits (130), Expect = 7.438e-7
Identity = 27/101 (26.73%), Postives = 47/101 (46.53%), Query Frame = 2
Query:  104 GKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKW 406
            GK + +++ L+           G+ P+H+A  +G  ++   LL+   ++      G+ P+H A   G +E+  LLLQ     D    G  GLTP  +A  +
Sbjct:  493 GKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDA--AGKSGLTPLHVAAHY 591          

HSP 4 Score: 52.7582 bits (125), Expect = 2.901e-6
Identity = 76/326 (23.31%), Postives = 129/326 (39.57%), Query Frame = 2
Query:  965 NFTILHSAICDNDTDMVKYILD-----------------------HPNNIDLDSNNETLG----TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSS---ENEITIPFEKSIIALSLMENALT-LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALL 1843
             FT L+ A  +N  ++V+++LD                       H   + L   N+T G     AL +A      K   +L Q +   + ++K   TPLH A   G  +    L+NR+  +D      +T LH A  +G  N+ + +++ GA              C +    E  + +  ++S   LS  +N L+ L +   G    C    L        D  N+ L  LH+A  C   ++ K LLD  A  +    NG +PL  + C  N           I +  +L+ +GA I   + + +T    A+ + +  I+  L+
Sbjct:  123 GFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVP-VDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLH-IACKKN----------RIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 436          
BLAST of RING domain ligase2 isoform 3 vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 7.646e-19
Identity = 134/593 (22.60%), Postives = 235/593 (39.63%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIEFEKLCKSYDFMSQKLHTG-LTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLT-------KECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALT----LSIKF---HGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            G  P+HIA   G +N+  LLLN    ++        P+H A+  GN  +VKLLL    +ID +T+   GLTP     +      +E+           T+N ++ +    + D +   +L   ++     +    LT L  AA     K+ K +LD            K+ +     L+  T       K  I    ++ +H A  +    + +          + + +AA  GH   +  +M       +  VR   A+  A      E+   + +     E++ K + T LH +      D+V+ +L        ++   +  T L LA    H      L  +  + +   K   TPLH A   G  +    L+ +S + D  G  GLT LH A     + V   +++ GA+     +  +      + +N++ I    S++      NA+T     S+      G + +  L  L S  +N    N + L  LH+A +  +  + + L++ GA VD     G +PL  + C+  +          I+I N L+ + A +N K+ N  T    A++  +  I+  LL NN
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLD------------KKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGL----------TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ--GASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDI--ATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSL--LLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLH-VGCHYGN----------IKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNN 769          

HSP 2 Score: 58.9214 bits (141), Expect = 2.393e-7
Identity = 23/73 (31.51%), Postives = 44/73 (60.27%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWF 373
            L +  G  P+H+A ++  +N+  +L+N+  +++ +   GY P+H     GNI+IV  LLQH  +++ +TK  +
Sbjct:  675 LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY 747          
BLAST of RING domain ligase2 isoform 3 vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 93.5893 bits (231), Expect = 7.970e-18
Identity = 136/594 (22.90%), Postives = 238/594 (40.07%), Query Frame = 2
Query:  164 DKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIEFEKLCKSYDF-MSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDH---PNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLME-----NALT----LSIKFHGKL-FLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            + G  P+HIA   G +N+  LLLN    ++        P+H A+  GN  +VKLLL    +ID +T+   GLTP     +      +E+           T+N ++ +    + D +   +L   ++  +    +  LT L  AA     K+ K +LD     K+ N   K +           K  I    ++ +H A  +    + +          + + +AA  GH   +  +M       +  VR   A+  A      E+   + +     E++ K + T LH +      D+V+ +L     PN     +   +  T L L+    H      L  +  + +   K   TPLH A   G  +    L+ +S + D  G  GLT LH A     + V   +++ GA+     +  +      + +N++        IA SL+E     NA+T     S+    +   +  +  L S  +N    N + L  LH+A +  +  + + L++ GA VD     G +PL  + C+  +          I+I N L+ + A +N K+ N  T    A++  +  I+  LL NN
Sbjct:  241 ESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLD-----KKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGL----------TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPN-----AATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMD-------IATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPL-HVGCHYGN----------IKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNN 794          

HSP 2 Score: 61.2326 bits (147), Expect = 5.643e-8
Identity = 33/109 (30.28%), Postives = 55/109 (50.46%), Query Frame = 2
Query:  119 LRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTEN 445
            L R   +   NK     G  P+H+A ++  +N+  +L+N+  +++ +   GY P+H     GNI+IV  LLQH  +++ +TK   G TP   A +   T  I +    N
Sbjct:  692 LSRNANVNLSNK----SGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN--GYTPLHQAAQQGHTHIINVLLQNN 794          
BLAST of RING domain ligase2 isoform 3 vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 88.5817 bits (218), Expect = 2.352e-16
Identity = 135/600 (22.50%), Postives = 240/600 (40.00%), Query Frame = 2
Query:  149 NKLIDDKGHF-PIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIEFEKLCKSYDF-MSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDH---PNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLME-----NALT----LSIKF---HGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            N  ++ K  F P+HIA   G +N+  LLLN    ++        P+H A+  GN  +VKLLL    +ID +T+   GLTP     +      +E+           T+N ++ +    + D +   +L   ++  +    +  LT L  AA     K+ K +LD     K+ N   K +           K  I    ++ +H A  +    + +          + + +AA  GH   +  +M       +  VR   A+  A      E+   + +     E++ K + T LH +      D+V+ +L     PN     +   +  T L L+    H      L  +  + +   K   TPLH A   G  +    L+ +S + D  G  GLT LH A     + V   +++ GA+     +  +      + +N++        IA +L+E     NA+T     S+      G + +  L    +   N  + +  + LH+A +  +  + + L++ GA VD     G +PL  + C+  +          I+I N L+ + A +N K+ N  T    A++  +  I+  LL NN
Sbjct:  227 NADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD--GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLD-----KKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGL----------TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPN-----AATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMD-------IATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPL-HVGCHYGN----------IKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNN 786          

HSP 2 Score: 56.225 bits (134), Expect = 1.776e-6
Identity = 76/325 (23.38%), Postives = 130/325 (40.00%), Query Frame = 2
Query:  968 FTILHSAICDNDTDMVKYILD-----------------------HPNNIDLDSNNETLGT----ALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTC---QSSENEITIPFEKSIIALSLMENALT-LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALL 1843
            FT L+ A  +N  ++VK++LD                       H   + L   N+T G     AL +A      K   +L Q +   + ++K   TPLH A   G  +    L+NR+  +D      +T LH A  +G  N+ + +++ GA              C      E  + +  +++   LS  +N L+ L +   G    C +  L        D  N+ L  LH+A  C   ++ K LLD  A  +    NG +PL  + C  N           I++  +L+ +GA I   + + +T    A+ + +  I+  L+
Sbjct:  141 FTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNC-VQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPL-HIACKKNR----------IKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLM 453          
BLAST of RING domain ligase2 isoform 3 vs. UniProt/SwissProt
Match: sp|Q8C8R3|ANK2_MOUSE (Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 7.599e-16
Identity = 134/587 (22.83%), Postives = 229/587 (39.01%), Query Frame = 2
Query:  164 DKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAIK---KNDPIEFEKLCKSYDFMSQKLHTG-LTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALT---------LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN 1849
            + G  P+HIA   G +N+  LLLN    ++     G  P+H A+  GN  +VKLLL    +ID +T+   GLTP   A +      +EL           T+N ++ +    + D +E  K    Y      +    LT L  AA     ++ K +LD     K  N   + +    +  + L   C   R  + +    +   I A   +G   I       +AA  GH   +  +++         +R   A+  A      E+   +     L ++R +   T LH A     T++V+ +L H  + D  + N    T L ++          VL +   A +   K   TPLH A   G  D    L+ R    D  G  GLT LH A     + V   ++  GA+     +  +      + +N++ I    +++      N +T          S + H  +    LDK  +   + + G  +  LH+A +  +  +   L   GA  D     G +PL  + C+  +          +++ N L+  GA++N K+ N  T    A++  +  I+  LL +
Sbjct:  231 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD--GLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLD-----KRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPI------HVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIA--STLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTS--LHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLI-VACHYGN----------VKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQH 783          

HSP 2 Score: 60.077 bits (144), Expect = 1.427e-7
Identity = 111/546 (20.33%), Postives = 205/546 (37.55%), Query Frame = 2
Query:  182 IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTI---YNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASK 1810
            +H+A ++G + +V  LL    +++     G   +H A+L G  E+VK+L++    I+ +++   G TP  +A +            EN I  +K         L ++    S     G T L  A     ++ +  +L+   + K     +     ++D     TK   L     H      K  +N    +G       + L IAA  G+      ++ +     +     +  +  A  +    + + + +R    +++ +   T LH A       +V+ +L+    +   + N    + L +A    H +C+K L QY+   +       T LH A   G       L+++  N +     G T LH A  K    V E +V  GA+         +Q   +S    I +                     F G L +  L   N  + +  +    + LHMA +  Q E+ + LL +GA VD       +PL     +  SR+ +       EI  +L+ + A  +  +TN  T    +++
Sbjct:   68 LHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQN--GFTPLYMAAQ------------ENHIDVVKY--------LLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDD-----TKSAALLLQNDHNADVQSKMMVNRTTESG------FTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGL--SPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGAS---------IQAITESGLTPIHVA-------------------AFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPL-----HIASRLGK------TEIVQLLLQHMAHPDAATTNGYTPLHISAR 539          

HSP 3 Score: 57.7658 bits (138), Expect = 6.356e-7
Identity = 31/92 (33.70%), Postives = 50/92 (54.35%), Query Frame = 2
Query:  158 IDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            I + G  PIH+A   G LNIV+LLL    + +  +I G   +H A   G +E+V+ LL++   +D R +     TP  IA +  +T+ ++L 
Sbjct:  427 ITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARARE--EQTPLHIASRLGKTEIVQLL 516          
BLAST of RING domain ligase2 isoform 3 vs. UniProt/SwissProt
Match: sp|Q01484|ANK2_HUMAN (Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4)

HSP 1 Score: 84.7297 bits (208), Expect = 3.458e-15
Identity = 133/585 (22.74%), Postives = 229/585 (39.15%), Query Frame = 2
Query:  164 DKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIEFEK-LCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP-------FEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN 1849
            + G  P+HIA   G +N+  LLLN    ++     G  P+H A+  GN  +VKLLL    +ID +T+   GLTP   A +      +EL           T+N ++ +    + D +E  K L +    +       LT L  AA     ++ K +LD     K  N   + +    +  + L   C   R  + +    +   I A   +G   I   +F+      GH   +  +++         +R   A+  A      E+   +     L ++R +   T LH A     T++V+ +L H  + D  + N    T L ++          VL +   A +   K   TPLH A   G  D    L+ R    D  G  GLT LH A     + V   ++  GA+     +  +      + +N++ I         E +I+    +      S + H  +    LDK  +   + + G  +  LH+A +  +  +   L   GA  D     G +PL  + C+  +          +++ N L+  GA++N K+ N  T    A++  +  I+  LL +
Sbjct:  231 ESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD--GLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLD-----KRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFM------GHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY--TPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTS--LHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLI-VACHYGN----------VKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQH 783          

HSP 2 Score: 61.2326 bits (147), Expect = 6.300e-8
Identity = 84/341 (24.63%), Postives = 130/341 (38.12%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSN---NETLGTALALAHSLHHRKCIKV---LQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN--NPIFKNFSSKD-FQMAFDNHWFQYAECLLK 1936
            +++ KV    LH A   +DT     +L + +N D+ S    N T  +     H   H   + V   L     A +   +   TPLH A   G  +    L++R   ID     GLT LHCA   G + V E ++  GA  +   +  L+ L    Q    E      K ++      + +T             LD L +             LH+A  C    + K LLD  A  +    NG +PL  + C  N           I++  +L+ YGA I   + + +T    A+ + +  I+L LL N  +P   N   +    MA      +   CLL+
Sbjct:  186 DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECV----KHLLQHKAPVDDVT-------------LDYLTA-------------LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPL-HIACKKNR----------IKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLR 485          

HSP 3 Score: 57.3806 bits (137), Expect = 7.790e-7
Identity = 31/92 (33.70%), Postives = 50/92 (54.35%), Query Frame = 2
Query:  158 IDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            I + G  PIH+A   G LNIV+LLL    + +  +I G   +H A   G +E+V+ LL++   +D R +     TP  IA +  +T+ ++L 
Sbjct:  427 ITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARARE--EQTPLHIASRLGKTEIVQLL 516          
BLAST of RING domain ligase2 isoform 3 vs. TrEMBL
Match: A0A3L8DCQ5 (Uncharacterized protein OS=Ooceraea biroi OX=2015173 GN=DMN91_008646 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 5.747e-19
Identity = 148/675 (21.93%), Postives = 275/675 (40.74%), Query Frame = 2
Query:  179 PIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIEL-------------FHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRP--VENKEIN--DLMKEITEENDKLSNL----------TKECILYRSIIHQHAAGFKKFI-----NAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKV----NFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYE----------------LAT------------------NTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSI--KFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKD---FQMAFDNHWFQYAECLLKLLSDSFLESNITNE 1978
            P+H+A   G  +I+ LL+     +  +DI G  PIH A  NGNI+++ LL+++K  ++ RT     +TP  +A   +R D I               +    L +A+ +      E L K    +  +     T+L  A ++   +I+K ++     +  K  N   L+  I   N +++ +               L+ +++    AG+K  +     NAA +N    +   + L +AA +GH+  ++ ++K      +I +  +  +     +E  +EI E +    + + V      T+LH+A  +  +++V+ +L+   NI++  N       LA+AH   H + +K L QY+                +A+                  N +N     P+H A   G  D   + +++ +NI+  G +  T LH A +KG   V E ++  GA+          Q     S   +   F    +   L++N    ++  K   K  +   DK   T   + +    ++ H  V  ++ E     +  GA V+  N+NG +PL       ++R           I N+L+   A+ N       T    A+K  + +++ ALL+N  ++   +  D        D    +    + +LLSDSF   NI N+
Sbjct:  394 PLHVAALNGNYSIIDLLIKNKAEVNAQDIHGNTPIHEAATNGNIDVIDLLIKNKIDVNVRTHN--DVTPLHLAALKNRIDAIVFLIKSGAAVNARANYGVTPLHSAVLEGHKNVVELLIKHTAEVDARAIADGTLLHMAVEAGHTEIVKILVANGANINTKHTNRTPLLSAIKNNNKEIAEILIANGADVDEEDSGPLFLAVL----AGYKDIVEMLLKNAARVN-IRGLENATPLHLAATRGHKEIVNALIKSGADIDAITITDV-TSLYVAVQEGHKEIVEILIANGANVNVKSTDGTTLLHTAAGNGHSNVVQVLLNSKVNINIKDNKNRTSLELAVAHG--HLEVVKTLFQYQKIDMNTKGNDNWTILHIASQESNLDMVKYLVDNGSDINAKNASGSKPMHIAAREGHKDTVEFFLSKGLNINDPGAVNQTLLHYAAMKGHLAVVEYLIAQGADVNS-------QDKNGVSPMHLAATFGYKNVIEVLLKNGAIYNVVDKLCRKPLIMSSDKTVITLLASTENLFKAIQHNNVLEVETE-----IKMGAFVNTKNANGGTPLHYAAWKGSNR-----------IVNLLLQNRANSNAVGKKGFTPLHYAAKFSHLKVVKALLANGAVYNAVTDDDKTPLNFTVDKDIIR----IFQLLSDSF--KNINND 1029          

