Latent-transforming growth factor beta-binding protein

Overview
NameLatent-transforming growth factor beta-binding protein
Smed IDSMED30026698
Length (bp)1878
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Latent-transforming growth factor beta-binding protein (SMED30026698) t-SNE clustered cells

Violin plots show distribution of expression levels for Latent-transforming growth factor beta-binding protein (SMED30026698) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Latent-transforming growth factor beta-binding protein (SMED30026698) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Latent-transforming growth factor beta-binding protein (SMED30026698) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Human
Match: FBLN1 (fibulin 1 [Source:HGNC Symbol;Acc:HGNC:3600])

HSP 1 Score: 160.614 bits (405), Expect = 4.965e-41
Identity = 148/540 (27.41%), Postives = 221/540 (40.93%), Query Frame = 3
Query:  342 RRCVDMDDTNV-TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRP---------------------------PCPTNKPHYWNSGCHQCKE-------GYRWNPLINICEDIDECTGPYRLQCEP--FKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN---ATCLDIDECV--SLKDICGHLKCENTPGFFKCVC-KSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEI-PIEVLNYDHYHVKVNV--KKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTE 1820
            ++C D  D  V +C  GYQ + +   C+D+NEC   +  C + E C N  GS++C     CG GYE   E  +C D++EC   +  C    +C+N +GSF CRP                           PCP         G + C++       GY  N     C D+DEC  P     EP      CV  PG   CE +       I+ +C DV+EC           +C N  G Y CS                  C  GF+ ++    CED++EC S    C  +  C N  G Y C C  GY+  +    TC DIDEC   +   IC + +C N PG F+C C  SGY+++ N   C+DI+EC     +  I   S+N    CFN+ G ++CL   CP  YR    S++T+  +L           R    LP  + Y  +    +   P  +  + P   +  D   + +    ++ F T  K         + +P  + + +++ +  DL     +   +     F S E
Sbjct:  226 QQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELT-EDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPA----EPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCG-HKCENTLGSYLCS------------------CSVGFRLSVDGRSCEDINECSS--SPCSQE--CANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSY-RCINIPGSFQCSCPSSGYRLAPNGRNCQDIDEC-----VTGIHNCSINE--TCFNIQGGFRCLAFECPENYR---RSAATRCERLP------CHENRECSKLPLRITYYHLSFPTNIQAPAVVFRMGPSSAVPGDSMQLAITGGNEEGFFTTRKVSPHSGVVALTKPVPEPRDLLLTVKMDLSRHGTVSSFVAKLFIFVSAE 720          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Human
Match: FBLN1 (fibulin 1 [Source:HGNC Symbol;Acc:HGNC:3600])

HSP 1 Score: 160.229 bits (404), Expect = 5.170e-41
Identity = 148/540 (27.41%), Postives = 222/540 (41.11%), Query Frame = 3
Query:  342 RRCVDMDDTNV-TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRP---------------------------PCPTNKPHYWNSGCHQCKE-------GYRWNPLINICEDIDECTGPYRLQCEPFKE--ICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN---ATCLDIDECV--SLKDICGHLKCENTPGFFKCVC-KSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEI-PIEVLNYDHYHVKVNV--KKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTE 1820
            ++C D  D  V +C  GYQ + +   C+D+NEC   +  C + E C N  GS++C     CG GYE   E  +C D++EC   +  C    +C+N +GSF CRP                           PCP         G + C++       GY  N     C D+DEC  P     EP  +   CV  PG   CE +       I+ +C DV+EC           +C N  G Y CS                  C  GF+ ++    CED++EC S    C  +  C N  G Y C C  GY+  +    TC DIDEC   +   IC + +C N PG F+C C  SGY+++ N   C+DI+EC     +  I   S+N    CFN+ G ++CL   CP  YR    S++T+  +L           R    LP  + Y  +    +   P  +  + P   +  D   + +    ++ F T  K         + +P  + + +++ +  DL     +   +     F S E
Sbjct:  188 QQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELT-EDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPA----EPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCG-HKCENTLGSYLCS------------------CSVGFRLSVDGRSCEDINECSS--SPCSQE--CANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSY-RCINIPGSFQCSCPSSGYRLAPNGRNCQDIDEC-----VTGIHNCSINE--TCFNIQGGFRCLAFECPENYR---RSAATRCERLP------CHENRECSKLPLRITYYHLSFPTNIQAPAVVFRMGPSSAVPGDSMQLAITGGNEEGFFTTRKVSPHSGVVALTKPVPEPRDLLLTVKMDLSRHGTVSSFVAKLFIFVSAE 682          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Human
Match: FBLN1 (fibulin 1 [Source:HGNC Symbol;Acc:HGNC:3600])

