Zinc finger protein 474

Overview
NameZinc finger protein 474
Smed IDSMED30026699
Length (bp)1110
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger protein 474 (SMED30026699) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger protein 474 (SMED30026699) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger protein 474 (SMED30026699) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger protein 474 (SMED30026699) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026699

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026699SMESG000009204.1 SmedASXL_010837SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30026699SMESG000009204.1 dd_Smed_v4_14765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026699SMESG000009204.1 dd_Smed_v4_14765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026699SMESG000009204.1 dd_Smed_v6_14765_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30026699SMESG000009204.1 OX_Smed_1.0.02382ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026699SMESG000009204.1 dd_Smed_v4_14765_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger protein 474 vs. Ensembl Human
Match: AC010255.3 (zinc finger protein 474-like [Source:NCBI gene;Acc:100505841])

HSP 1 Score: 120.168 bits (300), Expect = 6.286e-33
Identity = 58/101 (57.43%), Postives = 68/101 (67.33%), Query Frame = 3
Query:  783 RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKP--IGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            R+P  V+CYIC RE+G+KSI IHEPQCL+KW  EN+ LPK  RR  P KP    I + G YD    NE AW ++ S L  C  CGRTFLPDRL VH +SCK
Sbjct:    3 RRPPAVVCYICGREYGTKSISIHEPQCLKKWHNENNLLPKELRRPVPKKPEVRTITAKGFYDLDALNEAAWTSAHSQLVPCNVCGRTFLPDRLIVHQRSCK 103          

HSP 2 Score: 112.464 bits (280), Expect = 4.933e-30
Identity = 63/104 (60.58%), Postives = 77/104 (74.04%), Query Frame = 3
Query:  111 IMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            ++ +P +VVCYIC RE+GTKSISIHEPQCL+KW  EN+ LPK  RRP PKKP+   +     Y L+  N+ A+ SA S L+PC  CGRTFLPDRL VHQRSC+P
Sbjct:    1 MIRRPPAVVCYICGREYGTKSISIHEPQCLKKWHNENNLLPKELRRPVPKKPEVRTITAKGFYDLDALNEAAWTSAHSQLVPCNVCGRTFLPDRLIVHQRSCKP 104          
BLAST of Zinc finger protein 474 vs. Ensembl Human
Match: ZNF474 (zinc finger protein 474 [Source:HGNC Symbol;Acc:HGNC:23245])

HSP 1 Score: 119.013 bits (297), Expect = 9.815e-30
Identity = 59/99 (59.60%), Postives = 73/99 (73.74%), Query Frame = 3
Query:  783 RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            R+P   +CYIC REFGS+SI IHEPQCL+KW IEN KLPK  RR EP KP  + SSG+Y     NE A++++Q+ L  C++CGRTFLPD L VH +SCK
Sbjct:   90 RRPGFRVCYICGREFGSQSIAIHEPQCLQKWHIENSKLPKHLRRPEPSKPQSLSSSGSYSLQATNEAAFQSAQAQLLPCESCGRTFLPDHLLVHHRSCK 188          

HSP 2 Score: 104.375 bits (259), Expect = 1.516e-24
Identity = 64/101 (63.37%), Postives = 78/101 (77.23%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            +P   VCYIC REFG++SI+IHEPQCLQKW IENS+LPK+ RRP P KPQ L      SY L+  N+ A++SAQ+ L+PCE+CGRTFLPD L VH RSC+P
Sbjct:   91 RPGFRVCYICGREFGSQSIAIHEPQCLQKWHIENSKLPKHLRRPEPSKPQSLS--SSGSYSLQATNEAAFQSAQAQLLPCESCGRTFLPDHLLVHHRSCKP 189          

HSP 3 Score: 88.1965 bits (217), Expect = 8.069e-19
Identity = 46/100 (46.00%), Postives = 60/100 (60.00%), Query Frame = 3
Query:  780 PRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            P +P+TVICYIC +EFG+ S+PIHEP+CLEKW++END+LP          P       N  SS+        +Q+ L  C +C R F  DRL VH +SCK
Sbjct:  216 PARPRTVICYICGKEFGTLSLPIHEPKCLEKWKMENDRLPV---ELHQPLPQKPQPLPNAQSSQAG-----PNQAQLVFCPHCSRIFTSDRLLVHQRSCK 307          

HSP 4 Score: 71.633 bits (174), Expect = 2.936e-13
Identity = 40/102 (39.22%), Postives = 58/102 (56.86%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSA--QSNLIPCENCGRTFLPDRLPVHQRSCR 419
            +P +V+CYIC +EFGT S+ IHEP+CL+KW++EN +LP    +P                     N  + ++   Q+ L+ C +C R F  DRL VHQRSC+
Sbjct:  218 RPRTVICYICGKEFGTLSLPIHEPKCLEKWKMENDRLPVELHQPL------------PQKPQPLPNAQSSQAGPNQAQLVFCPHCSRIFTSDRLLVHQRSCK 307          
BLAST of Zinc finger protein 474 vs. Ensembl Human
Match: AC010255.3 (zinc finger protein 474-like [Source:NCBI gene;Acc:100505841])

HSP 1 Score: 69.707 bits (169), Expect = 9.092e-15
Identity = 32/50 (64.00%), Postives = 38/50 (76.00%), Query Frame = 3
Query:  783 RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKP 932
            R+P  V+CYIC RE+G+KSI IHEPQCL+KW  EN+ LPK  RR  P KP
Sbjct:    3 RRPPAVVCYICGREYGTKSISIHEPQCLKKWHNENNLLPKELRRPVPKKP 52          

HSP 2 Score: 61.6178 bits (148), Expect = 6.483e-12
Identity = 26/38 (68.42%), Postives = 33/38 (86.84%), Query Frame = 3
Query:  111 IMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENS 224
            ++ +P +VVCYIC RE+GTKSISIHEPQCL+KW  EN+
Sbjct:    1 MIRRPPAVVCYICGREYGTKSISIHEPQCLKKWHNENN 38          
BLAST of Zinc finger protein 474 vs. Ensembl Celegans
Match: M153.4 (pep chromosome:WBcel235:X:12149953:12151474:1 gene:WBGene00044144.1 transcript:M153.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M153.4)

HSP 1 Score: 117.857 bits (294), Expect = 3.484e-32
Identity = 55/105 (52.38%), Postives = 70/105 (66.67%), Query Frame = 3
Query:  768 APPEPRKPQ-TVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMS-SGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSC 1076
             PP   K   TV C+IC R+FGSKSI IHEPQCL+KW  EN+KLPK +RR  PVKP  ++   G  D+   NE  WK +Q  + +C++CGR F  DRL+VH +SC
Sbjct:    7 GPPRATKSAPTVFCFICGRQFGSKSIAIHEPQCLKKWHAENEKLPKSKRRAAPVKPEAVIGDDGRLDAEATNEVLWKNAQGLMVECEHCGRKFNEDRLSVHQRSC 111          

HSP 2 Score: 90.1225 bits (222), Expect = 8.000e-22
Identity = 43/96 (44.79%), Postives = 58/96 (60.42%), Query Frame = 3
Query:  129 SVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSC 416
            +V C+IC R+FG+KSI+IHEPQCL+KW  EN       +R          +G       E  N++ +K+AQ  ++ CE+CGR F  DRL VHQRSC
Sbjct:   17 TVFCFICGRQFGSKSIAIHEPQCLKKWHAENE-KLPKSKRRAAPVKPEAVIGDDGRLDAEATNEVLWKNAQGLMVECEHCGRKFNEDRLSVHQRSC 111          
BLAST of Zinc finger protein 474 vs. Ensembl Xenopus
Match: ncf2 (neutrophil cytosolic factor 2 [Source:Xenbase;Acc:XB-GENE-482959])

HSP 1 Score: 228.409 bits (581), Expect = 1.462e-70
Identity = 160/368 (43.48%), Postives = 210/368 (57.07%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP-GHVLNPLPN----------KKENSVTNV------TRPDTVTL--------SKSTVLD----LKKIEVMNTSEPVA----VSKTQTVQPYQCSS---CNENLPQSCKF----CPFCGQSNSSKAKVLD------TSKRPDPNTTNDKNRRKSGNELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKP--IGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            +P   VCYIC REFG+KSI+IHEP+CL+KW IEN  LPK+ RR  P KPQ    G G +      N+ A+KS+Q+ L+PC NCGRTFLPDRL VHQRSC+  G  +  L            K E+  +N       T+P T+          +KS  +     L+K ++ N   P      V +   + P + +S    NE   QS K     CP CG+S +S    +       TS R +    N+  ++K+G   EK+VK P   ++P TV+CYIC REFG+KSI IHEPQCL+KW +END+LPK  RR EP KP    I + G+YD    N+ AW+++QS L  C  CGRTFLPDRL VH +SCK
Sbjct:   59 RPGFKVCYICGREFGSKSIAIHEPKCLEKWHIENDNLPKHLRRAAPVKPQITADGSGIAE-----NEAAWKSSQAQLLPCGNCGRTFLPDRLLVHQRSCKSDGKTVGTLKTTDDKKSSATIKTESEFSNTKDLAGPTKPKTLICYICGREFGTKSLPIHEPKCLEKWKIENDRLPKGQRRPVPQKPQLDPSKVTSRKEQNEAAWQSFKDQLLKCPNCGRSFASDRLPVHQKGCKVTSDRKEATKANNALKQKNGT-TEKNVKQPQVLKQPPTVVCYICGREFGTKSISIHEPQCLQKWNLENDRLPKNLRRPEPKKPEVRSIGAKGSYDLVSLNKAAWQSAQSQLVACDICGRTFLPDRLLVHQRSCK 420          