HSP 2 Score: 100.908 bits (250), Expect = 1.248e-17
Identity = 147/584 (25.17%), Postives = 233/584 (39.90%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTD--CIELFHTENLIAAIK--KNDPIEF----------EKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFI-NAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANY-MKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKL---------NSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLS 1846
            G+ P+H A E G L +V  LL    N    +   + PIH A LNG++EIV +L+      D   K   G TP   A + SR     I L H  N+ A  K   N  + +          + L K     S K   G+T L  A  S   +I+  +L   V                DK +N      L+ ++   H    +  I N A +N  + I  ++ L +AA  G+   ID ++K    NK+               E+  +           I  N T +H A  + + D++  ++ +  ++++ ++N+   T L LA   +    I  L +   A N +  Y  TPLH A+  G  +    LI  +  +D       T LH AV  G   + + +V NGAN   K      L    +++  E         IA  L+ N   +  +  G LFL  L            N+   N R   N + LH+A      E+  +L+ SGA +D +     + L+      +            EI  ILI  GA++NVKST+  T+  +A+   +  ++  LL+
Sbjct:  192 GYTPLHEAAEHGHLELVNFLLEYGANSNARNDRDWTPIHGAALNGHLEIVNVLISEGA--DVNAKVLDGCTPLHYAVETSREKIASILLKHGANVNAVDKTYNNTALHYAAKDGHEGIVKTLLKHKANASVKTVGGITPLHLAVHSGHLEIVTILLKHGVN-----------IHAKDKNNN----TPLHYAVNSAHMEVVEHLIKNGAEVNAKNCI-DKTPLHVAALNGNYSIIDLLIK----NKA---------------EVNAQ----------DIHGN-TPIHEAATNGNIDVIDLLIKNKIDVNVRTHNDV--TPLHLAALKNRIDAIVFLIKSGAAVNARANYGVTPLHSAVLEGHKNVVELLIKHTAEVDARAIADGTLLHMAVEAGHTEIVKILVANGANINTKHTNRTPLLSAIKNNNKE---------IAEILIANGADVDEEDSGPLFLAVLAGYKDIVEMLLKNAARVNIRGLENATPLHLAATRGHKEIVNALIKSGADIDAITITDVTSLYVAVQEGHK-----------EIVEILIANGANVNVKSTDGTTLLHTAAGNGHSNVVQVLLN 705          

HSP 3 Score: 88.5817 bits (218), Expect = 5.948e-14
Identity = 136/617 (22.04%), Postives = 253/617 (41.00%), Query Frame = 2
Query:  182 IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKN----DPIEFEKLCKSYDFM-----------SQKLHTGLTILQTAADSNADKIIKCILDRPVENK-EINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVI---NGPHKIATQSF----LEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESR------IKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANY-MKFVE-LNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKF---HGKL-FLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPL-----------FEMFCNSNSRMTEE-KVNRM----------IEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIF 1861
            +H A + G   IV  LL    N   + + G  P+H A  +G++EIV +LL+H   I  + K     TP   A   +  + +E    +N      KN     P+    L  +Y  +           +Q +H    I + A + N D     ++D  ++NK ++N     +   ND              +   H A  K  I+A V    +G    A  ++    L  A  +GH+  ++ ++K T     +  RAI          ++   TE + +  +          N T L SAI +N+ ++ + ++   N  D+D   E     L LA    ++  +++L +     N +   + TPLH A   G  +    LI    +ID I    +T L+ AV +G + + E ++ NGAN  +K  +    L     +  + +      S + +++ +N    S++    HG L  +  L +      N +  +N ++LH+A +    ++ K L+D+G+ ++  N++G+ P+            E F +    + +   VN+           + +   LI  GAD+N +  N ++    A+    + ++  LL N  I+
Sbjct:  296 LHYAAKDGHEGIVKTLLKHKANASVKTVGGITPLHLAVHSGHLEIVTILLKHGVNIHAKDKN--NNTPLHYAVNSAHMEVVEHL-IKNGAEVNAKNCIDKTPLHVAALNGNYSIIDLLIKNKAEVNAQDIHGNTPIHEAATNGNID-----VIDLLIKNKIDVN-----VRTHND--------------VTPLHLAALKNRIDAIVFLIKSGAAVNARANYGVTPLHSAVLEGHKNVVELLIKHT---AEVDARAIADGTLLHMA-VEAGHTEIVKILVANGANINTKHTNRTPLLSAIKNNNKEIAEILI--ANGADVD---EEDSGPLFLAVLAGYKDIVEMLLKNAARVNIRGLENATPLHLAATRGHKEIVNALIKSGADIDAITITDVTSLYVAVQEGHKEIVEILIANGANVNVKSTDGTTLLHTAAGNGHSNVVQVLLNSKVNINIKDNKNRTSLELAVAHGHLEVVKTLFQYQKIDMNTKGNDNWTILHIASQESNLDMVKYLVDNGSDINAKNASGSKPMHIAAREGHKDTVEFFLSKGLNINDPGAVNQTLLHYAAMKGHLAVVEYLIAQGADVNSQDKNGVSPMHLAATFGYKNVIEVLLKNGAIY 876          
BLAST of RING domain ligase2 isoform 3 vs. TrEMBL
Match: W5MI54 (Ankyrin 3a OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 7.623e-19
Identity = 140/598 (23.41%), Postives = 242/598 (40.47%), Query Frame = 2
Query:  143 FVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIEFEKLCKSYDFMSQKLHTG-LTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLME-NALTLSIKFHG--KLFLCFLDK-------LNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
             VN+  +  G  P+HIA   G +N+  LLLN    ++        P+H A+  GN  +VKLLL+   RID +TK   GLTP     +      +E+           T+N ++ +    + D +   +L   +D     +    LT L  AA     K+ K +LD     K+ N   K +           K  I    ++ +H A  +    + +          + + +AA  GHE  +  +        +  VR   A+  A      E+ + + +     E++ K + T LH A      D+V+ +L H      D++  +  T L LA    H     VL +   + +T  K   TPLH A   G  +    L+ +    D  G  GLT LH A     + V   +++ GA+     +  +      + +N++        IA +L+E  A T +I   G   + L   +        L +  +N   GN + L  LH+A +  +  + + L++ GA VD     G +PL  + C+  +          +++ N L+ + A +N K+ N  T    A++  +  I+  LL + 
Sbjct:  224 MVNRTTE-SGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNGNMVKLLLERGARIDAKTKD--GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVLLD-----KKANPNAKALNGFTPLHIASKKNRIKVMELLLKHGASIQAVTESGL----------TPIHVAAFMGHENIVTQLTHHGASPNTTNVRGETALHMAARAGQAEVVKYLVQNGAQVEAKAKDDQTPLHIASRLGKADIVQQLLQH--GASPDASTTSGYTPLHLAAREGHEDVASVLLEQGASLSTTTKKGFTPLHVAAKYGKIEVANLLLQKKATPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMD-------IATTLLEYGADTNAITRQGISPVHLAAQEGNVDVVSLLLARNANVNLGNKSGLTPLHLAAQEDRVNVAEVLVNQGATVDPQTKMGYTPLH-VACHYGN----------VKMVNFLLQHQAKVNAKTKNGYTPLHQAAQQGHTHIINILLQHG 783          
BLAST of RING domain ligase2 isoform 3 vs. TrEMBL
Match: A0A1B6CUN0 (Uncharacterized protein (Fragment) OS=Clastoptera arizonana OX=38151 GN=g.13255 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.296e-18
Identity = 152/603 (25.21%), Postives = 255/603 (42.29%), Query Frame = 2
Query:  161 DDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENL--IAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCI-LDRPVEN---KEINDLMKEITEENDKLSNLTKECILYRSIIHQHAA--GFKKFINAAVINGPHK----IATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR------AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDH-------------------------------PNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSEN-----EITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSAS 1807
            D+ G  P+HIA + G  + V +LLN N N   +D  G+ P+HYA    +I++ K++L+ +  +D   + + G T   IA +    + +  F  EN   + A ++N  I           ++  L     ++   AD N+  I  C  L   VEN   K  N L+K         +N+    I+Y +    +AA  G +K + A +IN  +     +A  + L  A + GH   +  +++  +    I  +       +  A     KEI E + ++      + K NFT L+ A+     D+++ ++ +                                N  D+ + N    T L LA    H+  I  L + +   NT+N +  TPLH A+  G  D   +LI     ++  G    T LH AV  G + + + +V NGA Y+     NF    C    N     E+ I    S+ A S   +ALTL++    +  +  L K N T  N +     +LLH AV+    E+  +L+  GA V+ + ++G +PL+       +R   E      EI +ILI  GA +NV   +   + ++A 
Sbjct:  950 DNSGKTPLHIAAKNGHKDAVEILLNNNANTNTKDKRGFSPLHYAITYNHIDVAKIMLEREANVDI-NESFGGFTSLHIAAENGYLELVN-FLLENGANVNAKQENVGIPLHTAA-----LNGHLEVVNALILKGADVNSRVIDGCTPLHYAVENGYEKIANILIKH-------GANVNVVDIVYNNTPLHYAAQDGHEKIVEALLINKANASVATVAGVTPLHCAVKSGHLKIVASLLEHGV---DIHAKDKNNASPLHFAVKCGHKEIVELLIKKGAKINDKDKHNFTPLYCAVVGGHKDIIELLIKNKADVKVKDIKGGTLLHAAAMNGKTDVIALLIKNKADVFARNNDGLTPLHLAAFGGHKDAIDFLIKSKAKVNTRNNHGVTPLHGAVIGGQKDIVTFLIQNKAKVNVEGHADSTPLHLAVEGGHKEIVKILVANGA-YVNVKINNFTPLICAVRHNHKEIVEVLIENGASVNAESW--DALTLAVLSSNRDIVEILLK-NITNINMKGPKGLTLLHSAVERGNKEIVNTLIAMGANVNAMTTDGTTPLYVA-----AREGHE------EIADILIANGAMVNVVKADETPLHRAAG 1520          

HSP 2 Score: 73.1738 bits (178), Expect = 3.796e-9
Identity = 124/593 (20.91%), Postives = 230/593 (38.79%), Query Frame = 2
Query:  179 PIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKI-----ATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGA--NYMKFVELNFLQFTCQSSENEITIPFE---KSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLF----------------------EMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIF 1861
            P+H A + G   IV LL+ +   I  +D   + P++ A + G+ +I++LL+++K   D + K   G T    A    +TD         +IA + KN    F    ++ D        GLT L  AA       I  +         I    K  T  N  ++ L           H    G +K I   +I    K+     A  + L +A E GH+  +  ++    Y                       +  ++N        NFT L  A+  N  ++V+ ++++  +++ +S       AL LA    +R  +++L +     N +     T LH A+  G  +    LI    N++ +   G T L+ A  +G E + + ++ NGA  N +K  E    +       N + +      K  +   +    L L+  +     +  L +      NA+  +  ++LH+A +    E+ K L+D G  ++  N++G+ P+                       E+  ++ + +    +   +E+   +I  GAD+N K  N +T    A+    + I+  LL +  I+
Sbjct: 1189 PLHFAVKCGHKEIVELLIKKGAKINDKDKHNFTPLYCAVVGGHKDIIELLIKNKA--DVKVKDIKGGTLLHAAAMNGKTD---------VIALLIKNKADVF---ARNND--------GLTPLHLAAFGGHKDAIDFL---------IKSKAKVNTRNNHGVTPL-----------HGAVIGGQKDIVTFLIQNKAKVNVEGHADSTPLHLAVEGGHKEIVKILVANGAY-----------------------VNVKIN--------NFTPLICAVRHNHKEIVEVLIENGASVNAES-----WDALTLAVLSSNRDIVEILLKNITNINMKGPKGLTLLHSAVERGNKEIVNTLIAMGANVNAMTTDGTTPLYVAAREGHEEIADILIANGAMVNVVKADETPLHRAAGHGHINVVEVLLRNGAKVHVKDYMNRTPLELAASYGHLHVVKMLLQYKKVDLNAKGNDGWTILHIASQDSNLEMVKFLVDEGVNINAKNTSGSKPIHIAAREGLKDTVQFFLSKGMSVNELGADNQTLLHYAAMKNGLEVIKYVIAQGADVNAKDNNGLTPMHIAALYGYKDIIKVLLKHGAIY 1703          

HSP 3 Score: 65.4698 bits (158), Expect = 7.689e-7
Identity = 120/574 (20.91%), Postives = 218/574 (37.98%), Query Frame = 2
Query:  191 ACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTE----------------NLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITE-----------------ENDKLSNLTKECILYRSIIHQHAA---GFKKFINAAVINGP----HKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKV----NFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTN 1780
            A EKG L  +   L +  +I   +I     +H+A    ++E+++ ++ HK  ++   K   G +P  IA    R + +E   +E                ++ A     D +E      +      K   G + L  A   N   + K +L+R   N +IN+     T                  EN    N  +E +     I  H A   G  + +NA ++ G       I   + L  A E G+E   + ++K       + +           ++  E+I E + + ++   V      T LH A+      +V  +L+H   +D+ + ++   + L  A    H++ +++L +     N ++K++ TPL+ A+  G  D    LI    ++      G T LH A + G  +V   ++ N A+               +  N+   P    + A    ++A+   IK   K+             N R+ +  + LH AV   Q ++   L+ + AKV+V     ++PL       +            EI  IL+  GA +NVK  N
Sbjct:  860 ALEKGNLEDLKSYLRKGADINARNINSSTTLHFAAHGPSLEVIQFIIDHKLSVNV--KNVNGQSPLHIAAVHGRKNIVEFLISETGVNIDDQDNSGKTPLHIAAKNGHKDAVEILLNNNANTNTKDK--RGFSPLHYAITYNHIDVAKIMLEREA-NVDINESFGGFTSLHIAAENGYLELVNFLLENGANVNAKQENVG----IPLHTAALNGHLEVVNALILKGADVNSRVIDGCTPLHYAVENGYEKIANILIKHGANVNVVDIVYNNTPLHYAAQDGHEKIVEALLINKANASVATVAGVTPLHCAVKSGHLKIVASLLEH--GVDIHAKDKNNASPLHFAVKCGHKEIVELLIKKGAKINDKDKHNFTPLYCAVVGGHKDIIELLIKNKADVKVKDIKGGTLLHAAAMNGKTDVIALLIKNKADVF-------------ARNNDGLTPLH--LAAFGGHKDAIDFLIKSKAKV-------------NTRNNHGVTPLHGAVIGGQKDIVTFLIQNKAKVNVEGHADSTPLHLAVEGGHK-----------EIVKILVANGAYVNVKINN 1383          
BLAST of RING domain ligase2 isoform 3 vs. TrEMBL
Match: Q16FR1 (AAEL014668-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014668 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.345e-18
Identity = 138/574 (24.04%), Postives = 238/574 (41.46%), Query Frame = 2
Query:  125 RTLRLEFVNKLIDDK---------GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEK-LCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFI-NAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDK-LNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASK 1810
            R   LE V  LID++         G  P+H A + G L++V LL++   N++     G  P+HYA+ NGN+E+VKLL+ ++  +D  T  + G TP   A + +  D  +      L  A  +N  +E  K L ++   +    + G T L  ++ +   K++K +    +ENK   D     T +N+  +       L+ +  + H    K  I N A ++  +   + SF  I ++ G  + +  +                             I  R N+ ++     +T LH A  +   ++VK+++D  N  + D+ N    T+  +A      + +K+L       +T N    TPLH A  +G  +    LI+   N+D     G T  H     G   V + +++N AN               +++NE   P   +             S   H ++    +D   N  T N R    ++  H+A K  + E+ K L+D+GA VD  N+ G +PL        SR      N  +E+  +LI  GA+++ K+    T F   S+
Sbjct:  338 RNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVD--TAQYEGWTPLHYASRNANVDTTQNEGCTPLHYA-SRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLL----IENKANVD-----TTQNEGWT------PLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSF-HIVSQNGRLVLVKLL-----------------------------IDNRANV-DTTDNEGWTPLHYASQNGHLEVVKFLID--NGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRAN-------------VDTTDNEGWTPLHYA-------------SRNGHLEVVKLLIDNGANVDTKNTR---GSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYA-----SR------NGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQ 820          

HSP 2 Score: 89.3521 bits (220), Expect = 2.726e-14
Identity = 134/596 (22.48%), Postives = 242/596 (40.60%), Query Frame = 2
Query:  125 RTLRLEFVNKLIDDK---------GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF--HTENL-IAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR-------------PVENKEINDLMK--EITEENDKLSNLTKE---CILYRSIIHQHAAGFKKFI-NAAVINGPHKIATQSFLEIAAEQGH----ELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSAS 1807
            R  +L+ V  LID++         G  P+H A   G L +V LL++   N++     G+ P+HYA+ NG +++VKLL+ ++  +D       G TP   A +    + ++L   +  N+  A  +   P+ +     + D    +   G T L  A+ +   +++K +++              P+     N  +K  ++  EN    + T+      L+ +  + H    K  I N A ++  +   + SF  I ++ G     +L ID        +   W   +  A      E+ + + +    F+++     T  H A  +   ++VK ++D+  N+D  +NNE   T L  A    H + +K+L       +T+N    T  H    +G  +    LI+   N+D     G T LH A   G   V + +++NGAN           F   S    +       ++ L L++N   +                  TT+N       + LH A +    E+ K L+D+GA VD  N+ G++       + N R+         E+  +LI  GA+++     R T+   AS
Sbjct:  305 RNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQN--EGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNE---GCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSF-HIVSQNGRLVLVKLLIDNRANVDTTDNEGWT-PLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDT-TNNEGW-TPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRL------EVVKL-LIDNGANV-----------------DTTNNE----GWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFH--IVSQNGRL---------EVVKLLIDNGANVDTTYNERWTLLHDAS 852          