HSP 1 Score: 155.221 bits (391), Expect = 1.221e-39
Identity = 135/441 (30.61%), Postives = 192/441 (43.54%), Query Frame = 3
Query:  342 RRCVDMDDTNV-TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRP---------------------------PCPTNKPHYWNSGCHQCKE-------GYRWNPLINICEDIDECTGPYRLQCEPFKE--ICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN---ATCLDIDECV--SLKDICGHLKCENTPGFFKCVC-KSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILP 1532
            ++C D  D  V +C  GYQ + +   C+D+NEC   +  C + E C N  GS++C     CG GYE   E  +C D++EC   +  C    +C+N +GSF CRP                           PCP         G + C++       GY  N     C D+DEC  P     EP  +   CV  PG   CE +       I+ +C DV+EC           +C N  G Y CS                  C  GF+ ++    CED++EC S    C  +  C N  G Y C C  GY+  +    TC DIDEC   +   IC + +C N PG F+C C  SGY+++ N   C+DI+EC     +  I   S+N    CFN+ G ++CL   CP  YR  + +  +K  + + P  S  +  R   +LP
Sbjct:  188 QQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYEL-TEDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPA----EPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCG-HKCENTLGSYLCS------------------CSVGFRLSVDGRSCEDINECSS--SPCSQE--CANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSY-RCINIPGSFQCSCPSSGYRLAPNGRNCQDIDEC-----VTGIHNCSINE--TCFNIQGGFRCLAFECPENYRRSAATQKSKKGRQNTPAGSSKEDCR---VLP 589          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Human
Match: FBLN1 (fibulin 1 [Source:HGNC Symbol;Acc:HGNC:3600])

HSP 1 Score: 156.377 bits (394), Expect = 1.223e-39
Identity = 156/560 (27.86%), Postives = 231/560 (41.25%), Query Frame = 3
Query:  342 RRCVDMDDTNV-TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRP---------------------------PCPTNKPHYWNSGCHQCKE-------GYRWNPLINICEDIDECTGPYRLQCEP--FKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN---ATCLDIDECV--SLKDICGHLKCENTPGFFKCVC-KSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR-----VLSESSST----KACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVND 1862
            ++C D  D  V +C  GYQ + +   C+D+NEC   +  C + E C N  GS++C     CG GYE   E  +C D++EC   +  C    +C+N +GSF CRP                           PCP         G + C++       GY  N     C D+DEC  P     EP      CV  PG   CE +       I+ +C DV+EC           +C N  G Y CS                  C  GF+ ++    CED++EC S    C  +  C N  G Y C C  GY+  +    TC DIDEC   +   IC + +C N PG F+C C  SGY+++ N   C+DI+EC     +  I   S+N    CFN+ G ++CL   CP  YR     +  E + T    K+C+ +  TC +      V  +   +I   +      T P +I  I +  +   H   + N+   F+       D  D II R  +     +V  +  +      VL + +           ++  +HIFV++
Sbjct:  188 QQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELT-EDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPA----EPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCG-HKCENTLGSYLCS------------------CSVGFRLSVDGRSCEDINECSS--SPCSQE--CANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSY-RCINIPGSFQCSCPSSGYRLAPNGRNCQDIDEC-----VTGIHNCSINE--TCFNIQGGFRCLAFECPENYRRSAATLQQEKTDTVRCIKSCRPNDVTCVFDP----VHTISHTVIS--LPTFREFTRPEEI--IFLRAITPPHPASQANI--IFDITEGNLRDSFD-IIKRYMDGMTVGVVRQVRPIVGPFHAVLKLEMNYVVGGVVSHRNVVNVHIFVSE 700          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Human
Match: FBLN1 (fibulin 1 [Source:HGNC Symbol;Acc:HGNC:3600])