HSP 2 Score: 128.257 bits (321), Expect = 8.376e-33
Identity = 63/99 (63.64%), Postives = 72/99 (72.73%), Query Frame = 3
Query:  783 RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            R+P   +CYIC REFGSKSI IHEP+CLEKW IEND LPK  RR  PVKP  I + G+  +   NE AWK+SQ+ L  C NCGRTFLPDRL VH +SCK
Sbjct:   58 RRPGFKVCYICGREFGSKSIAIHEPKCLEKWHIENDNLPKHLRRAAPVKP-QITADGSGIAE--NEAAWKSSQAQLLPCGNCGRTFLPDRLLVHQRSCK 153          

HSP 3 Score: 124.02 bits (310), Expect = 3.677e-31
Identity = 68/104 (65.38%), Postives = 81/104 (77.88%), Query Frame = 3
Query:  111 IMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            ++ +P +VVCYIC REFGTKSISIHEPQCLQKW +EN +LPKN RRP PKKP+   +G   SY L   N  A++SAQS L+ C+ CGRTFLPDRL VHQRSC+P
Sbjct:  318 VLKQPPTVVCYICGREFGTKSISIHEPQCLQKWNLENDRLPKNLRRPEPKKPEVRSIGAKGSYDLVSLNKAAWQSAQSQLVACDICGRTFLPDRLLVHQRSCKP 421          
BLAST of Zinc finger protein 474 vs. Ensembl Mouse
Match: 1700034E13Rik (RIKEN cDNA 1700034E13 gene [Source:MGI Symbol;Acc:MGI:1925664])

HSP 1 Score: 125.561 bits (314), Expect = 4.681e-35
Identity = 60/101 (59.41%), Postives = 71/101 (70.30%), Query Frame = 3
Query:  783 RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKP--IGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            R+P T++CYIC RE+G+KSI IHEPQCL+KW  EN+ LPK  RR EP KP    I + G YD    NE AW ++QS L  C  CGRTFLPDRL VH +SCK
Sbjct:    3 RRPPTIVCYICGREYGTKSISIHEPQCLKKWHNENNLLPKELRRPEPKKPEVRTITAKGFYDLDALNEAAWTSAQSQLVPCNVCGRTFLPDRLIVHQRSCK 103          

HSP 2 Score: 113.62 bits (283), Expect = 1.279e-30
Identity = 63/104 (60.58%), Postives = 78/104 (75.00%), Query Frame = 3
Query:  111 IMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            ++ +P ++VCYIC RE+GTKSISIHEPQCL+KW  EN+ LPK  RRP PKKP+   +     Y L+  N+ A+ SAQS L+PC  CGRTFLPDRL VHQRSC+P
Sbjct:    1 MIRRPPTIVCYICGREYGTKSISIHEPQCLKKWHNENNLLPKELRRPEPKKPEVRTITAKGFYDLDALNEAAWTSAQSQLVPCNVCGRTFLPDRLIVHQRSCKP 104          
BLAST of Zinc finger protein 474 vs. Ensembl Mouse
Match: 1700034E13Rik (RIKEN cDNA 1700034E13 gene [Source:MGI Symbol;Acc:MGI:1925664])

HSP 1 Score: 125.561 bits (314), Expect = 4.681e-35
Identity = 60/101 (59.41%), Postives = 71/101 (70.30%), Query Frame = 3
Query:  783 RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKP--IGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            R+P T++CYIC RE+G+KSI IHEPQCL+KW  EN+ LPK  RR EP KP    I + G YD    NE AW ++QS L  C  CGRTFLPDRL VH +SCK
Sbjct:    3 RRPPTIVCYICGREYGTKSISIHEPQCLKKWHNENNLLPKELRRPEPKKPEVRTITAKGFYDLDALNEAAWTSAQSQLVPCNVCGRTFLPDRLIVHQRSCK 103          

HSP 2 Score: 113.62 bits (283), Expect = 1.279e-30
Identity = 63/104 (60.58%), Postives = 78/104 (75.00%), Query Frame = 3
Query:  111 IMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            ++ +P ++VCYIC RE+GTKSISIHEPQCL+KW  EN+ LPK  RRP PKKP+   +     Y L+  N+ A+ SAQS L+PC  CGRTFLPDRL VHQRSC+P
Sbjct:    1 MIRRPPTIVCYICGREYGTKSISIHEPQCLKKWHNENNLLPKELRRPEPKKPEVRTITAKGFYDLDALNEAAWTSAQSQLVPCNVCGRTFLPDRLIVHQRSCKP 104          
BLAST of Zinc finger protein 474 vs. Ensembl Mouse
Match: Zfp474 (zinc finger protein 474 [Source:MGI Symbol;Acc:MGI:1914008])

HSP 1 Score: 130.568 bits (327), Expect = 2.789e-34
Identity = 60/99 (60.61%), Postives = 73/99 (73.74%), Query Frame = 3
Query:  783 RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            R+P   ICYIC REFGS+S+ IHEPQCLEKWR EN KLPK  RR EP KP  I  + ++     NEEA++++Q+ L  C+NCGRTFLPDRL VH +SCK
Sbjct:   87 RRPGFRICYICGREFGSQSLAIHEPQCLEKWRTENSKLPKHLRRPEPSKPQPIGGTDSHSLQAANEEAFQSAQAQLLPCENCGRTFLPDRLLVHQRSCK 185          

HSP 2 Score: 114.39 bits (285), Expect = 1.954e-28
Identity = 63/101 (62.38%), Postives = 81/101 (80.20%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            +P   +CYIC REFG++S++IHEPQCL+KW  ENS+LPK+ RRP P KPQP  +G   S+ L+  N+ A++SAQ+ L+PCENCGRTFLPDRL VHQRSC+P
Sbjct:   88 RPGFRICYICGREFGSQSLAIHEPQCLEKWRTENSKLPKHLRRPEPSKPQP--IGGTDSHSLQAANEEAFQSAQAQLLPCENCGRTFLPDRLLVHQRSCKP 186          

HSP 3 Score: 103.99 bits (258), Expect = 1.164e-24
Identity = 51/100 (51.00%), Postives = 67/100 (67.00%), Query Frame = 3
Query:  780 PRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            P +P+T+ICYIC REFG+ S+PIHEP+CLEKW+IEND+LP+  RR +              + + ++E   ASQ+ L  C NCGRTF  DRL VH +SCK
Sbjct:  213 PARPRTLICYICGREFGTLSLPIHEPKCLEKWKIENDQLPRELRRPQ------PQKPQPLPAGQSSQEG--ASQAALVPCPNCGRTFAVDRLPVHQRSCK 304          

HSP 4 Score: 91.6633 bits (226), Expect = 3.050e-20
Identity = 57/104 (54.81%), Postives = 72/104 (69.23%), Query Frame = 3
Query:  108 SIMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCR 419
             I  +P +++CYIC REFGT S+ IHEP+CL+KW+IEN QLP+  RRP P+KPQPLP G                ++Q+ L+PC NCGRTF  DRLPVHQRSC+
Sbjct:  211 GIPARPRTLICYICGREFGTLSLPIHEPKCLEKWKIENDQLPRELRRPQPQKPQPLPAG----------QSSQEGASQAALVPCPNCGRTFAVDRLPVHQRSCK 304          
BLAST of Zinc finger protein 474 vs. Ensembl Mouse
Match: Zfp474 (zinc finger protein 474 [Source:MGI Symbol;Acc:MGI:1914008])

HSP 1 Score: 130.568 bits (327), Expect = 2.789e-34
Identity = 60/99 (60.61%), Postives = 73/99 (73.74%), Query Frame = 3
Query:  783 RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            R+P   ICYIC REFGS+S+ IHEPQCLEKWR EN KLPK  RR EP KP  I  + ++     NEEA++++Q+ L  C+NCGRTFLPDRL VH +SCK
Sbjct:   87 RRPGFRICYICGREFGSQSLAIHEPQCLEKWRTENSKLPKHLRRPEPSKPQPIGGTDSHSLQAANEEAFQSAQAQLLPCENCGRTFLPDRLLVHQRSCK 185          

HSP 2 Score: 114.39 bits (285), Expect = 1.954e-28
Identity = 63/101 (62.38%), Postives = 81/101 (80.20%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            +P   +CYIC REFG++S++IHEPQCL+KW  ENS+LPK+ RRP P KPQP  +G   S+ L+  N+ A++SAQ+ L+PCENCGRTFLPDRL VHQRSC+P
Sbjct:   88 RPGFRICYICGREFGSQSLAIHEPQCLEKWRTENSKLPKHLRRPEPSKPQP--IGGTDSHSLQAANEEAFQSAQAQLLPCENCGRTFLPDRLLVHQRSCKP 186          

HSP 3 Score: 103.99 bits (258), Expect = 1.164e-24
Identity = 51/100 (51.00%), Postives = 67/100 (67.00%), Query Frame = 3
Query:  780 PRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            P +P+T+ICYIC REFG+ S+PIHEP+CLEKW+IEND+LP+  RR +              + + ++E   ASQ+ L  C NCGRTF  DRL VH +SCK
Sbjct:  213 PARPRTLICYICGREFGTLSLPIHEPKCLEKWKIENDQLPRELRRPQ------PQKPQPLPAGQSSQEG--ASQAALVPCPNCGRTFAVDRLPVHQRSCK 304          