HSP 3 Score: 70.4774 bits (171), Expect = 1.630e-8
Identity = 32/90 (35.56%), Postives = 55/90 (61.11%), Query Frame = 2
Query:  164 DKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            ++G  P+H A E G L++V LL++   N++     G+ P+HYA+ NGN+E+VKLL+ ++  +D  T  + G TP   A +  + D ++L 
Sbjct:   96 NEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVD--TAQYEGWTPLHYASRNGQLDVVKLL 183          

HSP 4 Score: 69.707 bits (169), Expect = 3.571e-8
Identity = 33/86 (38.37%), Postives = 53/86 (61.63%), Query Frame = 2
Query:  179 PIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRID-CRTKGWFGLTPFDIAKKWSRTDCIELF 433
            P+H A  KG + +V LL++ N NI+ +D  G  P+HYA+ NGN+E+VKLL+ ++  +D  + +GW   TP   A +    D ++L 
Sbjct:    2 PLHTAAGKGNIEMVKLLIDHNANIDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGW---TPLHYASQNGHIDVVKLL 84          

HSP 5 Score: 69.3218 bits (168), Expect = 4.272e-8
Identity = 37/108 (34.26%), Postives = 60/108 (55.56%), Query Frame = 2
Query:  137 LEFVNKLIDDK---------GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            LE V  LID++         G  P+H A + G L++V LL++   N++     G  P+HYA+ NGN+E+VKLL+ ++  +D  T  + G TP   A +  + D ++L 
Sbjct:  210 LELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVD--TAQYEGWTPLHYASRNGQLDVVKLL 315          

HSP 6 Score: 68.9366 bits (167), Expect = 5.517e-8
Identity = 38/112 (33.93%), Postives = 60/112 (53.57%), Query Frame = 2
Query:  125 RTLRLEFVNKLIDDK---------GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            R   LE V  LID++         G  P+H A   G L++V LL++   N++     G  P+HYA+ NGN+E+VKLL+ ++  +D  T  + G TP   A +  + D ++L 
Sbjct:  272 RNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVD--TAQYEGWTPLHYASQNGQLDVVKLL 381          

HSP 7 Score: 68.9366 bits (167), Expect = 5.957e-8
Identity = 38/112 (33.93%), Postives = 60/112 (53.57%), Query Frame = 2
Query:  125 RTLRLEFVNKLIDDK---------GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            R   LE V  LID++         G  P+H A   G L++V LL++   N++     G  P+HYA+ NGN+E+VKLL+ ++  +D  T  + G TP   A +  + D ++L 
Sbjct:  140 RNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVD--TAQYEGWTPLHYASQNGQLDVVKLL 249          

HSP 8 Score: 63.929 bits (154), Expect = 1.962e-6
Identity = 31/91 (34.07%), Postives = 51/91 (56.04%), Query Frame = 2
Query:  161 DDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            DD+G  P+H A   G L +V LL++   N++     G+ P+HYA+ NG+I++VKLL+ ++  +D       G TP   A +    D ++L 
Sbjct:   29 DDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQN--EGCTPLHKAAENGHLDVVKLL 117          
BLAST of RING domain ligase2 isoform 3 vs. TrEMBL
Match: J9LAT2 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 2.208e-18
Identity = 138/571 (24.17%), Postives = 232/571 (40.63%), Query Frame = 2
Query:  182 IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVI----NGPHKIATQSFL---EIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXX---XXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLG-TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLAL 1840
            +HIA +K       LLL  + N +     G+ P+H A+  GN  I KLLL     ++   K    +TP  +A KW +++ + L                    L +S   +  K   GLT L  AA S  D++I  +L R                 N  +S+ TK  +   + +H  A G    + AA +    N P    T  +L    +AA  GH      +++K     +  +           K   ++ E + +     E+  +   T LH A      ++V ++L H  N DL +     G T L LA   +    I++L +     + + +  QTPLH A   G  D    L+     +D       T LH A  +G E V   ++ N A+     +  F      S    I +     +K     +  +N +T L +  H     + L  LDK  S  + A++G  ++ LH+A K  Q ++  +LLD GAK +  +  G +PL          ++ ++ N  +E+T +L+ + AD N KS N +T     ++ +  ++ + L
Sbjct:  180 LHIAAKKDDCKAADLLLQNDHNPDVTSKSGFTPLHIASHYGNDGIAKLLLAKGADVNYSAK--HNITPLHVAAKWGKSNMVSL--------------------LLESGANIEAKTRDGLTALHCAARSGHDQVIDMLLQR-----------------NAPISSKTKNGL---AALHMAAQG--DHVEAAKVLLSNNAPVDDVTVDYLTGLHVAAHCGHIRVAKLLLEKHADPDARALNGFTPLHIACKKNRIKVVELLLKYNASLEATTESGLTPLHVASFMGCMNIVIFLLQHEANPDLPT---VRGETPLHLAARANQTDIIRILLRNGAQVDARAREKQTPLHIASRLGNVDIVMLLLAHGAAVDSTTKDLYTALHIASKEGQEEVASVLLENEASVTATTKKGFTPLHLASKYGNIKVTKLLLQKQAPVDAQGKNGVTPLHVASHYDNQAVALMLLDKQASPHATAKNG--HTPLHIAAKKNQMDIAVTLLDYGAKANAESKAGFTPL---------HLSSQEGN--VEMTTLLLNHNADPNYKSKNGLTPMHLTAQEDKHKVAVVL 690          

HSP 2 Score: 62.003 bits (149), Expect = 9.971e-6
Identity = 33/88 (37.50%), Postives = 48/88 (54.55%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            G  P+HIAC+K  + +V LLL  N ++E     G  P+H A+  G + IV  LLQH+   D  T    G TP  +A + ++TD I + 
Sbjct:  374 GFTPLHIACKKNRIKVVELLLKYNASLEATTESGLTPLHVASFMGCMNIVIFLLQHEANPDLPT--VRGETPLHLAARANQTDIIRIL 459          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 96.2857 bits (238), Expect = 1.122e-19
Identity = 140/601 (23.29%), Postives = 232/601 (38.60%), Query Frame = 2
Query:  137 LEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENL-IAAIKKN--DPIEFEKLCKSYDFMSQKLHTG----------LTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKEC----ILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLS--IKFH-----GKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            L+ V   I   G  P+HIA     LN+  LLLN   N+      G  P+H A+  GN+ +V+LLL     ID +TK    LTP   A +      IE+   +   I A  KN   PI         D + Q L             LT L  AA     ++ K +LD+           K  T   +  + L   C    +    ++ +H+A  +    + +          + L +A+  GH   +  +++K     +  V+    +  A      E+ E + +     +++ K + T LH A      ++VK +L+H  N   +S      T L +A    H + +++L           K   TPLH A   G  D    L+ R  N +  G  GLT LH AV     +V   +V+ G +        +      S +N++ +    S++      NA +L      H     G+  +  L  L S  +N   GN + L  LH+  +     +   L+  GA V      G +PL  + C+  +          I++   L+   A++N K+    T    A++  +  I+  LL + 
Sbjct:  167 LKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDE--LTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGA---------KPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGL----------TPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANP--NSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEV--ASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSL--LISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPL-HVACHYGN----------IKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHG 729          

HSP 2 Score: 71.2478 bits (173), Expect = 5.030e-12
Identity = 115/537 (21.42%), Postives = 197/537 (36.69%), Query Frame = 2
Query:  179 PIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAK-------------KWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAA------------------GFKKFINAAVINGPHK-------IATQSFLEIAAEQGH----ELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPL 1663
            P+H A   G + I+ +LL++   I+ +   G  PIH A    +++ V+ LLQ+   ID  T     LTP  +A              K ++ +   L     L  A KKN     + L K    +     +GLT L  A+      I+K +L +       N  +    E    +++    C +   ++   A                   G K+ +   +    HK        A  + L IAA +GH     + +D   ++T   K  +   +  A      ++ E + ER     +  K   T LH A+  N+ D+V  ++    +    + N    T L +A   +  +    L QY  + N ++    TPLH A   G  D    LI++  N++     GLT LH    +G   + + +V  GA+      + +           I +                   +KF        L +  +     R G   + LH A +    ++   LL  GA+ + + +NG S L
Sbjct:  247 PLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDH--LTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKV----ETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLL---EHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFT-PLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGY--TPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKM-------------------VKF-------LLQQQANVNGKTRAGY--TPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSAL 743          

HSP 3 Score: 67.781 bits (164), Expect = 5.937e-11
Identity = 130/615 (21.14%), Postives = 230/615 (37.40%), Query Frame = 2
Query:  167 KGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTK----------------------------------GWFGLTPFDIAKKWSRTDCIEL---------FHTENLIA----AIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENE---ITIPFEKSIIALSLMENALT---LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALL 1843
            KG+  +HIA   G   +V  L+N   N+  +   G+ P++ A    ++E+VK LL++       T+                                     G TP  IA  +   +  +L         F  +N I     A ++ + I    L      +  K    LT L  AA +   +II+ +LD+  P++ K  N L    +  + D +     +C+  R ++  +A      I+   ++        + L +AA  GH       M K + +K                   +  T  +N         FT LH A   N   ++  +L H  +  L++  E+  T L +A  + H   +K+L Q   + N  N   +TPLH A  +G  +   +L+  +  +D       T LHCA   G + + + ++ + AN               + E     + I  + +     + +   T   ++ K+ GK+ +  L        NA   N  + LH+AV     ++   L+  G        NG +PL              K N+ +E+ + L+ YGA  N +S   +T    A++ E    M++LL
Sbjct:   75 KGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHM-----DCV--RQLLQYNAE-----IDDITLD------HLTPLHVAAHCGHHR-----MAKVLLDKG-----------------AKPNTRALN--------GFTPLHIACKKNHLRVMDLLLKH--SASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKY-GKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLH----------IASKQNQ-VEVASSLLQYGASANAESLQGVTPLHLAAQ-EGRADMVSLL 626          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 93.9745 bits (232), Expect = 6.048e-19
Identity = 140/592 (23.65%), Postives = 228/592 (38.51%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIE-LFHTENLIAAIKKN--DPIEFEKLCKSYDFMSQKLH----------TGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLME-NALTLSIKFHGKLFLCFLDKLNS----TTSNARDGNNN-------SLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMT------EEKVNRMIEIT----------NILIGYGADINVKSTNRITIFQSASKL 1813
            G  P+HIA   G +N+  LLLN    ++ +      P+H A+  GN  +VKLLL+   RID +TK   GLTP     +      +E L      I +  KN   P+         + +   LH            LT L  AA     K+ K I+D     K+ N   K +           K  I    ++ +H A  +    + +          + + +AA  GHE  +  +M       +  VR   A+  A      E+ + + +     +++ K + T LH +      ++++ +L H      DS   +  T L LA    H+    +L     +     K   TPLH A   G  +    L+ +    D  G  GLT LH A     + V   +++ GA+     +  +      + +N++        IA +L+E  A T +I   G   L    +  +    T   ARD   N       + LH+A +  Q  + + L++ GA VD     G +PL       N +M       + KVN   ++T          N+L+ +GA  N  + N  T    A +L
Sbjct:  182 GFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKD--GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVD-----KKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGL----------TPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQH--GACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQME-------IATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKVTAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRL 747          

HSP 2 Score: 88.1965 bits (217), Expect = 3.835e-17
Identity = 115/510 (22.55%), Postives = 206/510 (40.39%), Query Frame = 2
Query:  182 IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRA---IXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDH---PNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPL 1663
            +HIA  K       LLL  + N + E   G+ P+H A   GNI +  LLL     +D + +    +TP  +A K   ++ ++L                  E+  +    +  K   GLT L   A S  +++++ +LDR  P+ +K  N L    +  + D L+     C+    ++  H        N  +          + L +AA  GH      I+ K     +  +     +  A  K   ++ E + +     ++  +   T +H A      ++V  +++H   PN  ++        TAL +A      + +K L Q     + ++K  QTPLH +   G  +    L+      D     G T LH A  +G ++V   +++ GA+     +  F      +   +I +     +K     +  ++ LT L +  H    K+ L  LD+  S  + A++G   + LH+A K  Q E+  +LL+ GA  + +   G SPL
Sbjct:  153 LHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARN--DITPLHVASKRGNSNMVKLL----------------LERGAR----IDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLN-----CV---QLLLHHEVPVDDVTNDYL----------TALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGE-----TALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNG--YTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPL 615          

HSP 3 Score: 58.9214 bits (141), Expect = 3.074e-8
Identity = 77/325 (23.69%), Postives = 133/325 (40.92%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSE-NEITIPFEKSIIALSLMENALT-LSIKF---HGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPL-FEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQMAF 1897
            +++ KV    LH A   +DT     +L + +N D++S +    T L +A    +     +L     A + + +   TPLH A   G  +    L+ R   ID     GLT LHC    G E V E +++ GA  +   +  L+ L    Q    N + +     +    +  + LT L +     H K+    +DK      NA+  N  + LH+A K  + ++ + LL  GA +  V  +G +P+    F    + +T+            L+ +GA  N  +    T    A++     ++  L+ N   + +  SKD Q   
Sbjct:  143 DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGF--TPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDK--KANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQ------------LMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNG-AYVDAKSKDDQTPL 450          

HSP 4 Score: 54.6842 bits (130), Expect = 5.550e-7
Identity = 79/347 (22.77%), Postives = 142/347 (40.92%), Query Frame = 2
Query:  911 IQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILD-----------------------HPNNIDLDSNNETLG----TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSS---ENEITIPFEKSIIALSLMENALT-LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            ++E +T   N+  ++ +  FT L+ A  +N  D+V+Y+LD                       H   + L   N+T G     AL +A      K   +L Q +   + ++K   TPLH A   G  +    L+NR   +D      +T LH A  +G  N+ + ++  GA      +       C +    E  + +  ++    LS  +N L+ L +   G    C    L+       D  N+ L  LH+A  C   ++ K ++D  A  +    NG +PL  + C  N           I++  +L+ +GA I   + + +T    A+ + +E I+  L+++ 
Sbjct:   70 VKELVTNGANV-NAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVP-VDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPL-HIACKKNR----------IKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHG 403          

HSP 5 Score: 52.373 bits (124), Expect = 2.792e-6
Identity = 21/70 (30.00%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTK 364
            L +  G  P+H+A ++  +N+  +L+N    ++ E   GY P+H A   GN+++V  LL+++ +++ +TK
Sbjct:  639 LCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTK 708          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 88.9669 bits (219), Expect = 1.617e-17
Identity = 126/510 (24.71%), Postives = 203/510 (39.80%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNF--LQFTCQSSENEIT-IPFEKSIIALSLMENALT-LSIKFHG---KLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPL 1663
            ++   G  P+HIA     L++  LLLN   N+      G  P+H A   GN+ +V+LLL    +ID RTK    LTP   A +      IE+         + +  PI+             K   GL+ +  AA  +    ++ +L     N EI+D    IT ++    ++   C  +R        G K   NA  +NG       + L IA ++ H   +D ++K   ++ S+                 E +TE             T LH A      ++VK +L        +++N  + T L +A    H +  + L Q     + + K  QTPLH A   G  +    L+    N D     G T LH A  +G  +    +++  A   K  +  F  L   C+  + ++  +  E+     +  +N LT L +  H     +    + K  S  S AR+G   + LH+A K  Q E+  SLL  GA  +  +  G +PL
Sbjct:  176 VLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDE--LTPLHCAARNGHVRVIEIL--------LDQGAPIQ------------AKTKNGLSPIHMAAQGDHMDCVRQLLQY---NAEIDD----ITLDHLTPLHVAAHCGHHRMAKVLLDKGAKA--NARALNG------FTPLHIACKKNHMRSMDLLLK---HSASL-----------------EAVTES----------GLTPLHVAAFMGHLNIVKSLLQ--RGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNG--YTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPL 614          