HSP 1 Score: 152.14 bits (383), Expect = 9.355e-39
Identity = 129/410 (31.46%), Postives = 179/410 (43.66%), Query Frame = 3
Query:  342 RRCVDMDDTNV-TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRP---------------------------PCPTNKPHYWNSGCHQCKE-------GYRWNPLINICEDIDECTGPYRLQCEPFKE--ICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN---ATCLDIDECV--SLKDICGHLKCENTPGFFKCVC-KSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            ++C D  D  V +C  GYQ + +   C+D+NEC   +  C + E C N  GS++C     CG GYE   E  +C D++EC   +  C    +C+N +GSF CRP                           PCP         G + C++       GY  N     C D+DEC  P     EP  +   CV  PG   CE +       I+ +C DV+EC           +C N  G Y CS                  C  GF+ ++    CED++EC S    C  +  C N  G Y C C  GY+  +    TC DIDEC   +   IC + +C N PG F+C C  SGY+++ N   C+DI+EC     +  I   S+N    CFN+ G ++CL   CP  YR
Sbjct:  188 QQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYEL-TEDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPA----EPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCG-HKCENTLGSYLCS------------------CSVGFRLSVDGRSCEDINECSS--SPCSQE--CANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSY-RCINIPGSFQCSCPSSGYRLAPNGRNCQDIDEC-----VTGIHNCSINE--TCFNIQGGFRCLAFECPENYR 561          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 142.895 bits (359), Expect = 1.849e-35
Identity = 147/527 (27.89%), Postives = 216/527 (40.99%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPP----CPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQ---CSGG--TIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATK-----------------------------ECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECV----SLKDICGHLKCENTPGFFKCVCKSGYKMSNEN-VCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPI-EVLNYDHYHVKVNVKKAFNTKSKKQMDITDSI----ILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLS 1805
            +C SG+    +   C DI+EC+   D C  ++ C N PGS+KCI    CG GY  + ET+ C D++EC      C     C N  GS+ C            P         C  GY   P   +C DIDEC   +   C   +E CV  PG   C+ +   C+ G         C DV+EC   +     +  C N  G Y C   KC    E N+A K                             EC CK GF+      +CEDV+EC + I  C  K  C N  G Y C C+ G+        C DIDEC     S  D+C    C NT G + C C  GYK+  +   C D++EC        +   + +++V C N +GS+KC    CP+ Y  + +S +   C      C     E C ++ P  L Y+ I +  +  +      I + +V   +H   +VN +    T      ++  +I    +L+  E   + +V +   L     + L + L++S
Sbjct:  179 SCRSGFDLAPDGMACVDIDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYY--PKNGMCNDIDECVTGH--NCGAGEE-CVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNEC---QQGVCGSMECINLPGTYKC---KCGPGYEFNDAKKRCEDVDECIKFAGHVCDLSAECINTIGSFECKCKPGFQLASDGRRCEDVNECTTGIAACEQK--CVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLC-MGGCINTKGSYLCQCPPGYKIQPDGRTCVDVDECA-------MGECAGSDKV-CVNTLGSFKCHSIDCPTNY--IHDSLNKNRCNRQPSACGL--PEECSKV-PLFLTYQFISLARAVPISSHRPAITLFKVSAPNHADTEVNFELQLKTTIVGAPNVLPAIRANFLLQKGEKRNSAVVTLRDSLDGPQTVKLQLLLRMS 678          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 141.739 bits (356), Expect = 3.778e-35
Identity = 115/369 (31.17%), Postives = 163/369 (44.17%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNAT--CLDIDECVSLKDICGHL-----KCENTPGFFKCVCKSGYKMSNEN-VCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESS 1457
            +C SG+    +   C DI+EC+   D C  ++ C N PGS+KCI    CG GY  + ET+ C D++EC      C     C N  GS+ C                 +C +G   NP+   C  I                              C  G      +C D+DEC    +NC   + C N  G + C +             K   C  G++ N  TG CEDV+EC     VCG+   C N  G Y C+C PGYEF +A   C D+DEC+      GH+     +C NT G F+C CK G++++++   CED+NECT   GI   E+       +C N+ GSY+C   IC  G+ +  + +
Sbjct:  179 SCRSGFDLAPDGMACVDIDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDA--------------KKCGDGELQNPMTGECTSI-----------------------------TCPNGYYPKNGMCNDIDECVTG-HNCGAGEECVNTPGSFRCQQ-------------KGNLCAHGYEVNGATGFCEDVNECQQ--GVCGSM-ECINLPGTYKCKCGPGYEFNDAKKRCEDVDECIKFA---GHVCDLSAECINTIGSFECKCKPGFQLASDGRRCEDVNECTT--GIAACEQ-------KCVNIPGSYQC---ICDRGFALGPDGT 472          