HSP 4 Score: 91.6633 bits (226), Expect = 3.050e-20
Identity = 57/104 (54.81%), Postives = 72/104 (69.23%), Query Frame = 3
Query:  108 SIMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCR 419
             I  +P +++CYIC REFGT S+ IHEP+CL+KW+IEN QLP+  RRP P+KPQPLP G                ++Q+ L+PC NCGRTF  DRLPVHQRSC+
Sbjct:  211 GIPARPRTLICYICGREFGTLSLPIHEPKCLEKWKIENDQLPRELRRPQPQKPQPLPAG----------QSSQEGASQAALVPCPNCGRTFAVDRLPVHQRSCK 304          
BLAST of Zinc finger protein 474 vs. UniProt/SwissProt
Match: sp|A6QQM4|ZN474_BOVIN (Zinc finger protein 474 OS=Bos taurus OX=9913 GN=ZNF474 PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.111e-62
Identity = 155/364 (42.58%), Postives = 203/364 (55.77%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRPGHVLNP----------LPNKKENSVTNVTRPDTV----------TLSKSTVLD--LKKIEVMNTSEPVAVSK--TQTVQPYQCSSCNENLPQSCKF--CPFCGQSNS-SKAKVLDTSKRPDPNTTNDKN---------RRKSGNELEKSVKAPP---EP---RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKP--IGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            +P   VCYIC REFG++S+ IHEPQCL+KW +ENS+LPK+ RRP P KP P   G G SY L+  N+ A++S+Q+ L+PCE CGRTFLPDRL VHQRSC+   V  P          L   K+ S    TRP TV          TLS        L+K +V N   P    +   Q  QP          P+  +   CP C Q+ +  +  V   S +  P+    ++         +  +  + ++++ APP   +P   R+P T++CYIC RE+G+KSI IHEPQCL+KW  EN+ LPK  RR EP KP    I + G YD    NE AW ++QS L  C  CGRTFLPDRL VH +SCK
Sbjct:   89 RPGFRVCYICGREFGSQSLGIHEPQCLEKWRVENSKLPKHLRRPEPSKPPPFS-GSG-SYSLQAANEAAFQSSQAQLLPCETCGRTFLPDRLLVHQRSCK-QKVEGPRAPSLDRSDDLAGLKKVSSGITTRPRTVICYICGREFGTLSLPIHEPKCLEKWKVENDRLPREFRQPLPQKPQPLLTGQPKHAGPRQGQLVSCPNCSQTFAPDRLPVHQRSCKAQPSGPKVQDLTLGSRGGLKESTNPKPQRNMAAPPVTDKPKMIRRPPTIVCYICGREYGTKSIAIHEPQCLKKWHNENNLLPKELRRPEPKKPEVRTITAKGFYDLDALNEAAWTSAQSQLVPCNICGRTFLPDRLIVHQRSCK 449          

HSP 2 Score: 130.954 bits (328), Expect = 7.516e-33
Identity = 60/100 (60.00%), Postives = 73/100 (73.00%), Query Frame = 3
Query:  783 RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCKK 1082
            R+P   +CYIC REFGS+S+ IHEPQCLEKWR+EN KLPK  RR EP KP     SG+Y     NE A+++SQ+ L  C+ CGRTFLPDRL VH +SCK+
Sbjct:   88 RRPGFRVCYICGREFGSQSLGIHEPQCLEKWRVENSKLPKHLRRPEPSKPPPFSGSGSYSLQAANEAAFQSSQAQLLPCETCGRTFLPDRLLVHQRSCKQ 187          

HSP 3 Score: 113.62 bits (283), Expect = 1.185e-26
Identity = 62/104 (59.62%), Postives = 78/104 (75.00%), Query Frame = 3
Query:  111 IMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            ++ +P ++VCYIC RE+GTKSI+IHEPQCL+KW  EN+ LPK  RRP PKKP+   +     Y L+  N+ A+ SAQS L+PC  CGRTFLPDRL VHQRSC+P
Sbjct:  347 MIRRPPTIVCYICGREYGTKSIAIHEPQCLKKWHNENNLLPKELRRPEPKKPEVRTITAKGFYDLDALNEAAWTSAQSQLVPCNICGRTFLPDRLIVHQRSCKP 450          

HSP 4 Score: 86.2705 bits (212), Expect = 2.947e-17
Identity = 53/104 (50.96%), Postives = 68/104 (65.38%), Query Frame = 3
Query:  108 SIMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCR 419
             I  +P +V+CYIC REFGT S+ IHEP+CL+KW++EN +LP+  R+P P+KPQPL  G  K               Q  L+ C NC +TF PDRLPVHQRSC+
Sbjct:  212 GITTRPRTVICYICGREFGTLSLPIHEPKCLEKWKVENDRLPREFRQPLPQKPQPLLTGQPKH----------AGPRQGQLVSCPNCSQTFAPDRLPVHQRSCK 305          
BLAST of Zinc finger protein 474 vs. UniProt/SwissProt
Match: sp|Q6V5K9|ZN474_MOUSE (Zinc finger protein 474 OS=Mus musculus OX=10090 GN=Znf474 PE=2 SV=2)

HSP 1 Score: 130.568 bits (327), Expect = 1.951e-33
Identity = 60/99 (60.61%), Postives = 73/99 (73.74%), Query Frame = 3
Query:  783 RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            R+P   ICYIC REFGS+S+ IHEPQCLEKWR EN KLPK  RR EP KP  I  + ++     NEEA++++Q+ L  C+NCGRTFLPDRL VH +SCK
Sbjct:   87 RRPGFRICYICGREFGSQSLAIHEPQCLEKWRTENSKLPKHLRRPEPSKPQPIGGTDSHSLQAANEEAFQSAQAQLLPCENCGRTFLPDRLLVHQRSCK 185          

HSP 2 Score: 114.39 bits (285), Expect = 1.367e-27
Identity = 63/101 (62.38%), Postives = 81/101 (80.20%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            +P   +CYIC REFG++S++IHEPQCL+KW  ENS+LPK+ RRP P KPQP  +G   S+ L+  N+ A++SAQ+ L+PCENCGRTFLPDRL VHQRSC+P
Sbjct:   88 RPGFRICYICGREFGSQSLAIHEPQCLEKWRTENSKLPKHLRRPEPSKPQP--IGGTDSHSLQAANEEAFQSAQAQLLPCENCGRTFLPDRLLVHQRSCKP 186          

HSP 3 Score: 103.99 bits (258), Expect = 8.141e-24
Identity = 51/100 (51.00%), Postives = 67/100 (67.00%), Query Frame = 3
Query:  780 PRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            P +P+T+ICYIC REFG+ S+PIHEP+CLEKW+IEND+LP+  RR +              + + ++E   ASQ+ L  C NCGRTF  DRL VH +SCK
Sbjct:  213 PARPRTLICYICGREFGTLSLPIHEPKCLEKWKIENDQLPRELRRPQ------PQKPQPLPAGQSSQEG--ASQAALVPCPNCGRTFAVDRLPVHQRSCK 304          

HSP 4 Score: 91.6633 bits (226), Expect = 2.134e-19
Identity = 57/104 (54.81%), Postives = 72/104 (69.23%), Query Frame = 3
Query:  108 SIMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCR 419
             I  +P +++CYIC REFGT S+ IHEP+CL+KW+IEN QLP+  RRP P+KPQPLP G                ++Q+ L+PC NCGRTF  DRLPVHQRSC+
Sbjct:  211 GIPARPRTLICYICGREFGTLSLPIHEPKCLEKWKIENDQLPRELRRPQPQKPQPLPAG----------QSSQEGASQAALVPCPNCGRTFAVDRLPVHQRSCK 304          
BLAST of Zinc finger protein 474 vs. UniProt/SwissProt
Match: sp|Q6S9Z5|ZN474_HUMAN (Zinc finger protein 474 OS=Homo sapiens OX=9606 GN=ZNF474 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 4.713e-29
Identity = 59/99 (59.60%), Postives = 73/99 (73.74%), Query Frame = 3
Query:  783 RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            R+P   +CYIC REFGS+SI IHEPQCL+KW IEN KLPK  RR EP KP  + SSG+Y     NE A++++Q+ L  C++CGRTFLPD L VH +SCK
Sbjct:   90 RRPGFRVCYICGREFGSQSIAIHEPQCLQKWHIENSKLPKHLRRPEPSKPQSLSSSGSYSLQATNEAAFQSAQAQLLPCESCGRTFLPDHLLVHHRSCK 188          

HSP 2 Score: 104.375 bits (259), Expect = 7.282e-24
Identity = 64/101 (63.37%), Postives = 78/101 (77.23%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            +P   VCYIC REFG++SI+IHEPQCLQKW IENS+LPK+ RRP P KPQ L      SY L+  N+ A++SAQ+ L+PCE+CGRTFLPD L VH RSC+P
Sbjct:   91 RPGFRVCYICGREFGSQSIAIHEPQCLQKWHIENSKLPKHLRRPEPSKPQSLS--SSGSYSLQATNEAAFQSAQAQLLPCESCGRTFLPDHLLVHHRSCKP 189          

HSP 3 Score: 88.1965 bits (217), Expect = 3.875e-18
Identity = 46/100 (46.00%), Postives = 60/100 (60.00%), Query Frame = 3
Query:  780 PRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            P +P+TVICYIC +EFG+ S+PIHEP+CLEKW++END+LP          P       N  SS+        +Q+ L  C +C R F  DRL VH +SCK
Sbjct:  216 PARPRTVICYICGKEFGTLSLPIHEPKCLEKWKMENDRLPV---ELHQPLPQKPQPLPNAQSSQAG-----PNQAQLVFCPHCSRIFTSDRLLVHQRSCK 307          

HSP 4 Score: 71.633 bits (174), Expect = 1.410e-12
Identity = 40/102 (39.22%), Postives = 58/102 (56.86%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSA--QSNLIPCENCGRTFLPDRLPVHQRSCR 419
            +P +V+CYIC +EFGT S+ IHEP+CL+KW++EN +LP    +P                     N  + ++   Q+ L+ C +C R F  DRL VHQRSC+
Sbjct:  218 RPRTVICYICGKEFGTLSLPIHEPKCLEKWKMENDRLPVELHQPL------------PQKPQPLPNAQSSQAGPNQAQLVFCPHCSRIFTSDRLLVHQRSCK 307          
BLAST of Zinc finger protein 474 vs. UniProt/SwissProt
Match: sp|Q4R8T4|ZN474_MACFA (Zinc finger protein 474 OS=Macaca fascicularis OX=9541 GN=ZNF474 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 5.059e-29
Identity = 58/99 (58.59%), Postives = 72/99 (72.73%), Query Frame = 3
Query:  783 RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            R+P   +CYIC REFGS+SI IHEPQCL+KW IEN KLPK  RR EP KP  +  SG+Y     NE A++++Q+ L  C++CGRTFLPD L VH +SCK
Sbjct:   90 RRPGFRVCYICGREFGSQSIAIHEPQCLQKWHIENSKLPKHLRRPEPSKPQSLSGSGSYSLQASNEAAFQSAQAQLLPCESCGRTFLPDNLLVHQRSCK 188          