HSP 2 Score: 60.4622 bits (145), Expect = 1.009e-8
Identity = 26/85 (30.59%), Postives = 46/85 (54.12%), Query Frame = 2
Query:  179 PIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            P+H+  ++G + I  +L+ +  ++      GY  +H A   GNI++VK LLQ +  ++C+T+   G TP   A +   TD + L 
Sbjct:  651 PLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTR--VGYTPLHQAAQQGHTDIVTLL 733          

HSP 3 Score: 56.6102 bits (135), Expect = 1.304e-7
Identity = 28/88 (31.82%), Postives = 46/88 (52.27%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            G+  +H+AC  G + +V  LL +  ++ C+   GY P+H A   G+ +IV LLL+H    +  T    G +P  IAK+      I++ 
Sbjct:  681 GYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTN--GTSPLGIAKRLGYISVIDVL 766          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 86.6557 bits (213), Expect = 9.175e-17
Identity = 133/586 (22.70%), Postives = 230/586 (39.25%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAI---KKNDPIEFEKLCKSYDFMSQKLHTG-LTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLG-TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLS--IKFH-----GKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN 1849
            G  P+HIA   G +N+  LLLN    ++        P+H A   GN  +VKLLL    +ID +TK   GLTP     +      +E+           T+N ++ +    + D +   +L   +D     +    LT L  AA     K+ K I+D     K+ N   K +           K  +    ++ +H A  +    + +          + + +AA  GHE  +  +        +  VR   A+  A      ++   + +     + + K + T LH A      ++V+ +L         S   T G T L LA    H++   +L ++  + +   K   TPLH A   G  +    L+ +    D  G  GLT LH A     + V   ++++GA+     +  +      + +N++ I    +++      NA+T       H     G + L  L  L +  +N   GN N L  LH+A +  +  + + LL+ GA+VD     G +PL       N +M            + L+   A IN K+ +  T    A++  +  I+  LL +
Sbjct:  237 GFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKD--GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVD-----KKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGL----------TPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLL---QKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEI--GTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSL--LLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKM-----------VSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQH 787          

HSP 2 Score: 84.7297 bits (208), Expect = 3.751e-16
Identity = 127/595 (21.34%), Postives = 225/595 (37.82%), Query Frame = 2
Query:  182 IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINID--------------------------QIGFL-------GLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLA 1837
            +HIA  K       LLL  + N + E   G+ P+H A   GNI +  LLL     +D   +    +TP  +A K    + ++L                  ++  K    +  K   GLT L   A S  +++++ +LDR  P+ +K  N L    +  + D L+     C+    ++ QH        N  +          + L +AA  GH                               ++ + I ++     ++    FT LH A   N   +++ +L H     L +  E+  T + +A  + H   +K L  +  + NT N   +T LH A  +G  D   YL+     +D                          Q G         G T LH AV +G +     ++ +GA+     +  F      +   +I       +K     +  +  LT L +  H    ++ L  LD   S  + A++G   + LH+A K  Q E+  +LL+ GA+ + V   G SPL  +     S          +++ ++L+   A++N+ + N +T    A+  + +R+ +A
Sbjct:  208 LHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARN--DITPLHVAAKRGNGNMVKLL----------------LDRGAK----IDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLN-----CV---QLLLQHDVPVDDVTNDYL----------TALHVAAHCGH------------------------------YKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKH--GASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNG--YTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPL-HLAAQEGS----------VDLVSLLLTKNANVNMGNKNGLTPLHLAA--QEDRVGVA 715          

HSP 3 Score: 58.5362 bits (140), Expect = 3.457e-8
Identity = 79/324 (24.38%), Postives = 133/324 (41.05%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSE-NEITIPFEKSIIALSLMENALT-LSIKF---HGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQMAF 1897
            +++ KV    LH A   +DT     +L + +N D++S +    T L +A    +     +L     A +   +   TPLH A   G  +    L++R   ID     GLT LHC    G E V E +++ GA  +   +  L+ L    Q    N + +  +  +    +  + LT L +     H K+    +DK      NA+  N  + LH+A K  + ++ + LL  GA +  V  +G +P+     +  + M  E       I   L  +GA  N  +    T    A++     ++  LL N     +  +KD Q A 
Sbjct:  198 DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGF--TPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDK--KANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPI-----HVAAFMGHEN------IVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKV-DIKAKDDQTAL 505          

HSP 4 Score: 54.6842 bits (130), Expect = 5.883e-7
Identity = 25/80 (31.25%), Postives = 44/80 (55.00%), Query Frame = 2
Query:  158 IDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIA 397
            +  +G  P+H+A ++G +++V LLL +N N+   +  G  P+H A     + + ++LL H   +D  TK   G TP  +A
Sbjct:  662 VTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTK--TGYTPLHVA 739          

HSP 5 Score: 54.6842 bits (130), Expect = 6.086e-7
Identity = 32/98 (32.65%), Postives = 47/98 (47.96%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKW---SRTDCIELFHTENLIA 454
            G+ P+H+AC  G + +V  LL     I  +   GY P+H A   G+  I+ +LLQH+   +  T    G T   IA++    S  D +     ENL A
Sbjct:  732 GYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELT--LNGNTALSIARRLGYISVVDTLRGLTDENLTA 827          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 86.2705 bits (212), Expect = 1.465e-16
Identity = 133/586 (22.70%), Postives = 230/586 (39.25%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF---------HTENLIAAIK---KNDPIEFEKLCKSYDFMSQKLHTG-LTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLG-TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLS--IKFH-----GKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN 1849
            G  P+HIA   G +N+  LLLN    ++        P+H A   GN  +VKLLL    +ID +TK   GLTP     +      +E+           T+N ++ +    + D +   +L   +D     +    LT L  AA     K+ K I+D     K+ N   K +           K  +    ++ +H A  +    + +          + + +AA  GHE  +  +        +  VR   A+  A      ++   + +     + + K + T LH A      ++V+ +L         S   T G T L LA    H++   +L ++  + +   K   TPLH A   G  +    L+ +    D  G  GLT LH A     + V   ++++GA+     +  +      + +N++ I    +++      NA+T       H     G + L  L  L +  +N   GN N L  LH+A +  +  + + LL+ GA+VD     G +PL       N +M            + L+   A IN K+ +  T    A++  +  I+  LL +
Sbjct:  209 GFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKD--GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVD-----KKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGL----------TPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLL---QKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEI--GTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSL--LLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKM-----------VSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQH 759          

HSP 2 Score: 57.7658 bits (138), Expect = 6.372e-8
Identity = 80/330 (24.24%), Postives = 133/330 (40.30%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLG------TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE--LNFLQFTCQSSE-NEITIPFEKSIIALSLMENALT-LSIKF---HGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQMAF 1897
            +++ KV    LH A   +DT     +L + +N D++S   T        T L +A    +     +L     A +   +   TPLH A   G  +    L++R   ID     GLT LHC    G E V E +++ GA  +   +  L+ L    Q    N + +  +  +    +  + LT L +     H K+    +DK      NA+  N  + LH+A K  + ++ + LL  GA +  V  +G +P+     +  + M  E       I   L  +GA  N  +    T    A++     ++  LL N     +  +KD Q A 
Sbjct:  162 DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDK--KANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPI-----HVAAFMGHEN------IVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKV-DIKAKDDQTAL 477          

HSP 3 Score: 54.6842 bits (130), Expect = 6.689e-7
Identity = 25/80 (31.25%), Postives = 44/80 (55.00%), Query Frame = 2
Query:  158 IDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIA 397
            +  +G  P+H+A ++G +++V LLL +N N+   +  G  P+H A     + + ++LL H   +D  TK   G TP  +A
Sbjct:  634 VTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTK--TGYTPLHVA 711          

HSP 4 Score: 54.299 bits (129), Expect = 7.157e-7
Identity = 32/98 (32.65%), Postives = 47/98 (47.96%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKW---SRTDCIELFHTENLIA 454
            G+ P+H+AC  G + +V  LL     I  +   GY P+H A   G+  I+ +LLQH+   +  T    G T   IA++    S  D +     ENL A
Sbjct:  704 GYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELT--LNGNTALSIARRLGYISVVDTLRGLTDENLTA 799          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 3.496e-16
Identity = 133/571 (23.29%), Postives = 228/571 (39.93%), Query Frame = 2
Query:  161 DDKG--HFP-IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGH----ELFID--GIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEI---TIPFEKSIIALSLM--ENALT---LSIKF-HGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASK 1810
            D KG    P +HIA  K   N   LLL    N +     G+ P+H A   GN+ +  LLL     +D   +   G+TP  +A K    + ++L                  ++  K    +  K   GLT L  AA S  +K+I+ +L+R  P+  K  N L    +  + + L+     C+       Q   G +  ++   ++        + L +AA  GH    +L +D  G       N       +  A  K   ++ E + +      +  +   T +H A      ++V+ +L   N    ++ N    T L +A      + +K L Q       + +  QTPLH A   G  +    L+ R  + +     G T L+ A  +G  +V   ++ NGA+     +  F      S    +   T+  EK   A   +  +N LT   ++  + H K+ L  LDK  S  S A++G   + LH+A K  Q E+ K LL+ GA+ +++   G +PL       ++ M             +L+G  A I++ +   +T    A++
Sbjct:  166 DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARN--GITPLHVAAKRGNNNMVKLL----------------LDRGAK----IDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLA-----CV-------QLLLGRQAPVDDVTLD------YLTPLHVAAHCGHYRVAKLLLDRGGEPNARALN---GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ--NGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNG--YTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVA-----------LLLGRHASISLATKGGLTAMHLAAQ 678          

HSP 2 Score: 68.9366 bits (167), Expect = 4.671e-12
Identity = 83/314 (26.43%), Postives = 128/314 (40.76%), Query Frame = 2
Query:  965 NFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGA--NYMKFVELNFLQFTCQSSE---NEITIPFEKSIIALSLMENALTL--SIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDF 1885
              T LH A    + +MVK +LD    ID  + +    T L  A    H K I++L + +     + K   +PLH A           L+ R   +D +    LT LH A   G   V + +++ G   N         L   C+ +     E+ +    SI   +  E+ LT      F G L +  L   N  +SNA +    + LHMA +  Q E+ K+LL SGA+V V      +PL     +  SR+ +       EI  +L+  G+D N  + +  T    AS+  +  +   LL N       + K F
Sbjct:  238 GITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGL--TPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASI--HTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPL-----HIASRLGKA------EIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGF 536          

HSP 3 Score: 62.7734 bits (151), Expect = 3.183e-10
Identity = 132/604 (21.85%), Postives = 222/604 (36.75%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIE-LFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTG------------LTILQTAADSNADKIIKCILDRPVEN--KEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRA---IXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQ--IGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIF----KNFSSKDFQMAFDNH 1906
            G  P+HIA   G +N+  LLLN    ++     G  P+H A   GN  +VKLLL    +ID +T+   GLTP   A +      IE L   +  I A  KN         +       +L  G            LT L  AA     ++ K +LDR  E   + +N      I  + +++  +  E +L      +H A     I+    +G   I   SF+      GH   +  +++    + +  VR    +  A      E+ + + +       + + + T LH A      ++V+ +L      D ++   +  T L  A    H     +L +     +   K   TPLH A   G  +    L+ +  + D    G  GLT LH A     + V   +++ GA+     +  +      + +N++ +                       GK+ L    + N  T         + LH+A +    ++   LL   A + +    G   L  M   +     E+KVN    +  IL  + AD+N  +    T    AS   N +++  LL N  +     +N  +   Q A   H
Sbjct:  205 GFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRD--GLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVM--ELLL------KHGAS----IHTTTESGLTPIHVASFM------GHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQ--RGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEV-----------------------GKVLLELGAETNMLTQQGV-----APLHLAAQEGHADMVALLLGRHASISLATKGG---LTAMHLAAQ----EDKVN----VAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGH 747          

HSP 4 Score: 59.6918 bits (143), Expect = 2.569e-9
Identity = 74/302 (24.50%), Postives = 121/302 (40.07%), Query Frame = 2
Query:  947 ESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNN 1852
            +++ KV    LH A   +DT+    +L H +N D+ S +    T L +A    +     +L     A +   +   TPLH A   G ++    L++R   ID     GLT LHCA   G E V E ++   A  +   + N L     +++ E       + + L L   A    +          LD L               LH+A  C    + K LLD G + +    NG +PL  + C  N           I++  +L+ +GA I+  + + +T    AS + +  ++  LL N 
Sbjct:  166 DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGF--TPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTK-NGLSPLHMATQGE-----HLACVQLLLGRQAPVDDVT---------LDYLTP-------------LHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPL-HIACKKNR----------IKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNG 426          

HSP 5 Score: 48.521 bits (114), Expect = 7.489e-6
Identity = 32/164 (19.51%), Postives = 63/164 (38.41%), Query Frame = 2
Query:  131 LRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEI 622
            L L     ++  +G  P+H+A ++G  ++V LLL  + +I      G   +H A     + + ++L +HK  ++  TK  +  TP  +A  +     +                      L ++   ++ K   G T L  AA      ++  +L       E+
Sbjct:  623 LELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCY--TPLHVASHYGNIKMVNF--------------------LLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNEL 764          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 4.060e-15
Identity = 133/577 (23.05%), Postives = 227/577 (39.34%), Query Frame = 2
Query:  161 DDKG--HFP-IHIACEKGFLNIVILLLNENCNIECEDIW--------GYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGH----ELFID--GIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEI---TIPFEKSIIALSLMENALT---LSIKF-HGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASK 1810
            D KG    P +HIA  K   N   LLL    N +             G+ P+H A   GN+ +  LLL     +D   +   G+TP  +A K    + ++L                  ++  K    +  K   GLT L  AA S  +K+I+ +L+R  P+  K  N L    +  + + L+     C+       Q   G +  ++   ++        + L +AA  GH    +L +D  G       N       +  A  K   ++ E + +      +  +   T +H A      ++V+ +L   N    ++ N    T L +A      + +K L Q       + +  QTPLH A   G  +    L+ R  + +     G T L+ A  +G  +V   ++ NGA+     +  F      S    +   T+  EK   A    +N LT   ++  + H K+ L  LDK  S  S A++G   + LH+A K  Q E+ K LL+ GA+ +++   G +PL       ++ M             +L+G  A I++ +   +T    A++
Sbjct:  165 DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARN--GITPLHVAAKRGNNNMVKLL----------------LDRGAK----IDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLA-----CV-------QLLLGRQAPVDDVTLD------YLTPLHVAAHCGHYRVAKLLLDRGGEPNARALN---GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ--NGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGY--TPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVA-----------LLLGRHASISLATKGGLTAMHLAAQ 683          

HSP 2 Score: 68.5514 bits (166), Expect = 5.719e-12
Identity = 83/314 (26.43%), Postives = 128/314 (40.76%), Query Frame = 2
Query:  965 NFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGA--NYMKFVELNFLQFTCQSSE---NEITIPFEKSIIALSLMENALTL--SIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDF 1885
              T LH A    + +MVK +LD    ID  + +    T L  A    H K I++L + +     + K   +PLH A           L+ R   +D +    LT LH A   G   V + +++ G   N         L   C+ +     E+ +    SI   +  E+ LT      F G L +  L   N  +SNA +    + LHMA +  Q E+ K+LL SGA+V V      +PL     +  SR+ +       EI  +L+  G+D N  + +  T    AS+  +  +   LL N       + K F
Sbjct:  245 GITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGL--TPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIH--TTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPL-----HIASRLGKA------EIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGF 543          