HSP 2 Score: 116.701 bits (291), Expect = 4.753e-27
Identity = 142/522 (27.20%), Postives = 209/522 (40.04%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCI----------------DLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNN-CTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECV----SLKDICGHLKCENTPGFFKCVCKSGYKMSNEN-VCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLN-YDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQS-TEQIYSLNELHIFVN 1859
            ++C +GY    E ++C+D++EC+  +  C     CRN  GSY+C  K  CG G   N  T  C                 D++EC      C +G  C N  GSF C+               + C  GY  N     CED++EC    +  C   +  C+  PG   C+             C DVDEC +   + C  +  C N  G +                  EC CK GF+      +CEDV+EC + I  C  K  C N  G Y C C+ G+        C DIDEC     S  D+C    C NT G + C C  GYK+  +   C D++EC        +   + +++V C N +GS+KC    CP+ Y   S + +  A   S      T+   C+      ++Y   Q R   +L   I+  PIEV     H  V  +V    +   ++   I           E+ I +  +   P S   V  I + +  +S T  I + NE  I ++
Sbjct:  225 LSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKK-CGDGELQNPMTGECTSITCPNGYYPKNGMCNDIDECVTG-HNCGAGEECVNTPGSFRCQQK------------GNLCAHGYEVNGATGFCEDVNECQ---QGVCGSME--CINLPGTYKCKCGPGYEFNDAKKRCEDVDECIKFAGHVCDLSAECINTIGSF------------------ECKCKPGFQLASDGRRCEDVNECTTGIAACEQK--CVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLC-MGGCINTKGSYLCQCPPGYKIQPDGRTCVDVDECA-------MGECAGSDKV-CVNTLGSFKCHSIDCPTNYIHDSLNKNQIADGYSCIKVCSTEDTECLGNHTREVLY---QFRAVPSLKTIIS--PIEVSRIVTHMGVPFSVDYNLDYVGQRHFRIV---------QERNIGIVQLVK-PISGPTVETIKVNIHTKSRTGVILAFNEAIIEIS 683          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 137.887 bits (346), Expect = 5.414e-34
Identity = 130/489 (26.58%), Postives = 198/489 (40.49%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECV----SLKDICGHLKCENTPGFFKCVCKSGYKMSNEN-VCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPI-EVLNYDHYHVKVNVKKAFNTKSKKQMDITDSI----ILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLS 1805
            +C SG+    +   C DI+EC+   D C  ++ C N PGS+KCI    CG GY  + ET+ C D++EC      C     C N  GS+ C                 +C +G   NP+   C  I                              C  G      +C D+DEC    +NC   + C N  G + C +             K   C  G++ N  TG CEDV+EC + I  C  K  C N  G Y C C+ G+        C DIDEC     S  D+C    C NT G + C C  GYK+  +   C D++EC        +   + +++V C N +GS+KC    CP+ Y  + +S +   C      C     E C ++ P  L Y+ I +  +  +      I + +V   +H   +VN +    T      ++  +I    +L+  E   + +V +   L     + L + L++S
Sbjct:  179 SCRSGFDLAPDGMACVDIDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDA--------------KKCGDGELQNPMTGECTSI-----------------------------TCPNGYYPKNGMCNDIDECVTG-HNCGAGEECVNTPGSFRCQQ-------------KGNLCAHGYEVNGATGFCEDVNECTTGIAACEQK--CVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLC-MGGCINTKGSYLCQCPPGYKIQPDGRTCVDVDECA-------MGECAGSDKV-CVNTLGSFKCHSIDCPTNY--IHDSLNKNRCNRQPSACGL--PEECSKV-PLFLTYQFISLARAVPISSHRPAITLFKVSAPNHADTEVNFELQLKTTIVGAPNVLPAIRANFLLQKGEKRNSAVVTLRDSLDGPQTVKLQLLLRMS 594          