HSP 2 Score: 106.686 bits (265), Expect = 1.224e-24
Identity = 65/101 (64.36%), Postives = 79/101 (78.22%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            +P   VCYIC REFG++SI+IHEPQCLQKW IENS+LPK+ RRP P KPQ L      SY L+  N+ A++SAQ+ L+PCE+CGRTFLPD L VHQRSC+P
Sbjct:   91 RPGFRVCYICGREFGSQSIAIHEPQCLQKWHIENSKLPKHLRRPEPSKPQSLS--GSGSYSLQASNEAAFQSAQAQLLPCESCGRTFLPDNLLVHQRSCKP 189          

HSP 3 Score: 99.3673 bits (246), Expect = 5.112e-22
Identity = 49/100 (49.00%), Postives = 64/100 (64.00%), Query Frame = 3
Query:  780 PRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            P +P+TVICYIC REFG+ S+PIHEP+CLEKW+IEND+LP    +  P KP  + ++ +  +          SQ+ L  C NC  TF  DRL VH +SCK
Sbjct:  216 PARPRTVICYICGREFGTLSLPIHEPKCLEKWKIENDRLPVELHQPLPRKPQPLPTAQSSQAG--------PSQAQLVSCPNCSLTFTSDRLLVHQRSCK 307          

HSP 4 Score: 79.337 bits (194), Expect = 3.630e-15
Identity = 45/100 (45.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCR 419
            +P +V+CYIC REFGT S+ IHEP+CL+KW+IEN +LP    +P P+          K   L          +Q+ L+ C NC  TF  DRL VHQRSC+
Sbjct:  218 RPRTVICYICGREFGTLSLPIHEPKCLEKWKIENDRLPVELHQPLPR----------KPQPLPTAQSSQAGPSQAQLVSCPNCSLTFTSDRLLVHQRSCK 307          
BLAST of Zinc finger protein 474 vs. TrEMBL
Match: A0A2T7NFR4 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_20466 PE=4 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 2.870e-74
Identity = 152/337 (45.10%), Postives = 199/337 (59.05%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRPGHVLNPL-------PNKKENSVTNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVAVSKTQTVQPYQCSSCNENLPQSCKFCPFCGQSNSSKAKVLDTSKRPDPNTTNDKNRRKSGNELEK--------SVKAPPEPRK--PQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            +P +V+CYIC REFG++S+SIHE QCL+KW  EN +LPK QRR PP KP+ LP   GK      +N++A++SAQ+NL+ C+NCGRTF PDRL VHQRSC+PG V +PL          KEN      R  T  LS   VL+ K+I+                                      G S+S  +K  +++  P   T   +   KS + +E+            PPEPR   P+ V+CYIC R+FG+KSI IHEPQCLEKW++ENDKLP GQRR  P KP G+ + G+YD +  NE AW+++Q+NL  C NCGRTF PDRL VHL++CK
Sbjct:    4 RPPTVICYICGREFGSRSVSIHEAQCLKKWHAENDRLPKRQRRQPPVKPEILPSINGKGDDTSRFNELAWQSAQANLVECKNCGRTFQPDRLLVHQRSCKPGKVPSPLKKPGDVGSGSKENDPGIANRAVTAVLSGPKVLN-KRIDPD----------------------------------LAGNSHSPASKNTNSNNSPSLRTVRQQGTPKSSSGMERQGTYTSLNQTGPPPEPRASGPRFVLCYICGRQFGTKSIDIHEPQCLEKWKVENDKLPPGQRRPLPKKPEGLAAGGSYDINAMNEAAWQSAQANLVPCPNCGRTFNPDRLAVHLRACK 305          

HSP 2 Score: 137.502 bits (345), Expect = 3.408e-32
Identity = 109/335 (32.54%), Postives = 137/335 (40.90%), Query Frame = 3
Query:  132 VVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYN-DMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCR----------PGHVLNPLPNKKE--NSVTNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVAVSKTQTVQPYQCSSCNENLPQSCKFCPFCGQSNSSKAKVLDTSKRPDPNTTNDKNRRKSGNELEKSVKAPPEP----RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKP--IGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            V C  C R F    +++H   C  K                           G S   + Y  D    S     + C  CGR F    LP+H+  C           P     PLP K +   S + +TR                 E MN     A  ++   Q   CS+C                  S +  V   + +P P T+       S      S   P       R+P TV+CYIC REFG+KSI IHEPQCL+KW  EN++LP   RR EP KP    I +SG YD    NE AW+++QSNL  C  CGRTFLPDRL VH +SCK
Sbjct:  283 VPCPNCGRTFNPDRLAVHLRACKPKAGGSGISNATGLSPKGGAAVTSSGSREGLSSSSDQYPPDEPSPSKGPRTVVCYICGREFGTKSLPIHEPQCLEKWKIENSKLPKESRRPLPKKPQVLGSGSGMTR-----------------EQMNE----AAWESAQGQLVPCSNCGRTF-------------ASDRLPVHQRACKPKPGTSGRLGGTTSKTSDLGSSSPPASSTQVIRRPPTVVCYICGREFGTKSISIHEPQCLQKWHNENNQLPPKMRRPEPKKPEVRSIGASGKYDFDAMNEAAWQSAQSNLVPCDICGRTFLPDRLIVHQRSCK 583          

HSP 3 Score: 125.561 bits (314), Expect = 5.480e-28
Identity = 67/104 (64.42%), Postives = 81/104 (77.88%), Query Frame = 3
Query:  111 IMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            ++ +P +VVCYIC REFGTKSISIHEPQCLQKW  EN+QLP   RRP PKKP+   +G    Y  +  N+ A++SAQSNL+PC+ CGRTFLPDRL VHQRSC+P
Sbjct:  481 VIRRPPTVVCYICGREFGTKSISIHEPQCLQKWHNENNQLPPKMRRPEPKKPEVRSIGASGKYDFDAMNEAAWQSAQSNLVPCDICGRTFLPDRLIVHQRSCKP 584          

HSP 4 Score: 117.472 bits (293), Expect = 3.920e-25
Identity = 97/252 (38.49%), Postives = 129/252 (51.19%), Query Frame = 3
Query:  123 PVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRPGHVLNPLPNKKENSVTNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVAVSKTQTVQPYQCSS--CNENLPQSCKFCPFCGQSNSSKAKVLDTSKRPDPNTTNDKNRRKSGNELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQCLEK 872
            P  V+CYIC R+FGTKSI IHEPQCL+KW++EN +LP  QRRP PKKP+   +  G SY +   N+ A++SAQ+NL+PC NCGRTF PDRL VH R+C+P    + + N    S         VT S S        +     EP      +TV  Y C      ++LP     C    +     +K+   S+RP P          SG   E+  +A  E  + Q V C  C R F S  +P+H+  C  K
Sbjct:  209 PRFVLCYICGRQFGTKSIDIHEPQCLEKWKVENDKLPPGQRRPLPKKPEG--LAAGGSYDINAMNEAAWQSAQANLVPCPNCGRTFNPDRLAVHLRACKPKAGGSGISNATGLSPKGGA---AVTSSGSREGLSSSSDQYPPDEPSPSKGPRTVVCYICGREFGTKSLPIHEPQC--LEKWKIENSKLPKESRRPLPKKPQVLGS-GSGMTREQMNEAAWESAQGQLVPCSNCGRTFASDRLPVHQRACKPK 452          
BLAST of Zinc finger protein 474 vs. TrEMBL
Match: A0A2C9JJT7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106072942 PE=4 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 2.442e-69
Identity = 155/333 (46.55%), Postives = 199/333 (59.76%), Query Frame = 3
Query:  129 SVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXX-XVGM-GKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRPGHVLNPLPNKKENSVTNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVAVSKTQTVQPYQCSSCNENLPQSCKFC--PFCGQSNSSKAKVLDTSKRP------DPNTTNDKNRRKS------GNELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            ++VCYIC REFG+KSISIHE QCL+KW IENS+LP +QRRP P KPQ L  +G  G + + E +N++A+KSAQ NL  C+NCGRTF PDRL VHQRSC+PG  L PL        + + RP T TLS   VL+L   E ++ S  +  + T T QP        N P+S K+   P   +  +     L+    P           ++ NR+ +         L K+ + PP       + CYIC R+F   SI IHEPQCLEKW+IENDKLP+  RR  P KP  + + G+YD    NE AW+ASQ+NL  C NCGRTF PDRL VHL++CK
Sbjct:    6 TIVCYICGREFGSKSISIHENQCLKKWNIENSKLPPDQRRPTPVKPQLLPAIGKEGATGENERFNELAWKSAQGNLAECDNCGRTFQPDRLSVHQRSCKPGKPLKPL------KQSAILRPGTATLSSPAVLNLD--EAIDVSSKLNDT-TVTSQP--------NPPKSGKYANRPISAKGRTRPNLSLNQGDEPLQINGHSKQGNSEMNRQGTYTAPVQKGPLLKTKRGPP---GSNFIFCYICGRQFTKASIGIHEPQCLEKWKIENDKLPREHRRPLPKKPEILKAGGSYDVEAANEAAWQASQANLVPCPNCGRTFNPDRLQVHLRACK 318          