HSP 3 Score: 48.521 bits (114), Expect = 8.163e-6
Identity = 32/164 (19.51%), Postives = 63/164 (38.41%), Query Frame = 2
Query:  131 LRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEI 622
            L L     ++  +G  P+H+A ++G  ++V LLL  + +I      G   +H A     + + ++L +HK  ++  TK  +  TP  +A  +     +                      L ++   ++ K   G T L  AA      ++  +L       E+
Sbjct:  628 LELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCY--TPLHVASHYGNIKMVNF--------------------LLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNEL 769          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 2.358e-12
Identity = 136/633 (21.48%), Postives = 244/633 (38.55%), Query Frame = 2
Query:  161 DDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCR---IDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPV-ENKEIND-LMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGH----ELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYI--LDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTS-NARD--GNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN--NPIFKNFSSKDFQMAFDNHWFQYAECLLKLLSDSFLESNITNEAFVQCKTEPNL 2011
            D  G  P+H AC  G   +  LL+    ++   D+W + P+H A     +E+  LLL +      ++C +K    L P    K+      +  F   +L+ A ++ D    +K            H GL I+        +  + C +  P  + K++++ L+++    N+K  +L     +     H          + A IN    +  Q+ L  AA  GH     L +       + +   +  A      +   E  ++I    +L      V   +L +A    D D VK +      N  D++  +    T L  A   +    ++ L Q+    + ++K    PLH A + G  +    L+ R   ++       T LH A  KG   +C+ ++ +GA+  K       +    ++  ++    +  I  L   + AL  + K   K  L  + KL S  + N RD  G N++ LH+A      E+ + LL+ GA V+  +  G  PL       +           ++I  +LI Y A +N       T    A++    ++   LL++  +P  KN   ++ Q   D      A+ +  LL D+     +  EA       PN+
Sbjct:  364 DKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHSKSAIDLAPTSELKER----LVYEFRGHSLLQAAREADVTRVKK------------HLGLDIINFKHPQTHETALHCAVASPYPKRKQVSELLLRKGANVNEKTKDLLTPLHVASDKAHNDVIDV-LLKHGAKINVTDSLG-QTSLHRAAHAGHLTTCRLLLSHGCDPNLPSLQGFTAA------QLGNESVQQILHESSLPVRNSDVEHQLLEAAKA-GDLDTVKQLCTTQTVNCRDMEGRHS---TPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTK-------KNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAK---KGCLARVQKLCSGENVNCRDSQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGH-----------VDIAALLIKYSACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPSMKN---QEGQTPLD---LATADDVRALLIDA-----MPPEALPVTHKPPNI 936          

HSP 2 Score: 59.3066 bits (142), Expect = 4.869e-9
Identity = 41/152 (26.97%), Postives = 66/152 (43.42%), Query Frame = 2
Query:  161 DDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKL-------CKSYDFMSQKLHTGLTILQTAADSNADKIIKCIL 595
            DD G  P+H AC  G   +V LLL +  +    D W Y P+H A + G I++  +LLQH    D   +   G T  D+A+  ++      +  + L+ A +  +  +   L       C + D          T L  AA  N  +I++ +L
Sbjct:  211 DDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGA--DPGIRNTDGKTALDLAEPTAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKS------TPLHLAAGYNRVRIVQLLL 354          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 6.139e-11
Identity = 109/537 (20.30%), Postives = 213/537 (39.66%), Query Frame = 2
Query:  269 GYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTL---------SIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALL 1843
            G  P+H A  +G+ ++V++LL+    I  +TK   GL+P  +A +    +C+++         ++   P++   L    D+        LT L  AA     +  K +LD+   N  +  L        +  + L   C   R  + +    +   I A   +G   +   +F+      G+   +  +++      +  VR   A+  A      E+   +       +++ +   T LH A      ++V+ +L H  + D  ++N    T L +A    H     +L ++  +     K   TPLH A   G  +    L+ R  + D  G  GLT LH A     + V   +++ GA+     +  +      + ++++ I    +++      NA+T          + + H  +    L +        + G   S LH+A +  +  + + L+  GA V+     G +PL  + C+  +          I++ N L+ +GAD+N K+ N  T    A++  +  I+  LL
Sbjct:    6 GLTPLHCAARSGHEQVVEILLEQGAPILAKTKN--GLSPLHMATQGDHVECVQVL--------MQYRAPVDDITL----DY--------LTALHVAAHCGHYRTAKVLLDKGA-NPNVRAL--------NGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFM------GNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGY--TPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEI--ATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSG--LSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLI-VACHYGN----------IKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL 488          

HSP 2 Score: 59.3066 bits (142), Expect = 4.877e-9
Identity = 69/307 (22.48%), Postives = 115/307 (37.46%), Query Frame = 2
Query:  965 NFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDF 1885
              T LH A       +V+ +L+    I   + N    + L +A    H +C++VL QY    +       T LH A   G       L+++  N +     G T LH A  K    V E ++  GA+     E                 P   S                F G L +  +      + NA +    + LHMA +  Q E+ +SLL +GA+VD       +PL     +  +R+ +      +EI  +L+ + A  +  ++N  T    A++  +E +   LL +       + K F
Sbjct:    6 GLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGL--SPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGL-------------TPMHVS---------------AFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPL-----HIAARLGK------LEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGF 271          

HSP 3 Score: 56.9954 bits (136), Expect = 2.339e-8
Identity = 36/113 (31.86%), Postives = 53/113 (46.90%), Query Frame = 2
Query:  104 GKTEELRRTLRLEFVNKLIDDKG---HFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            G+TE +R  LR       +D K      P+HIA   G L IV LLL    + +     GY P+H A   G+ ++  +LL+H   +   TK   G TP  +A K+ + +   L 
Sbjct:  182 GQTEVVRSLLR---NGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKK--GFTPLHVASKYGKMEVASLL 289          

HSP 4 Score: 51.6026 bits (122), Expect = 9.487e-7
Identity = 24/79 (30.38%), Postives = 40/79 (50.63%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKW 406
            G+ P+H+A  +G  ++  +LL    ++      G+ P+H A+  G +E+  LLLQ     D   K   GLTP  +A  +
Sbjct:  237 GYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKN--GLTPLHVASHY 313          

HSP 5 Score: 50.447 bits (119), Expect = 2.086e-6
Identity = 43/158 (27.22%), Postives = 63/158 (39.87%), Query Frame = 2
Query:  167 KGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTD--CIELFHTENLIAAIKKN-DPIEFEKLCKSYDFMSQKLHT----------GLTILQTAADSNADKIIKCILDR 601
            +G   +H+A   G   +V  LL     ++ +      P+H A   G +EIV+LLLQH    D  T    G TP  +A +    D   I L H  +L    KK   P+         +  S  L            GLT L  A+  +  K+   +LD+
Sbjct:  170 RGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSN--GYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQ 325          

HSP 6 Score: 49.2914 bits (116), Expect = 4.703e-6
Identity = 24/92 (26.09%), Postives = 48/92 (52.17%), Query Frame = 2
Query:  158 IDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            + + G  P+H++   G LNIV++LL    +    ++ G   +H A   G  E+V+ LL++  ++D + +     TP  IA +  + + ++L 
Sbjct:  134 VTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREE--QTPLHIAARLGKLEIVQLL 223          

HSP 7 Score: 48.9062 bits (115), Expect = 6.273e-6
Identity = 26/88 (29.55%), Postives = 44/88 (50.00%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            G  P+H+A ++  +N+  +L+    ++      GY P+  A   GNI++V  LLQH   ++ +TK   G TP   A +   T  + L 
Sbjct:  402 GLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKN--GYTPLHQAAQQGHTHIVNLL 487          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 1.283e-8
Identity = 58/238 (24.37%), Postives = 99/238 (41.60%), Query Frame = 2
Query:  959 KVNFTILHSAICDNDTDMVKYILDHPNNID-LDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNF--LQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPL 1663
            +   T LH A  +  ++MV +++    NI+  D  +     A+  A  + H + +KVL  +      ++K   +PLH A +SG       L++  ++ID     G T LH A   G + V  ++++ GAN  +  E  F  L F   S+                            HG L L  L   N    N +  +  S LHM     +    ++L+ +G ++D  + +GN+PL
Sbjct:  136 RAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRR---AIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAAST----------------------------HGALCLELLVN-NGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPL 341          

HSP 2 Score: 52.373 bits (124), Expect = 6.262e-7
Identity = 80/362 (22.10%), Postives = 152/362 (41.99%), Query Frame = 2
Query:  914 QEEITERMNLFESRIKVN----FTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIAL--------SLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLL-DSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQMAFDNHWFQ---YAECLLKLLS 1945
            + EI E + L  +R+        T LH A        V+ +L H  + D+++ ++   T L +A +    KC + +     ++N  ++  +T LH A  +G  +   +L+ +  NI+         +H A   G   V + +V +GA+     +  +      SS  +I +   K ++ L        S    AL ++  ++G+  +  +++L    +N    N      LH A       LC  LL ++GA V+V + +G SPL          MT   V+     +  LI  G +I+ +  +  T    A++  +E ++  L++N     + + +     F  H      +++C  KLLS
Sbjct:   51 EAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKH--SADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGV--VKLLLDLGVDIDDPNSFGNTALHVAC-YNGQDVV--VNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPL---------HMT--AVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNG---ADTAKRGIHGMFPLHLAALSGFSDCCRKLLS 391          

HSP 3 Score: 48.521 bits (114), Expect = 8.764e-6
Identity = 28/79 (35.44%), Postives = 39/79 (49.37%), Query Frame = 2
Query:  161 DDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIA 397
            D K    IH A   G   +V +L+    ++ C+D  GY P+H A+ +G I +VKLLL     ID      FG T   +A
Sbjct:  168 DKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDID--DPNSFGNTALHVA 244          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 50.8322 bits (120), Expect = 1.001e-6
Identity = 26/77 (33.77%), Postives = 44/77 (57.14%), Query Frame = 2
Query:  161 DDKGHFPIHIACEKGFLNIVILLLNENC-NIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPF 388
            D  G   + IAC+KG  ++V  ++ E   +I  +D  G   +H A L G+IEIV+LL+++   ++ ++   FG TP 
Sbjct:  327 DSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPL 403          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Yeast
Match: SPT23 (ER membrane protein involved in regulation of OLE1 transcription; inactive ER form dimerizes and one subunit is then activated by ubiquitin/proteasome-dependent processing followed by nuclear targeting; SPT23 has a paralog, MGA2, that arose from the whole genome duplication [Source:SGD;Acc:S000001503])

HSP 1 Score: 48.521 bits (114), Expect = 5.058e-6
Identity = 26/95 (27.37%), Postives = 52/95 (54.74%), Query Frame = 2
Query:   92 HLMNGKTEELRRTLRLEFVN-KLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWF 373
             L+    +  +R   L  VN  + D +G   +H+A    + ++V LL+    ++  +D++G+ P+H A +NG++ I++LLL+    I  +T+  F
Sbjct:  683 QLITEVIKSFKRNNNLSTVNLSMCDVRGRTLLHLAAFNNWYSLVSLLIKYGSHLNDQDLFGFTPLHMACINGDLRIIRLLLECNVNIMKKTRNGF 777          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Nematostella
Match: EDO37759 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SET1])

HSP 1 Score: 60.4622 bits (145), Expect = 2.420e-9
Identity = 39/128 (30.47%), Postives = 67/128 (52.34%), Query Frame = 2
Query:   80 MFVSHLMNGKTEELRRTLRLEF---VNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIEC--EDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENL 448
            +F S +++G+ + L   L LE    VNK++   G+ P+H A   G  ++V LL N   ++    ED  G  P+  A ++GN+ +V LLL   CR +    G   ++P D+AK+    D  E+  + ++
Sbjct:  363 LFTS-VISGQEQVLNYLLSLEPRPNVNKVVSASGNTPLHAAVNCGNQSMVKLLANAGADLNAANEDCNGATPLFLAIMSGNLAMVSLLLSLGCRTNVYM-GALAVSPLDLAKELELHDIAEMLDSSHI 488          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Nematostella
Match: EDO44570 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVG1])

HSP 1 Score: 48.521 bits (114), Expect = 1.863e-7
Identity = 22/56 (39.29%), Postives = 33/56 (58.93%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQH 337
            G  P+H AC +G   IV +LL    +I   +  GY P+H A L+GN E +++L+ H
Sbjct:    1 GDTPLHFACARGESAIVRVLLLFGADIHARNFAGYSPLHVAALHGNAESIRILILH 56          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Nematostella
Match: EDO30220 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1E6])

HSP 1 Score: 52.373 bits (124), Expect = 7.657e-7
Identity = 28/102 (27.45%), Postives = 52/102 (50.98%), Query Frame = 2
Query:  179 PIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEF 484
            P+ +AC  G  ++V+ L+ +  +++ +D  G   +HY    G++EIVK L++   +         GLTP  +A    +T+ +E F +E     I + D +E 
Sbjct:   24 PLMVACYNGHRDVVMYLVKKGASMDMQDKQGNSVLHYGVERGHLEIVKELVRQGAK---HLPNKLGLTPLLLASNDCKTEMVEYFISEEDCPQIDRIDALEL 122          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Nematostella
Match: EDO45485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSW0])

HSP 1 Score: 46.595 bits (109), Expect = 1.063e-6
Identity = 25/64 (39.06%), Postives = 36/64 (56.25%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRT 361
            G  P+HIA   G   IV LLL+E  ++E +   GY+P+H A   G+  I+++LLQ     D  T
Sbjct:    1 GFTPLHIAVVYGHWEIVKLLLDEGADVEAQTKNGYQPLHLAAQYGHKIIIEILLQRGAPPDALT 64          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Nematostella
Match: EDO46099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR35])

HSP 1 Score: 48.1358 bits (113), Expect = 1.839e-6
Identity = 34/144 (23.61%), Postives = 61/144 (42.36%), Query Frame = 2
Query:  182 IHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRT-KGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVE 610
            +H A   G    + LLL     +     +G++PIH A +NG+ E V++LL++    + +T K    +TP   A +    DC      E           I+ E + +           G  ++  A+D+   K++  +LD  V+
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMER---------GIDLEAVYRD----------GWRLIHVASDNGRVKVLVTLLDAGVD 125          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 85.8853 bits (211), Expect = 1.807e-16
Identity = 129/582 (22.16%), Postives = 233/582 (40.03%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQ 1888
            G  P+HIA   G +N+  LLLN    ++     G  P+H A+  GN  +V+LLL    +ID +T+   GLTP   A +      +E+         ++K  P+    L ++ +        GL+ L  AA  +  + +K +L    PV++  ++ L            ++   C  YR  + +     +   NA  +NG       + L IA ++     ++ ++K   Y  SI                 + +TE             T +H A      ++V  +L   N    D +N    T+L +A      + ++ L +     + + +  QTPLH A   G  +    L+    + D     G T LH +  +G       ++  GA++    +  F      S    + +     ++     S  +N LT L +  H    K+ L  LDK  S  + A++G   + LH+A K  Q ++   LL  GA+ + +   G +PL       ++ M             +L+  GA INV + + +T    A+  + +R+ +A +    + +N ++ D Q
Sbjct:  226 GFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRD--GLTPLHCAARSGHEASVEVL--------LEKGAPL----LARTKN--------GLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTA---------LHVAAHCGHYR--VTKLLLDKRANPNARALNG------FTPLHIACKKNRVKVMELLVK---YGASI-----------------QAVTES----------GLTPIHVAAFMGHLNIVLLLLQ--NGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNG--YTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAA-----------LLMSKGAQINVPTKSGLTALHLAA--QEDRVAVAEI----LVRNGANLDHQ 717          

HSP 2 Score: 68.1662 bits (165), Expect = 4.354e-11
Identity = 95/422 (22.51%), Postives = 168/422 (39.81%), Query Frame = 2
Query:  788 LEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNN-----------------------IDLDSNNETLG----TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSS---ENEITIPFEKSIIALSLMENALT-LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN--NPIFKNFSSK-DFQMAFDNHWFQYAECLLK 1936
            L +AA++GH   +  ++ +     S   +   A+  +      E+ + + +R     ++ +  FT L+ A  +N  D+V+Y+L++  N                       + +   N+T G     AL +A      K   +L Q +   + Q+K   TPLH A   G  +    L+NR   +D     G+T LH A  +G  N+   +++ G+              C +    E  + +  EK    L+  +N L+ L +   G    C +  L    +   D   + L  LH+A  C    + K LLD  A  +    NG +PL  + C  N           +++  +L+ YGA I   + + +T    A+ + +  I+L LL N  +P   N   +    MA      +   CLL+
Sbjct:   69 LHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVEC-VKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLH-IACKKNR----------VKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLR 478          