HSP 2 Score: 88.9669 bits (219), Expect = 2.936e-18
Identity = 99/351 (28.21%), Postives = 132/351 (37.61%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCI----------------DLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNK---GRCKNEIGRYNCQCNPGYEFK--NATCLDIDECVSLKDICGHLK-CENTPGFFKCV---CKSGYKMSNENVCEDINECTETPGICRI 1349
            ++C +GY    E ++C+D++EC+  +  C     CRN  GSY+C  K  CG G   N  T  C                 D++EC      C +G  C N  GSF C+               + C  GY  N     CED++ECT                  G++ CE                              Q+C N  G Y C                   C  GF       KCED+DEC S+    GN    G C N  G Y CQC PGY+ +    TC+D+DEC ++ +  G  K C NT G FKC    C + Y   + N     N C   P  C +
Sbjct:  225 LSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKK-CGDGELQNPMTGECTSITCPNGYYPKNGMCNDIDECVTG-HNCGAGEECVNTPGSFRCQ------------QKGNLCAHGYEVNGATGFCEDVNECT-----------------TGIAACE------------------------------QKCVNIPGSYQCI------------------CDRGFALGPDGTKCEDIDEC-SIWAGSGNDLCMGGCINTKGSYLCQCPPGYKIQPDGRTCVDVDEC-AMGECAGSDKVCVNTLGSFKCHSIDCPTNYIHDSLNK----NRCNRQPSACGL 490          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 128.642 bits (322), Expect = 4.368e-31
Identity = 137/504 (27.18%), Postives = 200/504 (39.68%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECV----SLKDICGHLKCENTPGFFKCVCKSGYKMSNEN-VCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLN-YDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQS-TEQIYSLNELHIFVN 1859
            +C SG+    +   C DI+EC+   D C  ++ C N PGS+KCI    CG GY  + ET+ C D++EC      C     C N  GS+ C                 +C +G   NP+   C  I                              C  G      +C D+DEC    +NC   + C N  G + C +             K   C  G++ N  TG CEDV+EC + I  C  K  C N  G Y C C+ G+        C DIDEC     S  D+C    C NT G + C C  GYK+  +   C D++EC        +   + +++V C N +GS+KC    CP+ Y   S + +  A   S      T+   C+      ++Y   Q R   +L   I+  PIEV     H  V  +V    +   ++   I           E+ I +  +   P S   V  I + +  +S T  I + NE  I ++
Sbjct:  179 SCRSGFDLAPDGMACVDIDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDA--------------KKCGDGELQNPMTGECTSI-----------------------------TCPNGYYPKNGMCNDIDECVTG-HNCGAGEECVNTPGSFRCQQ-------------KGNLCAHGYEVNGATGFCEDVNECTTGIAACEQK--CVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLC-MGGCINTKGSYLCQCPPGYKIQPDGRTCVDVDECA-------MGECAGSDKV-CVNTLGSFKCHSIDCPTNYIHDSLNKNQIADGYSCIKVCSTEDTECLGNHTREVLY---QFRAVPSLKTIIS--PIEVSRIVTHMGVPFSVDYNLDYVGQRHFRIV---------QERNIGIVQLVK-PISGPTVETIKVNIHTKSRTGVILAFNEAIIEIS 599          