HSP 2 Score: 224.942 bits (572), Expect = 1.354e-64
Identity = 147/353 (41.64%), Postives = 194/353 (54.96%), Query Frame = 3
Query:  132 VVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRPGHVLNPLPNKKENSVTNVTR-------------PDTVTL--------SKSTVLD----LKKIEVMNTSEPVAVSKTQTVQP-------YQCSSCNENLPQSCKFCPFCGQSNS-SKAKVLDTSKRPDPNTTNDKNRRKSGNELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKP----IGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            + CYIC R+F   SI IHEPQCL+KW+IEN +LP+  RRP PKKP+   +  G SY +E  N+ A++++Q+NL+PC NCGRTF PDRL VH R+C+P     P+     NS+ + +              P TV          +KS  +     L K +  N+  P  + +    +P           +  EN       C  CG+  +  +  V   + +P P   N+ N           VK+ P  R+P T+ICYIC REFGSKSI IHEPQCL+KW IENDKLPK  RR EP KP    +    SG YD    NE AW+++Q+NL  C NCGRTFLPDRL VH +SC+
Sbjct:  225 IFCYICGRQFTKASIGIHEPQCLEKWKIENDKLPREHRRPLPKKPEI--LKAGGSYDVEAANEAAWQASQANLVPCPNCGRTFNPDRLQVHLRACKPKPGSMPIQETNNNSLVDKSNSGSKSREESPQRGPKTVICYICGREFGTKSISIHEPQCLDKWKTQNSQLPKEMRRPVPRKPEGNLTREQMNDAAWENSKNQLVPCQNCGRRFAPDRLTVHQRACKPKPGAGNNNNS-------SAPVKSAPVIRRPPTIICYICGREFGSKSISIHEPQCLQKWHIENDKLPKQMRRPEPRKPEVRAVAGSKSGTYDVDAMNEAAWQSAQANLVPCDNCGRTFLPDRLIVHQRSCR 568          

HSP 3 Score: 126.716 bits (317), Expect = 2.120e-28
Identity = 67/106 (63.21%), Postives = 85/106 (80.19%), Query Frame = 3
Query:  111 IMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKS--YKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            ++ +P +++CYIC REFG+KSISIHEPQCLQKW IEN +LPK  RRP P+KP+   V   KS  Y ++  N+ A++SAQ+NL+PC+NCGRTFLPDRL VHQRSCRP
Sbjct:  464 VIRRPPTIICYICGREFGSKSISIHEPQCLQKWHIENDKLPKQMRRPEPRKPEVRAVAGSKSGTYDVDAMNEAAWQSAQANLVPCDNCGRTFLPDRLIVHQRSCRP 569          

HSP 4 Score: 103.605 bits (257), Expect = 2.047e-20
Identity = 58/100 (58.00%), Postives = 75/100 (75.00%), Query Frame = 3
Query:  123 PVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            P +V+CYIC REFGTKSISIHEPQCL KW+ +NSQLPK  RRP P+KP+        +   E  ND A++++++ L+PC+NCGR F PDRL VHQR+C+P
Sbjct:  353 PKTVICYICGREFGTKSISIHEPQCLDKWKTQNSQLPKEMRRPVPRKPEG-------NLTREQMNDAAWENSKNQLVPCQNCGRRFAPDRLTVHQRACKP 445          
BLAST of Zinc finger protein 474 vs. TrEMBL
Match: A0A5G3K3V8 (Neutrophil cytosolic factor 2 OS=Xenopus tropicalis OX=8364 GN=ncf2 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 2.296e-67
Identity = 160/368 (43.48%), Postives = 210/368 (57.07%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP-GHVLNPLPN----------KKENSVTNV------TRPDTVTL--------SKSTVLD----LKKIEVMNTSEPVA----VSKTQTVQPYQCSS---CNENLPQSCKF----CPFCGQSNSSKAKVLD------TSKRPDPNTTNDKNRRKSGNELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKP--IGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            +P   VCYIC REFG+KSI+IHEP+CL+KW IEN  LPK+ RR  P KPQ    G G +      N+ A+KS+Q+ L+PC NCGRTFLPDRL VHQRSC+  G  +  L            K E+  +N       T+P T+          +KS  +     L+K ++ N   P      V +   + P + +S    NE   QS K     CP CG+S +S    +       TS R +    N+  ++K+G   EK+VK P   ++P TV+CYIC REFG+KSI IHEPQCL+KW +END+LPK  RR EP KP    I + G+YD    N+ AW+++QS L  C  CGRTFLPDRL VH +SCK
Sbjct:   59 RPGFKVCYICGREFGSKSIAIHEPKCLEKWHIENDNLPKHLRRAAPVKPQITADGSGIAE-----NEAAWKSSQAQLLPCGNCGRTFLPDRLLVHQRSCKSDGKTVGTLKTTDDKKSSATIKTESEFSNTKDLAGPTKPKTLICYICGREFGTKSLPIHEPKCLEKWKIENDRLPKGQRRPVPQKPQLDPSKVTSRKEQNEAAWQSFKDQLLKCPNCGRSFASDRLPVHQKGCKVTSDRKEATKANNALKQKNGT-TEKNVKQPQVLKQPPTVVCYICGREFGTKSISIHEPQCLQKWNLENDRLPKNLRRPEPKKPEVRSIGAKGSYDLVSLNKAAWQSAQSQLVACDICGRTFLPDRLLVHQRSCK 420          

HSP 2 Score: 128.257 bits (321), Expect = 1.315e-29
Identity = 63/99 (63.64%), Postives = 72/99 (72.73%), Query Frame = 3
Query:  783 RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            R+P   +CYIC REFGSKSI IHEP+CLEKW IEND LPK  RR  PVKP  I + G+  +   NE AWK+SQ+ L  C NCGRTFLPDRL VH +SCK
Sbjct:   58 RRPGFKVCYICGREFGSKSIAIHEPKCLEKWHIENDNLPKHLRRAAPVKP-QITADGSGIAE--NEAAWKSSQAQLLPCGNCGRTFLPDRLLVHQRSCK 153          

HSP 3 Score: 124.02 bits (310), Expect = 5.774e-28
Identity = 68/104 (65.38%), Postives = 81/104 (77.88%), Query Frame = 3
Query:  111 IMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            ++ +P +VVCYIC REFGTKSISIHEPQCLQKW +EN +LPKN RRP PKKP+   +G   SY L   N  A++SAQS L+ C+ CGRTFLPDRL VHQRSC+P
Sbjct:  318 VLKQPPTVVCYICGREFGTKSISIHEPQCLQKWNLENDRLPKNLRRPEPKKPEVRSIGAKGSYDLVSLNKAAWQSAQSQLVACDICGRTFLPDRLLVHQRSCKP 421          
BLAST of Zinc finger protein 474 vs. TrEMBL
Match: A0A1S3JM57 (zinc finger protein 474 OS=Lingula unguis OX=7574 GN=LOC106174468 PE=4 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 5.087e-66
Identity = 157/359 (43.73%), Postives = 197/359 (54.87%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXX-XVGMG-KSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRPGHV--------------------------------LNPLPNKKENSV-----TNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVAVSKTQTVQPYQCSSCNENLPQSCKFCPFCGQSNSSKAKVLDTSKRPDPNTTNDKNRRKSGNELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            +P +VVCYIC REFGT+SISIHEPQCL+KW +EN QLPK+QRRPPP+KPQ L  +G G K Y L+ +N+ AY+SAQ+NL  CENCGRTFLPDRLPVHQRSCRPG+                                 L+P P +K         +NV RP T TL    +L          S P +      +  +  +S                + N  K+  +      DP+T                    P    P+T++CYIC REFGSKS+ IHEPQCLEKW+ ENDKLP+  RR  P KP    +SGN +  + NE A + +QSNLA+C NCGRTF PDRL +H +SCK
Sbjct:    4 RPPAVVCYICGREFGTRSISIHEPQCLKKWNLENQQLPKHQRRPPPQKPQVLPAIGHGNKGYDLDRFNEQAYQSAQNNLAECENCGRTFLPDRLPVHQRSCRPGNSQKPRSTLPSHSRSQTWPEDTGQPRPKSGGHLGLSPRPPQKPTGSGVQGSSNVQRPRTSTLKNPKILKGNSFGEETVSSPSSTGTPPGMNKFSHTSGGGKRLTMNNGTQQTRRDNQPKSAGVPRDGGTDPSTG-------------------PHRGGPRTLVCYICGREFGSKSLSIHEPQCLEKWKAENDKLPRELRRPLPQKP---GTSGNMN--EQNEAARQNAQSNLAECPNCGRTFQPDRLLIHQRSCK 338          

HSP 2 Score: 139.428 bits (350), Expect = 1.111e-32
Identity = 104/284 (36.62%), Postives = 132/284 (46.48%), Query Frame = 3
Query:  282 GMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCR----------PGHVLNPLPNKKENSVTNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVAVSKTQTVQPYQCSSCN-----ENLPQSCKFC-PFCGQSNSSKAKVLDTSKRPDPNTTNDKNRRKSGNELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKP--IGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            G G S     ++D +   A   LI C  CGR F    LP+H+  C           P +    LP K +      TR                 E MN     A  K+       C +C      + LP   + C P  G    S+  V   + +  P T+     R S    E+    PP  R+P TVICYIC RE+GSKSI IHEPQCL+KW +EN++LPK  RR  P KP    +   G YD    NE AW+++Q+NL  C  CGRTFLPDRL VH +SCK
Sbjct:  379 GGGPSTVTNGHSDNSPSRAPKTLI-CYVCGREFGSKSLPIHEPQCLEKWKRENAKLPNNQKKQLPQKPQAGSAGATR-----------------EEMND----AAYKSAQSNLVPCENCGRTFQPDRLPVHQRACRPKTG----SRTPVHMKTAKLGPVTS-----RGSTQNSERPKSKPPAMRRPPTVICYICGREYGSKSISIHEPQCLQKWHMENNQLPKHLRRPVPKKPEVRPVTGKGTYDIDAMNEAAWESAQANLVPCDICGRTFLPDRLLVHKRSCK 631          