HSP 3 Score: 60.8474 bits (146), Expect = 8.844e-9
Identity = 30/94 (31.91%), Postives = 50/94 (53.19%), Query Frame = 2
Query:  152 KLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            + + + G  PIH+A   G LNIV+LLL    + +  +I G   +H A   G  E+V+ LL++   +D R +     TP  IA +  +T+ ++L 
Sbjct:  418 QAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAR--EDQTPLHIASRLGKTEIVQLL 509          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 85.5001 bits (210), Expect = 2.004e-16
Identity = 129/582 (22.16%), Postives = 233/582 (40.03%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFH---GKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQ 1888
            G  P+HIA   G +N+  LLLN    ++     G  P+H A+  GN  +V+LLL    +ID +T+   GLTP   A +      +E+         ++K  P+    L ++ +        GL+ L  AA  +  + +K +L    PV++  ++ L            ++   C  YR  + +     +   NA  +NG       + L IA ++     ++ ++K   Y  SI                 + +TE             T +H A      ++V  +L   N    D +N    T+L +A      + ++ L +     + + +  QTPLH A   G  +    L+    + D     G T LH +  +G       ++  GA++    +  F      S    + +     ++     S  +N LT L +  H    K+ L  LDK  S  + A++G   + LH+A K  Q ++   LL  GA+ + +   G +PL       ++ M             +L+  GA INV + + +T    A+  + +R+ +A +    + +N ++ D Q
Sbjct:  241 GFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRD--GLTPLHCAARSGHEASVEVL--------LEKGAPL----LARTKN--------GLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTA---------LHVAAHCGHYR--VTKLLLDKRANPNARALNG------FTPLHIACKKNRVKVMELLVK---YGASI-----------------QAVTES----------GLTPIHVAAFMGHLNIVLLLLQ--NGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNG--YTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAA-----------LLMSKGAQINVPTKSGLTALHLAA--QEDRVAVAEI----LVRNGANLDHQ 732          

HSP 2 Score: 68.1662 bits (165), Expect = 4.626e-11
Identity = 95/422 (22.51%), Postives = 168/422 (39.81%), Query Frame = 2
Query:  788 LEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNN-----------------------IDLDSNNETLG----TALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSS---ENEITIPFEKSIIALSLMENALT-LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSL--LHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN--NPIFKNFSSK-DFQMAFDNHWFQYAECLLK 1936
            L +AA++GH   +  ++ +     S   +   A+  +      E+ + + +R     ++ +  FT L+ A  +N  D+V+Y+L++  N                       + +   N+T G     AL +A      K   +L Q +   + Q+K   TPLH A   G  +    L+NR   +D     G+T LH A  +G  N+   +++ G+              C +    E  + +  EK    L+  +N L+ L +   G    C +  L    +   D   + L  LH+A  C    + K LLD  A  +    NG +PL  + C  N           +++  +L+ YGA I   + + +T    A+ + +  I+L LL N  +P   N   +    MA      +   CLL+
Sbjct:   84 LHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVEC-VKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLH-IACKKNR----------VKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLR 493          

HSP 3 Score: 60.4622 bits (145), Expect = 9.636e-9
Identity = 30/94 (31.91%), Postives = 50/94 (53.19%), Query Frame = 2
Query:  152 KLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            + + + G  PIH+A   G LNIV+LLL    + +  +I G   +H A   G  E+V+ LL++   +D R +     TP  IA +  +T+ ++L 
Sbjct:  433 QAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAR--EDQTPLHIASRLGKTEIVQLL 524          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 77.411 bits (189), Expect = 6.708e-14
Identity = 130/602 (21.59%), Postives = 214/602 (35.55%), Query Frame = 2
Query:   59 IKMSYFDMFVSHLMNGKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFG-------------------------------LTPFDIAK-------------KWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR---------PVENK----------EINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGH----ELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPL 1663
            I   Y +M V+ L+      L R   + F  K     G  P+HIA  +G + +V LLL+    I+ +      P+H A  NG++ I+++LL+H   I  +TK                                   LTP  +A              K ++ +   L     L  A KKN     + L K    +     +GLT L  AA      I+K +L R          VE            E+   + +   + D  +    +  L+ +    H    K  ++          A  + L IAA +GH     + +D   ++    K  +   +  A      ++ E + ER     +  K   T LH A+  N+ D+VK ++    +    + N    T L +A   +  +   VL Q   + N ++    TPLH A   G  D    LI++  N++     GLT LH    +G   + + +V  GA+      + +           I +                   +KF        L +     +  R G   + LH A +    ++   LL  GA  + + SNG SPL
Sbjct:  210 IAAHYENMSVAQLL------LNRGANVNFTPK----NGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAK-DDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFT-PLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGY--TPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKM-------------------VKF-------LLQQQAHVNAKTRMG--YTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPL 769          

HSP 2 Score: 74.3294 bits (181), Expect = 5.722e-13
Identity = 145/632 (22.94%), Postives = 246/632 (38.92%), Query Frame = 2
Query:  113 EELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIEL---FHTENLI-----------------AAIKKNDP-------IEFEKL--CKSYDFMS--QKL-----------HTGLTILQTAADSNADKIIKCILDRPVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSI------WVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENE---ITIPFEKSIIALSLMENALT---LSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALL 1843
            E L   + LE   K    KG+  +HIA   G   +V  L+N   N+  +   G+ P++ A    ++E+VK LL++       T+   G TP  +A +    + + L   + T+  +                 A + +NDP         F  L     Y+ MS  Q L             G+T L  A+      +++ +LDR     +I+   K E+T  +    N     I    I+ +H A     I A   NG       S + +AA+  H   +D + +   YN  I       +  +  A       + + + ++     +R    FT LH A   N    +  +L H  +  L++  E+  T L +A  + H   +K L Q   + N  N   +TPLH A  +G  +   +L+  +  +D       T LHCA   G + + + ++++ AN               + E     I I  +     + + +   T   ++ K+ GK+ +  L        NA   N  + LH+AV     ++ K L+  G        NG +PL              K N+ IE+ ++L+  GA  N +S   IT    AS+ E    M+A+L
Sbjct:   61 ELLHSGIELEATTK----KGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTED--GFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDR---GAQIDAQTKDELTPLHCAARNGHVRII---EILLEHGAP----IQAKTKNG------LSPIHMAAQGDH---MDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKH--SASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKY-GKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLH----------IAAKQNQ-IEVASVLLQNGASPNCESLQGITPLHLASQ-EGRPDMVAML 652          

HSP 3 Score: 70.4774 bits (171), Expect = 9.852e-12
Identity = 123/568 (21.65%), Postives = 226/568 (39.79%), Query Frame = 2
Query:  155 LIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIEL---------FHTENLIA----AIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDR--PVENKEINDLMK-EITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIP---FEKSIIALSLMENALT-LSIKFHG---KLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRIT 1789
            L  + G  P+ +A ++G  N+V LL+N     +         +H A  N +     +LLQ+    D  +K   G TP  IA  +      +L         F  +N I     A ++ + +    L      +  +    LT L  AA +   +II+ +L+   P++ K  N L    +  + D + +  ++ + Y + I          ++ A   G H++A +  L+  A + +   ++G     I  K   +R++            + + +     E+  +   T LH A      ++VK +L        +++N  + T L +A    H +  + L Q     + + K  QTPLH A   G  +    L++   N D     G T LH A  +G  +    +++ GA  +K  +  F      S   ++ +     E+     +  +N LT L +  H     +    + K  S  S AR+G   + LH+A K  Q E+   LL +GA  +  +  G +PL     +   R          ++  +LI   A++N+ + N +T
Sbjct:  137 LPTEDGFTPLAVALQQGHENVVALLINYGTKGKVR----LPALHIAARNDDTRTAAVLLQNDPNPDVLSK--TGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHM-DCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMA-KVLLDKGA-KANARALNGFTPLHIACKKNHMRSM------------DLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQ--RGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNG--YTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLH--LASQEGRP---------DMVAMLISKQANVNLGNKNGLT 668          

HSP 4 Score: 57.7658 bits (138), Expect = 6.781e-8
Identity = 28/88 (31.82%), Postives = 46/88 (52.27%), Query Frame = 2
Query:  170 GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            G+ P+H+AC  G + +V  LL +  ++  +   GY P+H A   G+ +IV LLL+H    +  T    G +P  IAK+      I++ 
Sbjct:  699 GYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSN--GTSPLGIAKRLGYISVIDVL 784          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 75.485 bits (184), Expect = 2.512e-13
Identity = 137/662 (20.69%), Postives = 256/662 (38.67%), Query Frame = 2
Query:  167 KGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIEL---FHTENLIAAIKKND-----------PI----EFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILD--RPVENKEIN--------------DLMKEITEENDKLSNLTKECILYRSII----HQHAA------GFKKFINAAVING--PHKIATQ-------------------------SFLEIAAEQGHELFIDGIMKKTIYNKSIWVR---AIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKD----FQMAFDNHWFQY 1918
            KG+  +HIA   G   +V  L+N   N+  +   G+ P++ A    ++E+VK LL++       T+   G TP  +A +    + + L   + T+  +      D           P+     +E L  +   +++  +  LT L  AA +   +II+ +LD   P++ K  N              D +K++ + N ++ ++T + +    +     H   A      G K   N+  +NG  P  IA +                         + L +A+  GH   +  +++K     +  V+    +  A      E+ E + +     +++ K + T LH A      ++VK +L+H  N   +S      + L +A    H + +++L   E       K   TPLH A   G  D    L+ R  N +  G  GLT LH AV     +V   +V+ G +        +      + +N++        +A SL++         HG             ++NA      + LH+A +  +P++   L+   A V++ N +G +PL  +    +           + I +IL+  GA +   +    T    A    N +++  LL       N +SK      Q  + +H+ +Y
Sbjct:   72 KGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTED--GFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKP--NSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANP--NSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVE-------VANSLLQ---------HG------------ASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGH-----------VGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQ---ANVNSKTRVEYIQCHYKDHYCEY 685          

HSP 2 Score: 51.2174 bits (121), Expect = 6.469e-6
Identity = 25/92 (27.17%), Postives = 47/92 (51.09%), Query Frame = 2
Query:  158 IDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF 433
            + + G  P+H+A   G LNIV +LL +  +    ++    P+H A+ +G+ E+ + LLQ+   +D + K     TP   A +    + ++L 
Sbjct:  338 VTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKD--DQTPLHCAARMGHKELVKLL 427          
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Medaka
Match: ENSORLT00000038944.1 (tankyrase-1 [Source:NCBI gene;Acc:101158122])

HSP 1 Score: 72.4034 bits (176), Expect = 2.289e-12
Identity = 122/579 (21.07%), Postives = 221/579 (38.17%), Query Frame = 2
Query:  161 DDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCR---IDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADK---IIKCILDRPVENKEIN-DLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKF-VELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSN--NPIFKN 1867
            D  G  P+H AC  G   +  LLL     +   D+W + P+H A     +E+  LLL H      ++C +K    + P    K+    +    F   +L+ A ++ D  + +K         +  HT  T L  A  S   K   + + +L +     E N D M  +    ++  N   E      ++ +H A     +NA    G      Q+ L  AA  GH L    ++     + S+       A     + +Q+ + E + +  S   V++ +L +A    D D +K +   P N++         T L  A   +    ++ L  +    + ++K    PLH A + G  +    L+    +++       T LH A  KG   +C+ ++ +GA+  K   + N      +  + +I          L   +      ++      LC  D +N   +  R   N++ LH+A      E+ + LL+ GA V+  +  G  PL       +           ++I  +LI Y   +N       T    A++    ++   LL++  +P  KN
Sbjct:  346 DKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLLNCHSKSSVDMAPTPELKERLTYE----FKGHSLLQAAREADMAKAKKTLALEIINFKHPHTHETALHCAVASPHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDIME------VLQKHGA----KVNALDTLG------QTALHRAALAGH-LQTCRLLLGYGADASLVSLQGFTAAQMGNEAVQQILNESVPVRNS--DVDYRLLEAAKA-GDLDTIKSLCT-PQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVQ-----KLCSPDNINCRDTQGR---NSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGH-----------VDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKN 880          

HSP 2 Score: 56.6102 bits (135), Expect = 1.586e-7
Identity = 40/152 (26.32%), Postives = 65/152 (42.76%), Query Frame = 2
Query:  161 DDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKL-------CKSYDFMSQKLHTGLTILQTAADSNADKIIKCIL 595
            DD G  P+H AC  G   +V LLL +       D W Y P+H A + G I++  +LLQH    D   +   G +  D+A+  ++      +  + L+ A +  +  +   L       C + D          T L  AA  N  +I++ +L
Sbjct:  193 DDGGLIPLHNACSFGHSEVVSLLLCQGAEPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGA--DPNIRNTDGKSALDLAEPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKS------TPLHLAAGYNRVRIVQLLL 336          

HSP 3 Score: 52.7582 bits (125), Expect = 2.348e-6
Identity = 27/79 (34.18%), Postives = 37/79 (46.84%), Query Frame = 2
Query:  161 DDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIA 397
            D  G  P+H A   G ++I  LL+  N  +   D W + P+H A   G  ++  LLL H    D   K   G TP D+A
Sbjct:  814 DKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGA--DPTMKNQEGQTPLDLA 890          
BLAST of RING domain ligase2 isoform 3 vs. Planmine SMEST
Match: SMESG000003596.1 (SMESG000003596.1)

HSP 1 Score: 1763.81 bits (4567), Expect = 0.000e+0
Identity = 887/892 (99.44%), Postives = 887/892 (99.44%), Query Frame = 2
Query:   65 MSYFDMFVSHLMNGKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQMAFDNHWFQYAECLLKLLSDSFLESNITNEAFVQCKTEPNLIXXXXXXXXXXXQRAIIETLLWNAIRKNDKKLFDFFIKIEISSPKLFSNGENLFTQILKVRKIHFAWKVLESKNKMKFVNLKNKTNQTPLQVAIEIDEMDLVDALIHESNEFDCEDINGNSVLTQLIGKISICKNVNSKSRLMAAMKSAILLGGDIYKVSSCGKRIIDTCTDCNAKSEIERFHGNNLKKKEYVNDKICIICMNNTVDVAFQCGHLVCSVCGNRLFVCPVCNKEISNKTKIYFS 2740
            MSYFDMFVSHLMNGKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIKKAKDKKFKEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE     FTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQMAFDNHWFQYAECLLKLLSDSFLESNITNEAFVQCKTEPNLIKLLFSKSSSSFQRAIIETLLWNAIRKNDKKLFDFFIKIEISSPKLFSNGENLFTQILKVRKIHFAWKVLESKNKMKFVNLKNKTNQTPLQVAIEIDEMDLVDALIHESNEFDCEDINGNSVLTQLIGKISICKNVNSKSRLMAAMKSAILLGGDIYKVSSCGKRIIDTCTDCNAKSEIERFHGNNLKKKEYVNDKICIICMNNTVDVAFQCGHLVCSVCGNRLFVCPVCNKEISNKTKIYFS
Sbjct:    1 MSYFDMFVSHLMNGKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIKKAKDKKFKEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVE-----FTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQMAFDNHWFQYAECLLKLLSDSFLESNITNEAFVQCKTEPNLIKLLFSKSSSSFQRAIIETLLWNAIRKNDKKLFDFFIKIEISSPKLFSNGENLFTQILKVRKIHFAWKVLESKNKMKFVNLKNKTNQTPLQVAIEIDEMDLVDALIHESNEFDCEDINGNSVLTQLIGKISICKNVNSKSRLMAAMKSAILLGGDIYKVSSCGKRIIDTCTDCNAKSEIERFHGNNLKKKEYVNDKICIICMNNTVDVAFQCGHLVCSVCGNRLFVCPVCNKEISNKTKIYFS 887          
BLAST of RING domain ligase2 isoform 3 vs. Planmine SMEST
Match: SMESG000001281.1 (SMESG000001281.1)

HSP 1 Score: 999.579 bits (2583), Expect = 0.000e+0
Identity = 519/895 (57.99%), Postives = 665/895 (74.30%), Query Frame = 2
Query:   65 MSYFDMFVSHLMNGKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQMAFDNHWFQYAECLLKLLSDSFLESNITNEAF-VQCKTEPNLIXXXXXXXXXXXQRAIIETLLWNAIRKNDKKLFDFFIKIEISSPKLFSNGENLFTQILKVRKIHFAWKVLESKNKMKFVNLKNKTNQTPLQVAIEIDEMDLVDALIHESNEFDCEDINGNSVLTQLIGKISICKNVNSKSRLMAAMKSAILLGGDIYKVSSCGKRIIDTCTDCNAKSEIERFHGNNLKKKEYVNDK---ICIICMNNTVDVAFQCGHLVCSVCGNRLFVCPVCNKEISNKTKIYF 2737
            M  F  F  +LM+G +  LR  +R+ FVNK++D+ G +PIH+AC  G+++IV LLL+ NCNIE E+ WG KPIH A+ NGN EIVKLLL+ KC+ID  +K   G +P D A   ++TDCIEL   E L AAI +N+ ++F++  K  DF  Q + TGL+IL+TA   NA +IIKCILD+P   KEINDL++E+T + DK   LT+ECILY  +IHQHA GFKKF++  +ING  K+   SFLEIA  +G   FIDGIMKKTIYNK +W  AI +A++K F EI+EE++ERM L ESR KVNFTILH+AICDND +MVKYI++HPN +DL+SNNET GTAL+L HSLHHRKCIKVLQQY+L TNT+NKYSQTPLHEAIASG  +NC YLI ++I+ID  GF+GLT LHCAVI+GME VC Q++N GA+Y++F+EL+      +SS NEI IPF +SII L+  ENALT S+KFH  LF CFL++L+S +SN  DG+ NSLLH+AVKCL+P +CKSLL +GA VD VN  GNSPL EMFC   S++T + +N+MI ITNILI +GA+IN  S+N IT+FQ AS +E+E +MLALLSNNP    FSS DFQ AF   WF YAE L+ +L ++FL SNIT   F +  K +  LIKLLF KSS   Q+AIIE LL +A+  +D  LF+ F+K EI  PK+   GENLFT ILK  K+ FAWK+L S N++KFVNLKN  NQ PLQ+AIE++EMDLVD LIHES+E DCED  G +VLT+L+ KIS     N K ++++ +KSAILLG DIYK++S G+RIID+CT+ + K+EIERFH NN+KK +  ND    +C IC +N V++ FQCGHL CSVC +R+  CP+C  +I  +TK+Y 
Sbjct:    1 MRDFKNFKEYLMSGNSAGLRNNMRVGFVNKIVDEDGQYPIHVACAAGYIDIVKLLLDYNCNIEFENEWGMKPIHSASKNGNTEIVKLLLKRKCQID--SKDILGNSPLDWATMCNKTDCIELLRIEELFAAINQNNLMKFDEFYKPCDFAKQNISTGLSILETAIKHNAYQIIKCILDKPANYKEINDLIEELTMKGDKNLKLTEECILYLCVIHQHAQGFKKFVSPDIINGQCKLVGLSFLEIATGKGCNAFIDGIMKKTIYNKLLWQNAILEAQEKGFVEIEEELSERMILLESRQKVNFTILHTAICDNDAEMVKYIVNHPNAVDLNSNNETFGTALSLGHSLHHRKCIKVLQQYKLNTNTRNKYSQTPLHEAIASGSGENCEYLIEQAIDIDWAGFIGLTALHCAVIRGMETVCLQLLNKGADYVRFIELSH-----RSSSNEIAIPFIRSIIPLTNSENALTFSMKFHRTLFSCFLNRLDSQSSNVHDGDKNSLLHLAVKCLRPGICKSLLKAGANVDSVNYWGNSPLLEMFCKPQSKLTNKSLNKMIIITNILIKHGANINAISSNGITVFQFASIIESENLMLALLSNNPDLNFFSSSDFQTAFTKQWFNYAEILINILPETFLVSNITLATFDLSTKADTKLIKLLFDKSSCEMQQAIIEKLLCDAVNSDDIDLFEHFLKTEILVPKILKTGENLFTFILKENKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRLMLKISNLP-ANHKPKMISVIKSAILLGADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAKIITRTKMYL 887          
BLAST of RING domain ligase2 isoform 3 vs. Planmine SMEST
Match: SMESG000002106.1 (SMESG000002106.1)

HSP 1 Score: 974.926 bits (2519), Expect = 0.000e+0
Identity = 500/903 (55.37%), Postives = 671/903 (74.31%), Query Frame = 2
Query:   65 MSYFDMFVSHLMNGKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF-HTENLI---AAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQMAFDNHWFQYAECLLKLLSDSFLESNITNEAFVQC-KTEPNLIXXXXXXXXXXXQRAIIETLLWNAIRKNDKKLFDFFIKIEISSPKLFSNGENLFTQILKVRKIHFAWKVLESKNKMKFVNLKNKTNQTPLQVAIEIDEMDLVDALIHESNEFDCEDINGNSVLTQLIGKISICKNVNSKSRLMAAMKSAILLGGDIYKVSSCGKRIIDTCTDCNAKSEIERFHGNNL---KKKEYVNDK---ICIICMNNTVDVAFQCGHLVCSVCGNRLFVCPVCNKEISNKTKIYFS 2740
            M  +  F+  LMNG TE +   +  EFVN +I +KG FPIH+ACEKG +NIV LL+   CNIECED    +PIHYA++NG+++I+K+LL +KC++DC+ K   GL+P ++A+   + DC+EL  ++E L+   AA+K+NDPIEFE+L KS +F+S+  +TG   L+ A ++NAD+IIK ILD+P++NKEI+D MKEI+  N + SNL KEC+L+R IIH+H  GFK+   AA+ING  +I   SFLE+AAEQG  +FID IMKKTIY+KS+W++A+ KA++  F  I+EEI++RM L ESR KVNFTILH+AICDND D+VKYILDH + +DL+SNNE  GTALA +HSLHH KCIK++QQY+L TNT+NK+ QTPLHEAIASG++ NCG+LI+R++NIDQ  F+GL+ LHCAVI+GM NV  ++V  GA+Y+K+V     Q T     N+ITIPF KS I+LS  ENALTLSIKF   L  CFL++LNS ++N+ DG+ NSLLHMAVKCLQP LC+SL+++GA++  +N+ GN+PL EMF  +   MT+EK+N+MI+ITNILI  GAD+N KS+N I++FQSAS + +ER+MLAL+SNNP+ +NFSS DFQ+AF N W +Y E L+K+L D+FL SNIT E F    K EP LIK+LF KSS   Q++I+E  L+ A   +  ++FD  I IEI  P    NGE L T ++K  KI F WK+L+S NK KFVN+KNK NQT LQVAIEI+EMDL+D LI+ES  FD ED +G + LTQL+ KISIC N NS  +L++A+KS +  GGDIY V+S GK++ID C D N K+++  F+   L   KK++  +DK   IC ICM+N V++  QCGHL+C  C ++LFVC  CN EI  + ++YF+
Sbjct:    1 MRDYKCFMESLMNGNTEGVNNNINEEFVN-IIVEKGKFPIHVACEKGLINIVQLLMQHGCNIECEDDKQCRPIHYASMNGHVKIIKVLLLNKCQVDCKQKN--GLSPLELARLCDQKDCVELLSNSETLLKTFAAVKRNDPIEFEELYKSCNFISRNFYTGFCFLKIALENNADRIIKNILDKPIDNKEIDDFMKEISANNIENSNLIKECLLHRCIIHKHVVGFKQLKTAAIINGNREIMQTSFLEMAAEQGCHVFIDEIMKKTIYDKSVWIKAMDKARENGFLNIEEEISDRMILLESRQKVNFTILHTAICDNDPDVVKYILDHADIVDLNSNNEIFGTALAFSHSLHHSKCIKIMQQYQLDTNTRNKFMQTPLHEAIASGVEKNCGFLIDRAVNIDQTDFMGLSVLHCAVIRGMINVSSRLVTMGADYVKYV-----QLTPHLLANKITIPFAKSTISLSHTENALTLSIKFQATLLPCFLERLNSESANSCDGDENSLLHMAVKCLQPGLCRSLVNAGAQIHSINNLGNTPLLEMFYETEINMTDEKLNKMIDITNILIECGADVNAKSSNEISLFQSASIIGSERLMLALVSNNPMLRNFSSDDFQLAFSNQWHKYGETLIKILPDNFLSSNITIETFQSSKKAEPKLIKILFDKSSPELQQSILENFLYEASNNDGNEIFDHMINIEILQPSELRNGETLLTALMKENKIGFVWKLLDSINKTKFVNVKNKRNQTALQVAIEIEEMDLIDNLIYESEGFDSEDKDGRTALTQLLEKISICTNANSNRKLISAIKSIVQAGGDIYMVTSLGKQVIDACADGNVKADVIEFNRKILTKSKKEKNDDDKGSMICNICMDNLVEIVLQCGHLLCCRCSDQLFVCHACNAEIKTRIQLYFN 895          
BLAST of RING domain ligase2 isoform 3 vs. Planmine SMEST
Match: SMESG000002106.1 (SMESG000002106.1)

HSP 1 Score: 974.156 bits (2517), Expect = 0.000e+0
Identity = 499/900 (55.44%), Postives = 670/900 (74.44%), Query Frame = 2
Query:   74 FDMFVSHLMNGKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF-HTENLI---AAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQMAFDNHWFQYAECLLKLLSDSFLESNITNEAFVQC-KTEPNLIXXXXXXXXXXXQRAIIETLLWNAIRKNDKKLFDFFIKIEISSPKLFSNGENLFTQILKVRKIHFAWKVLESKNKMKFVNLKNKTNQTPLQVAIEIDEMDLVDALIHESNEFDCEDINGNSVLTQLIGKISICKNVNSKSRLMAAMKSAILLGGDIYKVSSCGKRIIDTCTDCNAKSEIERFHGNNL---KKKEYVNDK---ICIICMNNTVDVAFQCGHLVCSVCGNRLFVCPVCNKEISNKTKIYFS 2740
            +  F+  LMNG TE +   +  EFVN +I +KG FPIH+ACEKG +NIV LL+   CNIECED    +PIHYA++NG+++I+K+LL +KC++DC+ K   GL+P ++A+   + DC+EL  ++E L+   AA+K+NDPIEFE+L KS +F+S+  +TG   L+ A ++NAD+IIK ILD+P++NKEI+D MKEI+  N + SNL KEC+L+R IIH+H  GFK+   AA+ING  +I   SFLE+AAEQG  +FID IMKKTIY+KS+W++A+ KA++  F  I+EEI++RM L ESR KVNFTILH+AICDND D+VKYILDH + +DL+SNNE  GTALA +HSLHH KCIK++QQY+L TNT+NK+ QTPLHEAIASG++ NCG+LI+R++NIDQ  F+GL+ LHCAVI+GM NV  ++V  GA+Y+K+V     Q T     N+ITIPF KS I+LS  ENALTLSIKF   L  CFL++LNS ++N+ DG+ NSLLHMAVKCLQP LC+SL+++GA++  +N+ GN+PL EMF  +   MT+EK+N+MI+ITNILI  GAD+N KS+N I++FQSAS + +ER+MLAL+SNNP+ +NFSS DFQ+AF N W +Y E L+K+L D+FL SNIT E F    K EP LIK+LF KSS   Q++I+E  L+ A   +  ++FD  I IEI  P    NGE L T ++K  KI F WK+L+S NK KFVN+KNK NQT LQVAIEI+EMDL+D LI+ES  FD ED +G + LTQL+ KISIC N NS  +L++A+KS +  GGDIY V+S GK++ID C D N K+++  F+   L   KK++  +DK   IC ICM+N V++  QCGHL+C  C ++LFVC  CN EI  + ++YF+
Sbjct:    5 YKCFMESLMNGNTEGVNNNINEEFVN-IIVEKGKFPIHVACEKGLINIVQLLMQHGCNIECEDDKQCRPIHYASMNGHVKIIKVLLLNKCQVDCKQKN--GLSPLELARLCDQKDCVELLSNSETLLKTFAAVKRNDPIEFEELYKSCNFISRNFYTGFCFLKIALENNADRIIKNILDKPIDNKEIDDFMKEISANNIENSNLIKECLLHRCIIHKHVVGFKQLKTAAIINGNREIMQTSFLEMAAEQGCHVFIDEIMKKTIYDKSVWIKAMDKARENGFLNIEEEISDRMILLESRQKVNFTILHTAICDNDPDVVKYILDHADIVDLNSNNEIFGTALAFSHSLHHSKCIKIMQQYQLDTNTRNKFMQTPLHEAIASGVEKNCGFLIDRAVNIDQTDFMGLSVLHCAVIRGMINVSSRLVTMGADYVKYV-----QLTPHLLANKITIPFAKSTISLSHTENALTLSIKFQATLLPCFLERLNSESANSCDGDENSLLHMAVKCLQPGLCRSLVNAGAQIHSINNLGNTPLLEMFYETEINMTDEKLNKMIDITNILIECGADVNAKSSNEISLFQSASIIGSERLMLALVSNNPMLRNFSSDDFQLAFSNQWHKYGETLIKILPDNFLSSNITIETFQSSKKAEPKLIKILFDKSSPELQQSILENFLYEASNNDGNEIFDHMINIEILQPSELRNGETLLTALMKENKIGFVWKLLDSINKTKFVNVKNKRNQTALQVAIEIEEMDLIDNLIYESEGFDSEDKDGRTALTQLLEKISICTNANSNRKLISAIKSIVQAGGDIYMVTSLGKQVIDACADGNVKADVIEFNRKILTKSKKEKNDDDKGSMICNICMDNLVEIVLQCGHLLCCRCSDQLFVCHACNAEIKTRIQLYFN 896          
BLAST of RING domain ligase2 isoform 3 vs. Planmine SMEST
Match: SMESG000010368.1 (SMESG000010368.1)