HSP 3 Score: 123.25 bits (308), Expect = 4.964e-27
Identity = 63/100 (63.00%), Postives = 80/100 (80.00%), Query Frame = 3
Query:  123 PVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            P +++CY+C REFG+KS+ IHEPQCL+KW+ EN++LP NQ++  P+KPQ    G  +    E+ ND AYKSAQSNL+PCENCGRTF PDRLPVHQR+CRP
Sbjct:  398 PKTLICYVCGREFGSKSLPIHEPQCLEKWKRENAKLPNNQKKQLPQKPQAGSAGATR----EEMNDAAYKSAQSNLVPCENCGRTFQPDRLPVHQRACRP 493          

HSP 4 Score: 119.398 bits (298), Expect = 1.179e-25
Identity = 65/104 (62.50%), Postives = 85/104 (81.73%), Query Frame = 3
Query:  111 IMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
             M +P +V+CYIC RE+G+KSISIHEPQCLQKW +EN+QLPK+ RRP PKKP+  PV    +Y ++  N+ A++SAQ+NL+PC+ CGRTFLPDRL VH+RSC+P
Sbjct:  529 AMRRPPTVICYICGREYGSKSISIHEPQCLQKWHMENNQLPKHLRRPVPKKPEVRPVTGKGTYDIDAMNEAAWESAQANLVPCDICGRTFLPDRLLVHKRSCKP 632          

HSP 5 Score: 103.99 bits (258), Expect = 1.563e-20
Identity = 58/100 (58.00%), Postives = 74/100 (74.00%), Query Frame = 3
Query:  123 PVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            P ++VCYIC REFG+KS+SIHEPQCL+KW+ EN +LP+  RRP P+KP       G S  + + N+ A ++AQSNL  C NCGRTF PDRL +HQRSC+P
Sbjct:  247 PRTLVCYICGREFGSKSLSIHEPQCLEKWKAENDKLPRELRRPLPQKP-------GTSGNMNEQNEAARQNAQSNLAECPNCGRTFQPDRLLIHQRSCKP 339          
BLAST of Zinc finger protein 474 vs. TrEMBL
Match: A0A1S3KGS0 (zinc finger protein 474-like OS=Lingula unguis OX=7574 GN=LOC106181734 PE=4 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 8.557e-66
Identity = 163/361 (45.15%), Postives = 203/361 (56.23%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXX-XVGMG-KSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRPG-------------------------------HV-LNPLPNKKENSV-----TNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVAVSKTQTVQPYQCSSCNENLPQSCKFCPFCGQSNSSKAKVLDTSKRPDPNTTNDKNRRKSGNELEKSVKAPPEPRK--PQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            +P +VVCYIC REFGT+SISIHEPQCL+KW +EN QLPK+QRRPPP+KPQ L  +G G K Y L+ +N+ AY+SAQ+NL  CENCGRTFLPDRLPVHQRSCRPG                               H+ L+P P +K         ++V RP T TL    +L           E  A S + T  P          P   KF      S++S      T       T  D   + +G   +        P +  P+T++CYIC REFGSKS+ IHEPQCLEKW+ ENDKLP+  RR  P KP    +SGN +  + NE A + +QSNLA+C NCGRTF PDRL +H +SCK
Sbjct:    4 RPPAVVCYICGREFGTRSISIHEPQCLKKWNLENQQLPKHQRRPPPQKPQVLPAIGHGNKGYDLDRFNEQAYQSAQNNLAECENCGRTFLPDRLPVHQRSCRPGNSQKPRSTLPSHSRSQTWPEDTGQPRPMSGGHLGLSPRPPQKPTGSGMQGSSSVQRPRTSTLKNPKILKGNSF-----GEETASSPSSTGTP----------PGMNKF------SHTSGGGKRLTMNNGTQQTRRDNQPKSAGVPRDGGTDPSTGPHRGGPRTLVCYICGREFGSKSLSIHEPQCLEKWKAENDKLPRELRRPLPQKP---GTSGNMN--EQNEAARQNAQSNLAECPNCGRTFQPDRLLIHQRSCK 338          

HSP 2 Score: 195.667 bits (496), Expect = 5.049e-53
Identity = 130/319 (40.75%), Postives = 176/319 (55.17%), Query Frame = 3
Query:  123 PVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRPGHVLNPLPNKKENSVTNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVAVSKTQTVQPYQCSSCNENLPQSCKFCPFCGQSNSSKAKVLDTSKRPDPNTTNDKNRRKSGNELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            P ++VCYIC REFG+KS+SIHEPQCL+KW+ EN +LP+  RRP P+KP       G S  + + N+ A ++AQSNL  C NCGRTF PDRL +HQRSC+P          K N+    T       +K++V   + +  MN  +  A   T T +P                                +S    P+T  + +R  S        +AP      +T+ICY+C REFGSKS+PIHEPQCLEKW+ EN KLP  Q+++ P KP     S      + N+ A+K++QSNL  C+NCGRTF PDRL VH ++C+
Sbjct:  247 PRTLVCYICGREFGSKSLSIHEPQCLEKWKAENDKLPRELRRPLPQKP-------GTSGNMNEQNEAARQNAQSNLAECPNCGRTFQPDRLLIHQRSCKP----------KTNTAATGT-----GQNKNSVRANRNLAPMNGLDRGA---TFTAEP--------------------------------SSGGGGPSTVTNGHRDNS------PSRAP------KTLICYVCGREFGSKSLPIHEPQCLEKWKRENAKLPNNQKKQLPQKP--QAGSAGATREEMNDAAYKSAQSNLVPCENCGRTFQPDRLPVHQRACR 494          

HSP 3 Score: 138.658 bits (348), Expect = 2.451e-32
Identity = 103/284 (36.27%), Postives = 131/284 (46.13%), Query Frame = 3
Query:  282 GMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCR----------PGHVLNPLPNKKENSVTNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVAVSKTQTVQPYQCSSCN-----ENLPQSCKFC-PFCGQSNSSKAKVLDTSKRPDPNTTNDKNRRKSGNELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKP--IGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            G G S     + D +   A   LI C  CGR F    LP+H+  C           P +    LP K +      TR                 E MN     A  K+       C +C      + LP   + C P  G    ++  V   + +  P T+     R S    E+    PP  R+P TVICYIC RE+GSKSI IHEPQCL+KW +EN++LPK  RR  P KP    +   G YD    NE AW+++Q+NL  C  CGRTFLPDRL VH +SCK
Sbjct:  381 GGGPSTVTNGHRDNSPSRAPKTLI-CYVCGREFGSKSLPIHEPQCLEKWKRENAKLPNNQKKQLPQKPQAGSAGATR-----------------EEMND----AAYKSAQSNLVPCENCGRTFQPDRLPVHQRACRPKTG----TRTPVHMKTAKLGPVTS-----RGSTQNSERPKSKPPAMRRPPTVICYICGREYGSKSISIHEPQCLQKWHMENNQLPKHLRRPVPKKPEVRPVTGKGTYDIDAMNEAAWESAQANLVPCDICGRTFLPDRLLVHKRSCK 633          

HSP 4 Score: 119.398 bits (298), Expect = 1.019e-25
Identity = 65/104 (62.50%), Postives = 85/104 (81.73%), Query Frame = 3
Query:  111 IMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
             M +P +V+CYIC RE+G+KSISIHEPQCLQKW +EN+QLPK+ RRP PKKP+  PV    +Y ++  N+ A++SAQ+NL+PC+ CGRTFLPDRL VH+RSC+P
Sbjct:  531 AMRRPPTVICYICGREYGSKSISIHEPQCLQKWHMENNQLPKHLRRPVPKKPEVRPVTGKGTYDIDAMNEAAWESAQANLVPCDICGRTFLPDRLLVHKRSCKP 634          

HSP 5 Score: 118.627 bits (296), Expect = 2.134e-25
Identity = 99/256 (38.67%), Postives = 133/256 (51.95%), Query Frame = 3
Query:  123 PVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRPGHVLNPLPNKKENSVTNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVAVSKTQTVQPYQCSSCNENLPQSCKFC-PFCGQ----SNSSKAKVLDTSKRPDPNTTNDKNRRKSGN-ELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQCLEK 872
            P +++CY+C REFG+KS+ IHEPQCL+KW+ EN++LP NQ++  P+KPQ    G  +    E+ ND AYKSAQSNL+PCENCGRTF PDRLPVHQR+CRP          K  + T V    T  L   T     +      S+P A+ +  TV  Y C    E   +S     P C Q     N+   K L   +RP P     +     G  +++   +A  E  +   V C IC R F    + +H+  C  K
Sbjct:  400 PKTLICYVCGREFGSKSLPIHEPQCLEKWKRENAKLPNNQKKQLPQKPQAGSAGATR----EEMNDAAYKSAQSNLVPCENCGRTFQPDRLPVHQRACRP----------KTGTRTPVHM-KTAKLGPVTSRGSTQNSERPKSKPPAMRRPPTVICYICG--REYGSKSISIHEPQCLQKWHMENNQLPKHL---RRPVPKKPEVRPVTGKGTYDIDAMNEAAWESAQANLVPCDICGRTFLPDRLLVHKRSCKPK 635          
BLAST of Zinc finger protein 474 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002107.1 (pep scaffold:Pmarinus_7.0:GL478112:15965:19282:-1 gene:ENSPMAG00000001914.1 transcript:ENSPMAT00000002107.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 210.305 bits (534), Expect = 1.593e-64
Identity = 150/374 (40.11%), Postives = 193/374 (51.60%), Query Frame = 3
Query:  135 VCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXX-XXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQR--------SCRPGHVLNP-----LPNKKENSVTNVTRPDTV------------TLSKSTVLDLKKIEVMNTSEP----------------------VAVSKTQTVQPYQ-----CSSCNENLPQSCKFCPFCGQSNSSKAKVLDTSKRP---DPNTTNDKNRRKSGNELEKSVKAPPEP-RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKP--IGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            VCYIC REFG+KSIS+HEP+CL+KW+IEN +LPK+ RRP P K       G+G +      ND+A++SAQ+ L+ C+NCGRTFLPDRL +HQR        + + G    P        +K +S   + +P T+            +LS      L+K +  N   P                      +AVS     + ++     CS+C        KF P   Q +    KV      P    P  +     +     +  ++K  P+  RKPQTVICYIC REFG+KSI IHEPQC  KW IENDKLPK  RR EP KP    I SSG YD    N  AW++SQ  L  C  CGRTFLPDRL VH ++CK
Sbjct:   60 VCYICGREFGSKSISLHEPKCLEKWQIENEKLPKHLRRPEPHKPNTDTKSGVGAA------NDLAWQSAQAQLVACDNCGRTFLPDRLAIHQRSCFKSKEIAAKDGGRRGPSLSRGATFRKPSSTITIWKPRTLICYICGREFGTKSLSIHEPQCLEKWKNENDRLPRELRRPVPKKPLVAQAGGGTGAIAVSNEAAWESFKGQLVPCSNCGR------KFAPDRLQVHQRSCKVKGPGASPASTGPGASAAVQVKLPLYAVATAIKTQPKVIRKPQTVICYICGREFGTKSISIHEPQCFTKWHIENDKLPKNMRRPEPKKPEVALIKSSGTYDLEAANAAAWQSSQGQLVPCPVCGRTFLPDRLAVHQRACK 421          