HSP 1 Score: 959.133 bits (2478), Expect = 0.000e+0
Identity = 505/934 (54.07%), Postives = 663/934 (70.99%), Query Frame = 2
Query:   65 MSYFDMFVSHLMNGKTEELRRTLRLEFVNKLIDDK-GHFPIHIACEKGFLNIVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLL---------------------------------QHKCRIDCRTKGWFGLTPFDIAKKWSRTDCIELF-HTENLIAAIKKNDPIEFEKLCKSYDFMSQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKLSNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGHELFIDGIMKKTIYNKSIWVRAIXXXXXXXXXEIQEEITERMNLFESRIKVNFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRKCIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGFLGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITIPFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLLHMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVNRMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFKNFSSKDFQMAFDNHWFQYAECLLKLLSDSFLESNITNEAFVQCKTE-PNLIXXXXXXXXXXXQRAIIETLLWNAIRKNDKKLFDFFIKIEISSPKLFSNGENLFTQILKVRKIHFAWKVLESKNKMKFVNLKNKTNQTPLQVAIEIDEMDLVDALIHESNEFDCEDINGNSVLTQLIGKISICKNVNSKSRLMAAMKSAILLGGDIYKVSSCGK-RIIDTCTDCNAKSEIERFHGNNLKKKEYVNDK-----ICIICMNNTVDVAFQCGHLVCSVCGNRLFVCPVCNKEISNKTKIYFS 2740
            M  F  F  HLM G  E +R  LR EFV+K+IDD  G FPIHI C  GF+ +  LLL+ NC IECE  WG +PIHYAT  G+ EIVKLLL                                 + KCRIDC+TK   G +P DIAK+++R DC++L  H E L A I+++DPIE EKL  S +F+ + ++TGL +L+ A  +NADKI+K ILD+ ++NKEI++++KE+T  + + +NL KECILY  I   H +G K+F +A VING  +I   ++LE+A E G +L ID IM+KTIY+KSIW++AI KAK+  F EIQ+EI ERM L ESR K NFTI H+AI DND DM++Y+LDHPN +DL+SNNET GTAL+LA+SLH R CI VLQQY+L  NT+NKYS+TPLHEAIASG+D +CGYLI+RSI+IDQ G++GLTGLHCAVI+G+ NVC Q+VN GA+ M+ V L     +CQ S  EI+IPF +S I+L+++EN+LTLS+KFH  +F CF  KL+  +SNA DG+NNSLLH+AVKCLQP++C SLL++GA+VD VN+ GNSPL E+F +    + ++ +N++I ITNILI  GAD+N KS+N I+ F SAS +E+E++M+AL+SN+P   NFSS DFQ AF N WF YAE L++LL D FL   I+N+ F  C++   NLIK LF+KSSS+ Q+++IE LL+ A+  ND +LFD FI+ EIS+PK   NGENL T IL+ RKI FAWK+L+S N+ KFV L+N  NQ PLQ+AIEI+EMDLV+ALI E+ +   ED  G   L QL+ KISI  NVN K +L+ A+KS I  GGDIYK++S G+ RIID CTD  AK EIER+H NN K     N       +C IC N  V++ FQCGHL+C +C ++LF CP C  +I  +TK++FS
Sbjct:    1 MGDFQSFKEHLMKGNAEGVRNNLRGEFVDKIIDDDNGDFPIHITCRDGFVAVAKLLLDRNCKIECETKWGNRPIHYATCYGHSEIVKLLLDRNCNIECETKWKWRPIHYVSWKGQSEILKLLLRRKCRIDCKTKD--GKSPLDIAKQFNRVDCVKLLTHMEKLFAIIEQDDPIEMEKLLISCEFIRENIYTGLNVLEIAMTNNADKILKWILDKSIDNKEIDEVIKELTAIDKENANLLKECILYLCITRHHMSGIKRFHSAVVINGQRRIVGPTYLELAVEHGCDLLIDLIMRKTIYDKSIWIKAIGKAKENGFIEIQKEIQERMTLMESRQKSNFTIFHTAISDNDVDMLQYLLDHPNIVDLNSNNETFGTALSLAYSLHQRNCIAVLQQYQLDVNTRNKYSETPLHEAIASGMDADCGYLIDRSIDIDQTGYMGLTGLHCAVIRGLINVCTQLVNRGADCMRSVNL-----SCQHSVGEISIPFAQSFISLTVIENSLTLSLKFHRTIFPCFFKKLDLNSSNAHDGDNNSLLHLAVKCLQPDICSSLLNAGAQVDSVNNFGNSPLLELFADRKIPVDDDTLNKLIGITNILIVKGADVNFKSSNGISAFISASNIESEKLMVALVSNHPRLINFSSNDFQTAFLNQWFVYAELLIELLPDDFLSFAISNDTFQSCESAGTNLIKSLFNKSSSALQQSVIENLLYKAVNSNDVELFDHFIRTEISAPKSLRNGENLLTFILQERKIEFAWKLLDSVNRGKFVKLRNINNQIPLQIAIEIEEMDLVNALIIETKDCHSEDEGGTCALIQLLEKISISNNVNFKRKLILAIKSIISFGGDIYKMTSRGQHRIIDVCTDSVAKEEIERYHRNNTKPSTEENKPDNEIAMCNICQNKQVNIVFQCGHLICDLCSDQLFECPFCKADIVTRTKMFFS 927          
The following BLAST results are available for this feature:
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK31.528e-1821.92ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK32.198e-1821.92ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK24.216e-1822.28ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK25.522e-1822.53ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK26.145e-1822.53ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-449.488e-1321.33AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-449.488e-1321.33AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-449.623e-1321.33AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-449.623e-1321.33AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.010e-1221.33AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank27.740e-1822.55gene:FBgn0261788 transcript:FBtr0303119[more]
Ank22.575e-1722.55gene:FBgn0261788 transcript:FBtr0334061[more]
Ank24.267e-1722.95gene:FBgn0261788 transcript:FBtr0303118[more]
Ank24.680e-1722.49gene:FBgn0261788 transcript:FBtr0344224[more]
Ank28.141e-1722.49gene:FBgn0261788 transcript:FBtr0303125[more]
back to top
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1a2.329e-1923.12ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b2.722e-1821.06ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b5.154e-1821.20ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank2b5.302e-1822.64ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041... [more]
ank1b5.546e-1821.20ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK27.629e-1723.60ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK27.964e-1723.60ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK29.825e-1723.60ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK21.238e-1623.77ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
ANK21.248e-1623.77ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
back to top
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank36.950e-2022.60ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank37.672e-2022.60ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank38.791e-2022.60ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank39.736e-2022.60ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank31.069e-1922.60ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of RING domain ligase2 isoform 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G5E8K5|ANK3_MOUSE7.646e-1922.60Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|O70511|ANK3_RAT7.970e-1822.90Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
sp|Q12955|ANK3_HUMAN2.352e-1622.50Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
sp|Q8C8R3|ANK2_MOUSE7.599e-1622.83Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV... [more]
sp|Q01484|ANK2_HUMAN3.458e-1522.74Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=... [more]
back to top
BLAST of RING domain ligase2 isoform 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3L8DCQ55.747e-1921.93Uncharacterized protein OS=Ooceraea biroi OX=20151... [more]
W5MI547.623e-1923.41Ankyrin 3a OS=Lepisosteus oculatus OX=7918 PE=4 SV... [more]
A0A1B6CUN01.296e-1825.21Uncharacterized protein (Fragment) OS=Clastoptera ... [more]
Q16FR11.345e-1824.04AAEL014668-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
J9LAT22.208e-1824.17Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
back to top
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1a1.122e-1923.29ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ank3b6.048e-1923.65ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank1b1.617e-1724.71ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank3a9.175e-1722.70ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.465e-1622.70ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000095.13.496e-1623.29pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.14.060e-1523.05pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000009608.12.358e-1221.48pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
ENSPMAT00000007446.16.139e-1120.30pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000003991.11.283e-824.37pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
back to top
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HOS41.001e-633.77Subunit of the Set3 complex; complex is a meiotic-... [more]
SPT235.058e-627.37ER membrane protein involved in regulation of OLE1... [more]
back to top
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO377592.420e-930.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445701.863e-739.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302207.657e-727.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454851.063e-639.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460991.839e-623.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RING domain ligase2 isoform 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000039458.11.807e-1622.16ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000031565.12.004e-1622.16ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ank1b6.708e-1421.59ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ank1a2.512e-1320.69ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
ENSORLT00000038944.12.289e-1221.07tankyrase-1 [Source:NCBI gene;Acc:101158122][more]
back to top
BLAST of RING domain ligase2 isoform 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003596.10.000e+099.44SMESG000003596.1[more]
SMESG000001281.10.000e+057.99SMESG000001281.1[more]
SMESG000002106.10.000e+055.37SMESG000002106.1[more]
SMESG000002106.10.000e+055.44SMESG000002106.1[more]
SMESG000010368.10.000e+054.07SMESG000010368.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026726 ID=SMED30026726|Name=RING domain ligase2 isoform 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2953bp
CTCTAGTTTCGCAATTTTACGTTTTTGTTTTGTTTTACAACTGACAAAGT
GATAAGTTATCAAGATGAGTTACTTTGATATGTTCGTGAGCCACTTGATG
AACGGGAAAACAGAGGAATTACGGAGAACTCTGAGATTAGAATTCGTGAA
TAAACTTATAGATGATAAAGGCCATTTTCCGATTCACATCGCTTGTGAAA
AAGGATTTTTAAATATTGTTATATTATTGCTCAATGAGAACTGCAATATC
GAATGTGAGGACATTTGGGGATATAAACCGATTCATTATGCAACGCTAAA
TGGAAATATTGAAATAGTTAAATTATTGCTTCAACACAAATGTCGAATAG
ATTGCAGAACAAAAGGTTGGTTTGGTCTAACTCCGTTTGACATAGCAAAG
AAGTGGAGCCGAACAGACTGTATTGAATTATTTCATACCGAAAATTTAAT
TGCGGCTATTAAGAAAAATGATCCAATCGAATTTGAGAAATTGTGCAAAT
CTTACGATTTCATGTCGCAGAAACTTCATACTGGATTGACGATTTTGCAA
ACGGCAGCCGACAGCAACGCTGATAAAATTATTAAATGCATTCTTGACAG
ACCTGTTGAAAATAAAGAAATAAATGATTTAATGAAAGAAATTACTGAAG
AAAATGACAAATTGTCAAATTTAACAAAAGAATGCATTCTTTACCGCAGC
ATTATTCACCAACATGCGGCAGGATTCAAAAAATTCATTAACGCAGCCGT
TATTAACGGACCACATAAAATTGCTACTCAGTCATTTCTAGAAATTGCTG
CCGAGCAAGGACATGAGCTGTTTATTGATGGTATAATGAAGAAAACAATT
TATAATAAATCGATATGGGTCAGAGCCATCAAGAAAGCAAAAGATAAAAA
ATTCAAAGAAATACAAGAAGAAATTACGGAAAGAATGAATTTATTTGAAT
CAAGAATAAAAGTGAATTTTACAATTTTACACAGTGCCATCTGCGATAAC
GATACCGACATGGTCAAATACATTCTCGATCATCCGAATAATATTGATCT
AGATTCAAATAATGAAACATTGGGAACTGCTTTAGCATTAGCCCATTCGC
TACATCATAGAAAATGTATCAAAGTATTGCAGCAATACGAACTCGCTACA
AACACACAAAACAAATATTCGCAGACTCCGTTGCATGAAGCTATCGCGAG
TGGATTGGACGATAATTGCGGATATTTGATAAATCGATCAATCAATATTG
ATCAAATTGGATTTTTAGGTTTAACCGGTCTGCACTGTGCTGTGATTAAA
GGAATGGAGAATGTTTGCGAACAAATGGTGAACAACGGTGCTAATTATAT
GAAATTTGTTGAATTAAATTTTTTACAGTTTACGTGTCAATCTTCCGAAA
ATGAAATCACCATTCCATTTGAAAAATCAATAATTGCACTTTCTCTCATG
GAAAATGCTTTGACTTTATCAATAAAATTTCACGGAAAACTCTTTTTATG
TTTTCTTGACAAACTGAATTCAACGACTTCGAATGCACGTGATGGAAATA
ACAATTCTTTGCTTCACATGGCGGTCAAATGTCTGCAGCCGGAATTGTGT
AAATCTCTGCTCGACTCTGGAGCAAAGGTCGACGTTGTCAACAGTAATGG
AAATTCCCCTTTATTTGAAATGTTCTGCAATTCAAATTCCAGAATGACTG
AGGAAAAAGTTAATCGAATGATCGAAATAACAAATATTTTGATTGGCTAT
GGTGCCGATATCAATGTTAAATCAACCAATAGAATCACGATATTTCAATC
CGCATCAAAATTGGAAAATGAAAGAATAATGCTTGCTCTTTTATCTAACA
ATCCGATTTTCAAGAACTTTTCTTCAAAGGATTTCCAGATGGCTTTCGAT
AATCATTGGTTCCAATATGCCGAATGTCTACTCAAGCTTTTATCCGACAG
TTTTCTCGAATCCAATATTACAAATGAAGCCTTTGTTCAATGCAAGACCG
AACCAAATTTGATAAAATTACTCTTCAGCAAATCTAGTTCCAGTTTCCAA
CGAGCCATTATAGAAACTCTTCTTTGGAATGCCATAAGAAAGAACGACAA
AAAATTGTTTGACTTTTTCATCAAAATAGAAATATCTTCTCCCAAACTAT
TCTCAAATGGTGAAAATCTTTTCACACAGATTTTGAAGGTAAGAAAAATT
CATTTCGCATGGAAAGTTTTGGAATCAAAAAATAAAATGAAATTCGTCAA
CTTGAAAAACAAAACAAACCAGACCCCCCTTCAAGTGGCAATTGAAATCG
ACGAGATGGACCTAGTTGACGCGTTGATCCATGAATCAAATGAATTCGAT
TGTGAGGATATTAATGGGAATTCGGTATTAACGCAATTAATTGGGAAAAT
ATCCATTTGCAAAAATGTAAATAGTAAATCGAGGTTGATGGCAGCCATGA
AATCGGCAATCCTCCTCGGAGGGGACATTTATAAGGTTTCCTCATGCGGC
AAGAGGATAATTGATACGTGCACCGACTGCAATGCCAAGTCGGAAATCGA
GAGGTTTCACGGAAATAATCTCAAAAAGAAAGAATATGTCAATGATAAAA
TATGCATAATTTGCATGAATAATACTGTGGACGTCGCCTTCCAATGTGGC
CACTTGGTCTGCTCTGTTTGCGGGAACCGATTATTTGTCTGTCCCGTTTG
TAACAAAGAAATTTCCAATAAAACCAAAATATATTTCAGTTAATTTGGTG
CAAAATTTGCACAATTTGATCACATGTACCGTTTTGATTGATGTTACTAT
TTTTGTGCAATTGATTTTGCAGTTTAAATGACTTGCAATTGCACTGTGCT
ATAGATTTTTTACTTATCAGATCAATATATCGCTTATAATATTAAGGTAA
ACAACTATTTTCGTGCAATTGGTTTTGCAGTCTAAATGACTTGCAATTGC
ACG
back to top

protein sequence of SMED30026726-orf-1

>SMED30026726-orf-1 ID=SMED30026726-orf-1|Name=SMED30026726-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=893bp
MSYFDMFVSHLMNGKTEELRRTLRLEFVNKLIDDKGHFPIHIACEKGFLN
IVILLLNENCNIECEDIWGYKPIHYATLNGNIEIVKLLLQHKCRIDCRTK
GWFGLTPFDIAKKWSRTDCIELFHTENLIAAIKKNDPIEFEKLCKSYDFM
SQKLHTGLTILQTAADSNADKIIKCILDRPVENKEINDLMKEITEENDKL
SNLTKECILYRSIIHQHAAGFKKFINAAVINGPHKIATQSFLEIAAEQGH
ELFIDGIMKKTIYNKSIWVRAIKKAKDKKFKEIQEEITERMNLFESRIKV
NFTILHSAICDNDTDMVKYILDHPNNIDLDSNNETLGTALALAHSLHHRK
CIKVLQQYELATNTQNKYSQTPLHEAIASGLDDNCGYLINRSINIDQIGF
LGLTGLHCAVIKGMENVCEQMVNNGANYMKFVELNFLQFTCQSSENEITI
PFEKSIIALSLMENALTLSIKFHGKLFLCFLDKLNSTTSNARDGNNNSLL
HMAVKCLQPELCKSLLDSGAKVDVVNSNGNSPLFEMFCNSNSRMTEEKVN
RMIEITNILIGYGADINVKSTNRITIFQSASKLENERIMLALLSNNPIFK
NFSSKDFQMAFDNHWFQYAECLLKLLSDSFLESNITNEAFVQCKTEPNLI
KLLFSKSSSSFQRAIIETLLWNAIRKNDKKLFDFFIKIEISSPKLFSNGE
NLFTQILKVRKIHFAWKVLESKNKMKFVNLKNKTNQTPLQVAIEIDEMDL
VDALIHESNEFDCEDINGNSVLTQLIGKISICKNVNSKSRLMAAMKSAIL
LGGDIYKVSSCGKRIIDTCTDCNAKSEIERFHGNNLKKKEYVNDKICIIC
MNNTVDVAFQCGHLVCSVCGNRLFVCPVCNKEISNKTKIYFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016874ligase activity
GO:0005515protein binding
GO:0008270zinc ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000141dorsal region of the whole animal
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 183..206
NoneNo IPR availablePFAMPF13920zf-C3HC4_3coord: 844..884
e-value: 7.2E-8
score: 32.2
NoneNo IPR availablePANTHERPTHR24178FAMILY NOT NAMEDcoord: 156..534
coord: 362..782
coord: 31..123
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 843..885
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 69..84
score: 32.73
coord: 555..569
score: 37.24
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 103..132
e-value: 3600.0
score: 0.9
coord: 528..568
e-value: 7.9
score: 15.4
coord: 368..397
e-value: 1.2
score: 18.1
coord: 401..430
e-value: 5.3
score: 16.0
coord: 495..524
e-value: 0.048
score: 22.8
coord: 35..64
e-value: 0.18
score: 20.9
coord: 68..97
e-value: 6.3E-4
score: 29.1
coord: 300..329
e-value: 0.0077
score: 25.4
coord: 572..601
e-value: 2800.0
score: 1.6
coord: 156..188
e-value: 38.0
score: 13.2
coord: 734..763
e-value: 35.0
score: 13.3
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 68..100
score: 10.793
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 495..527
score: 9.992
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 35..67
score: 9.885
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 11..259
e-value: 1.3E-27
score: 98.8
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 260..454
e-value: 5.5E-22
score: 80.1
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 11..540
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 486..773
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 824..892
e-value: 2.7E-11
score: 44.8
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 305..396
e-value: 9.7E-8
score: 32.5
coord: 40..123
e-value: 9.8E-12
score: 45.3
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 728..772
score: 9.516
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 35..596
score: 29.6
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 847..880
score: 10.527