HSP 2 Score: 122.094 bits (305), Expect = 1.865e-31
Identity = 58/101 (57.43%), Postives = 71/101 (70.30%), Query Frame = 3
Query:  780 PRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCKK 1082
            PR+    +CYIC REFGSKSI +HEP+CLEKW+IEN+KLPK  RR EP KP     SG       N+ AW+++Q+ L  C NCGRTFLPDRL +H +SC K
Sbjct:   53 PRRSAMRVCYICGREFGSKSISLHEPKCLEKWQIENEKLPKHLRRPEPHKPNTDTKSG---VGAANDLAWQSAQAQLVACDNCGRTFLPDRLAIHQRSCFK 150          

HSP 3 Score: 117.857 bits (294), Expect = 5.330e-30
Identity = 64/104 (61.54%), Postives = 78/104 (75.00%), Query Frame = 3
Query:  111 IMPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            ++ KP +V+CYIC REFGTKSISIHEPQC  KW IEN +LPKN RRP PKKP+   +    +Y LE  N  A++S+Q  L+PC  CGRTFLPDRL VHQR+C+P
Sbjct:  319 VIRKPQTVICYICGREFGTKSISIHEPQCFTKWHIENDKLPKNMRRPEPKKPEVALIKSSGTYDLEAANAAAWQSSQGQLVPCPVCGRTFLPDRLAVHQRACKP 422          

HSP 4 Score: 113.235 bits (282), Expect = 2.568e-28
Identity = 90/255 (35.29%), Postives = 131/255 (51.37%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRPGHVLNPLPNKKENSVTNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVAVSKTQTVQPYQCS------SCNENLPQSCKFCPFCGQSNSSKAKVLDTSKRPDPNTTNDKNRRKSGN-ELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQC 863
            KP +++CYIC REFGTKS+SIHEPQCL+KW+ EN +LP+  RRP PKKP     G G +  +   N+ A++S +  L+PC NCGR F PDRL VHQRSC+          K   +    T P   + +    L L  +     ++P  + K QTV  Y C       S + + PQ   F  +  +++    K+    +RP+P        + SG  +LE +  A  +  + Q V C +C R F    + +H+  C
Sbjct:  183 KPRTLICYICGREFGTKSLSIHEPQCLEKWKNENDRLPRELRRPVPKKPLVAQAG-GGTGAIAVSNEAAWESFKGQLVPCSNCGRKFAPDRLQVHQRSCK---------VKGPGASPASTGPG-ASAAVQVKLPLYAVATAIKTQPKVIRKPQTVICYICGREFGTKSISIHEPQC--FTKWHIEND----KLPKNMRRPEPKKPEVALIKSSGTYDLEAANAAAWQSSQGQLVPCPVCGRTFLPDRLAVHQRAC 420          
BLAST of Zinc finger protein 474 vs. Ensembl Nematostella
Match: EDO38612 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCJ2])

HSP 1 Score: 119.398 bits (298), Expect = 2.425e-33
Identity = 56/101 (55.45%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  786 KPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPI---GIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCK 1079
            KP++V+CYIC REFG+KSI IHEPQCL+KW IEN KLPK  +R  P+KP     + S G  D  + N+ A ++S + L  C NCGRTFLP+RL VH++SC+
Sbjct:    1 KPRSVVCYICGREFGTKSIGIHEPQCLKKWEIENRKLPKHLQRPLPIKPQILPSLGSDGGMDLERMNQMALESSNNQLIPCNNCGRTFLPERLKVHMRSCR 101          

HSP 2 Score: 114.775 bits (286), Expect = 1.474e-31
Identity = 63/102 (61.76%), Postives = 70/102 (68.63%), Query Frame = 3
Query:  120 KPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXX-XXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRP 422
            KP SVVCYIC REFGTKSI IHEPQCL+KWEIEN +L    QR  P K      +G      LE  N MA +S+ + LIPC NCGRTFLP+RL VH RSCRP
Sbjct:    1 KPRSVVCYICGREFGTKSIGIHEPQCLKKWEIENRKLPKHLQRPLPIKPQILPSLGSDGGMDLERMNQMALESSNNQLIPCNNCGRTFLPERLKVHMRSCRP 102          
BLAST of Zinc finger protein 474 vs. Ensembl Nematostella
Match: EDO32098 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW12])

HSP 1 Score: 57.7658 bits (138), Expect = 3.617e-9
Identity = 21/35 (60.00%), Postives = 28/35 (80.00%), Query Frame = 3
Query:  783 RKPQTVICYICSREFGSKSIPIHEPQCLEKWRIEN 887
            + P  ++CYIC  EFGSKS+ IHEPQCL+KW++ N
Sbjct:  400 KNPNMLVCYICGNEFGSKSLKIHEPQCLKKWKLAN 434          

HSP 2 Score: 56.9954 bits (136), Expect = 6.147e-9
Identity = 20/34 (58.82%), Postives = 28/34 (82.35%), Query Frame = 3
Query:  111 IMPKPVSVVCYICSREFGTKSISIHEPQCLQKWE 212
            +MPKP +V+CYIC R+FG  SI++HE QC ++WE
Sbjct:  131 VMPKPQTVICYICGRDFGPHSINVHERQCAKRWE 164          

HSP 3 Score: 56.225 bits (134), Expect = 1.279e-8
Identity = 21/33 (63.64%), Postives = 27/33 (81.82%), Query Frame = 3
Query:  123 PVSVVCYICSREFGTKSISIHEPQCLQKWEIEN 221
            P  +VCYIC  EFG+KS+ IHEPQCL+KW++ N
Sbjct:  402 PNMLVCYICGNEFGSKSLKIHEPQCLKKWKLAN 434          

HSP 4 Score: 55.8398 bits (133), Expect = 1.682e-8
Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 3
Query:  729 RRKSGNELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQCLEKW--------RIENDKLPKGQRR---REPVKP 932
            R+ SG  L + +  P    KPQTVICYIC R+FG  SI +HE QC ++W         IE++K  + ++R   +EPV P
Sbjct:  119 RQISGLFLAEYIVMP----KPQTVICYICGRDFGPHSINVHERQCAKRWEANKKQQREIEDEKKAREKKREPWKEPVFP 193          

HSP 5 Score: 52.7582 bits (125), Expect = 1.521e-7
Identity = 28/59 (47.46%), Postives = 32/59 (54.24%), Query Frame = 3
Query:  708 NTTNDKNRRKSGNELEKSVKAPPEPRK---PQTVICYICSREFGSKSIPIHEPQCLEKW 875
            N  N  N  + G E E+S  A     K   P TV CYIC R +GS SI IHE QC +KW
Sbjct:  601 NLENVDNSNRKGREREESFDATVAKHKTKTPSTVTCYICGRAYGSASISIHEKQCQKKW 659          

HSP 6 Score: 47.7506 bits (112), Expect = 4.912e-6
Identity = 18/29 (62.07%), Postives = 22/29 (75.86%), Query Frame = 3
Query:  123 PVSVVCYICSREFGTKSISIHEPQCLQKW 209
            P +V CYIC R +G+ SISIHE QC +KW
Sbjct:  631 PSTVTCYICGRAYGSASISIHEKQCQKKW 659          
BLAST of Zinc finger protein 474 vs. Planmine SMEST
Match: SMESG000009204.1 (SMESG000009204.1)

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 323/323 (100.00%), Postives = 323/323 (100.00%), Query Frame = 3
Query:  114 MPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSXXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRPGHVLNPLPNKKENSVTNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVAVSKTQTVQPYQCSSCNENLPQSCKFCPFCGQSNSSKAKVLDTSKRPDPNTTNDKNRRKSGNELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCKK 1082
            MPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSQLPKNQRRPPPKKPQPLPVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRPGHVLNPLPNKKENSVTNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVAVSKTQTVQPYQCSSCNENLPQSCKFCPFCGQSNSSKAKVLDTSKRPDPNTTNDKNRRKSGNELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCKK
Sbjct:    1 MPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSQLPKNQRRPPPKKPQPLPVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSCRPGHVLNPLPNKKENSVTNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVAVSKTQTVQPYQCSSCNENLPQSCKFCPFCGQSNSSKAKVLDTSKRPDPNTTNDKNRRKSGNELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLAQCQNCGRTFLPDRLTVHLKSCKK 323          
BLAST of Zinc finger protein 474 vs. Planmine SMEST
Match: SMESG000050488.1 (SMESG000050488.1)

HSP 1 Score: 102.834 bits (255), Expect = 2.970e-25
Identity = 76/258 (29.46%), Postives = 106/258 (41.09%), Query Frame = 3
Query:  345 NLIPCENCGRTFLPDRLPVHQRSCRPGHVLNPLPNKKENSVTNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVAVSKTQTVQPYQCSSCNENLPQSCKFCPFCGQSNSSKAKVLDTSKRPDPNTTNDKNRRKSGNELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQCLEKWRIENDKLPKGQRRREPVKPIG--------IMSSGNYDSSKYNEEAWK------ASQSNLAQCQNCGRTFLPDRLTVHLKSC 1076
            +L  C  C R+F  D L VH++ CR G  L+   +K          P  +   +S  +D     + +   P +   TQ  +   C SC +                     +   +K         +  RK   +  K    P    +    +CYIC R FG+ SI IHE QCLEK+R +N +LPK +RR EPVKP          +       +  YNE+A        A   NL  C NC RTF PD L  H+K+C
Sbjct:    2 SLAACSKCNRSFNFDSLKVHEKICR-GQFLSKQSSK----------PSGIQFGRSVDIDDSISGISDKDVPNSFKVTQESKFVTCKSCGKTFT------------------IHSINKHTVACDLRVERERKEQEQQRKHEAGPQHIGRLPGAVCYICGRNFGTTSIDIHEKQCLEKFRKQNAELPKKERRPEPVKPQTNKEILEQMVKEQKLKGNVTYNEQAAMNDAKAIAYNQNLVSCSNCSRTFNPDALRFHMKAC 230          

HSP 2 Score: 64.3142 bits (155), Expect = 1.425e-11
Identity = 36/111 (32.43%), Postives = 50/111 (45.05%), Query Frame = 3
Query:  129 SVVCYICSREFGTKSISIHEPQCLQKWEIENS---------------XXXXXXXXXXXXXXXXXXVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRSC 416
              VCYIC R FGT SI IHE QCL+K+  +N+                  +   +   ++     V   +   + D   +AY     NL+ C NC RTF PD L  H ++C
Sbjct:  123 GAVCYICGRNFGTTSIDIHEKQCLEKFRKQNAELPKKERRPEPVKPQTNKEILEQMVKEQKLKGNVTYNEQAAMNDAKAIAY---NQNLVSCSNCSRTFNPDALRFHMKAC 230          
The following BLAST results are available for this feature:
BLAST of Zinc finger protein 474 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
AC010255.36.286e-3357.43zinc finger protein 474-like [Source:NCBI gene;Acc... [more]
ZNF4749.815e-3059.60zinc finger protein 474 [Source:HGNC Symbol;Acc:HG... [more]
AC010255.39.092e-1564.00zinc finger protein 474-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Zinc finger protein 474 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
M153.43.484e-3252.38pep chromosome:WBcel235:X:12149953:12151474:1 gene... [more]
back to top
BLAST of Zinc finger protein 474 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein 474 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein 474 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ncf21.462e-7043.48neutrophil cytosolic factor 2 [Source:Xenbase;Acc:... [more]
back to top
BLAST of Zinc finger protein 474 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
1700034E13Rik4.681e-3559.41RIKEN cDNA 1700034E13 gene [Source:MGI Symbol;Acc:... [more]
1700034E13Rik4.681e-3559.41RIKEN cDNA 1700034E13 gene [Source:MGI Symbol;Acc:... [more]
Zfp4742.789e-3460.61zinc finger protein 474 [Source:MGI Symbol;Acc:MGI... [more]
Zfp4742.789e-3460.61zinc finger protein 474 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Zinc finger protein 474 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|A6QQM4|ZN474_BOVIN1.111e-6242.58Zinc finger protein 474 OS=Bos taurus OX=9913 GN=Z... [more]
sp|Q6V5K9|ZN474_MOUSE1.951e-3360.61Zinc finger protein 474 OS=Mus musculus OX=10090 G... [more]
sp|Q6S9Z5|ZN474_HUMAN4.713e-2959.60Zinc finger protein 474 OS=Homo sapiens OX=9606 GN... [more]
sp|Q4R8T4|ZN474_MACFA5.059e-2958.59Zinc finger protein 474 OS=Macaca fascicularis OX=... [more]
back to top
BLAST of Zinc finger protein 474 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NFR42.870e-7445.10Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2C9JJT72.442e-6946.55Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A5G3K3V82.296e-6743.48Neutrophil cytosolic factor 2 OS=Xenopus tropicali... [more]
A0A1S3JM575.087e-6643.73zinc finger protein 474 OS=Lingula unguis OX=7574 ... [more]
A0A1S3KGS08.557e-6645.15zinc finger protein 474-like OS=Lingula unguis OX=... [more]
back to top
BLAST of Zinc finger protein 474 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein 474 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002107.11.593e-6440.11pep scaffold:Pmarinus_7.0:GL478112:15965:19282:-1 ... [more]
back to top
BLAST of Zinc finger protein 474 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein 474 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO386122.425e-3355.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320983.617e-960.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger protein 474 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein 474 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000009204.10.000e+0100.00SMESG000009204.1[more]
SMESG000050488.12.970e-2529.46SMESG000050488.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026699 ID=SMED30026699|Name=Zinc finger protein 474|organism=Schmidtea mediterranea sexual|type=transcript|length=1110bp
TGTACACACATACAAGCATTGTGTAAAATCTATTAACCAATTAGAATGCA
GATAGTGTAGTCAATGGCAACTGATTCAAAACAACTTGAAAATTAATATT
TTAAATATCTATTATGCCTAAACCAGTTTCTGTGGTATGCTACATTTGCA
GCAGAGAATTTGGAACTAAATCTATCAGCATTCACGAGCCACAATGTTTA
CAAAAATGGGAAATAGAAAATTCACAACTGCCGAAAAATCAGCGTCGCCC
TCCACCAAAAAAACCCCAACCTCTTCCGGTAGGTATGGGTAAAAGTTATA
AATTGGAAGATTACAATGATATGGCGTATAAATCAGCTCAAAGCAATTTA
ATTCCATGTGAAAATTGCGGCCGAACCTTTCTCCCAGATCGATTACCTGT
CCACCAGCGCAGTTGTCGTCCAGGTCATGTTTTAAATCCACTTCCAAATA
AAAAGGAGAACAGTGTAACAAATGTAACACGACCAGACACGGTGACTTTA
TCGAAATCCACTGTTTTGGATTTAAAGAAAATTGAAGTGATGAATACTTC
AGAACCGGTAGCAGTTTCCAAGACTCAAACAGTTCAACCGTATCAATGTA
GCAGTTGCAATGAAAATTTACCGCAGTCGTGTAAATTCTGTCCGTTCTGT
GGTCAATCAAATTCGTCAAAAGCCAAAGTGTTGGACACCTCGAAACGACC
CGATCCAAATACGACGAATGATAAAAATCGACGAAAAAGCGGCAACGAGC
TTGAAAAATCAGTTAAAGCTCCTCCTGAACCTAGAAAACCTCAAACCGTC
ATTTGTTACATTTGTAGCAGAGAATTCGGATCAAAATCCATACCGATTCA
TGAGCCACAGTGTTTAGAAAAGTGGCGAATTGAGAATGATAAACTTCCTA
AAGGTCAAAGAAGACGAGAACCTGTAAAACCAATTGGCATTATGTCGTCT
GGAAATTATGACTCCTCGAAATATAATGAAGAAGCTTGGAAAGCTAGTCA
GAGTAATTTAGCTCAATGCCAAAATTGTGGCAGAACATTCCTACCTGATC
GACTAACAGTTCATTTAAAATCTTGCAAAAAATGAATAGTATAAATTAAA
TTGTGGCCAG
back to top

protein sequence of SMED30026699-orf-1

>SMED30026699-orf-1 ID=SMED30026699-orf-1|Name=SMED30026699-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=324bp
MPKPVSVVCYICSREFGTKSISIHEPQCLQKWEIENSQLPKNQRRPPPKK
PQPLPVGMGKSYKLEDYNDMAYKSAQSNLIPCENCGRTFLPDRLPVHQRS
CRPGHVLNPLPNKKENSVTNVTRPDTVTLSKSTVLDLKKIEVMNTSEPVA
VSKTQTVQPYQCSSCNENLPQSCKFCPFCGQSNSSKAKVLDTSKRPDPNT
TNDKNRRKSGNELEKSVKAPPEPRKPQTVICYICSREFGSKSIPIHEPQC
LEKWRIENDKLPKGQRRREPVKPIGIMSSGNYDSSKYNEEAWKASQSNLA
QCQNCGRTFLPDRLTVHLKSCKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR026319ZC2HC1
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 299..323
e-value: 1.1E-9
score: 40.1
coord: 78..105
e-value: 1.0E-11
score: 46.6
NoneNo IPR availablePFAMPF13913zf-C2HC_2coord: 78..102
e-value: 5.5E-11
score: 42.1
coord: 299..322
e-value: 4.2E-10
score: 39.3
coord: 8..28
e-value: 6.6E-7
score: 29.1
coord: 227..250
e-value: 6.7E-9
score: 35.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 190..221
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 37..57
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 187..222
NoneNo IPR availablePANTHERPTHR13555:SF36ZINC FINGER PROTEIN 474coord: 3..162
NoneNo IPR availablePANTHERPTHR13555:SF36ZINC FINGER PROTEIN 474coord: 218..323
IPR026319Zinc finger C2HC domain-containing proteinPANTHERPTHR13555C2H2 ZINC FINGER CGI-62-RELATEDcoord: 3..162
coord: 218..323