HSP 2 Score: 88.1965 bits (217), Expect = 5.632e-18
Identity = 92/319 (28.84%), Postives = 122/319 (38.24%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCI----------------DLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNK---GRCKNEIGRYNCQCNPGYEFK--NATCLDIDECVSLKDICGHLK-CENTPGFFKC 1262
            ++C +GY    E ++C+D++EC+  +  C     CRN  GSY+C  K  CG G   N  T  C                 D++EC      C +G  C N  GSF C+               + C  GY  N     CED++ECT                  G++ CE                              Q+C N  G Y C                   C  GF       KCED+DEC S+    GN    G C N  G Y CQC PGY+ +    TC+D+DEC ++ +  G  K C NT G FKC
Sbjct:  225 LSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKK-CGDGELQNPMTGECTSITCPNGYYPKNGMCNDIDECVTG-HNCGAGEECVNTPGSFRCQQK------------GNLCAHGYEVNGATGFCEDVNECT-----------------TGIAACE------------------------------QKCVNIPGSYQCI------------------CDRGFALGPDGTKCEDIDEC-SIWAGSGNDLCMGGCINTKGSYLCQCPPGYKIQPDGRTCVDVDEC-AMGECAGSDKVCVNTLGSFKC 462          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 119.783 bits (299), Expect = 5.589e-28
Identity = 135/510 (26.47%), Postives = 205/510 (40.20%), Query Frame = 3
Query:  363 DTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCI----------------DLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNN-CTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECV----SLKDICGHLKCENTPGFFKCVCKSGYKMSNEN-VCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPI-EVLNYDHYHVKVNVKKAFNTKSKKQMDITDSI----ILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLS 1805
            +T   C  G+  +F+   C D++EC+  +  C     CRN  GSY+C  K  CG G   N  T  C                 D++EC      C +G  C N  GSF C+               + C  GY  N     CED++EC    +  C   +  C+  PG   C+             C DVDEC +   + C  +  C N  G +                  EC CK GF+      +CEDV+EC + I  C  K  C N  G Y C C+ G+        C DIDEC     S  D+C    C NT G + C C  GYK+  +   C D++EC        +   + +++V C N +GS+KC    CP+ Y  + +S +   C      C     E C ++ P  L Y+ I +  +  +      I + +V   +H   +VN +    T      ++  +I    +L+  E   + +V +   L     + L + L++S
Sbjct:  263 NTEFGCPMGW--LFQHGHCVDVDECNLGSHDCGPLYQCRNTQGSYRCDAKK-CGDGELQNPMTGECTSITCPNGYYPKNGMCNDIDECVTG-HNCGAGEECVNTPGSFRCQ------------QKGNLCAHGYEVNGATGFCEDVNECQ---QGVCGSME--CINLPGTYKCKCGPGYEFNDAKKRCEDVDECIKFAGHVCDLSAECINTIGSF------------------ECKCKPGFQLASDGRRCEDVNECTTGIAACEQK--CVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLC-MGGCINTKGSYLCQCPPGYKIQPDGRTCVDVDECA-------MGECAGSDKV-CVNTLGSFKCHSIDCPTNY--IHDSLNKNRCNRQPSACGL--PEECSKV-PLFLTYQFISLARAVPISSHRPAITLFKVSAPNHADTEVNFELQLKTTIVGAPNVLPAIRANFLLQKGEKRNSAVVTLRDSLDGPQTVKLQLLLRMS 717          

HSP 2 Score: 111.309 bits (277), Expect = 3.422e-25
Identity = 96/325 (29.54%), Postives = 142/325 (43.69%), Query Frame = 3
Query:  519 CGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEIC-VRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKEC---HCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQ-----CNPGYEFKNAT--CLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSN-ENVCEDINECTETPG-ICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSES 1454
            C  G++   +   C+D NEC      C     C N IG + C+       PH            +R N + N          P R++ +P+      R+   +  E  C  G +     C DVDEC    ++C    +C N  G Y C   KC   E  N  T EC    C +G+      G C D+DEC +    CG    C N  G + CQ     C  GYE   AT  C D++EC   + +CG ++C N PG +KC C  GY+ ++ +  CED++EC +  G +C +         EC N +GS++C    C  G+++ S+ 
Sbjct:  180 CRSGFDLAPDGMACVDRNECLTRQSPCTQSEDCVNTIGGYICQRRISRLVPHR-----------HRANRIGN---------APRRMRDDPYSRAGEYREASQANTEFGCPMGWLFQHGHCVDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYPK--NGMCNDIDECVTG-HNCGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNEC--QQGVCGSMECINLPGTYKCKCGPGYEFNDAKKRCEDVDECIKFAGHVCDLS-------AECINTIGSFECK---CKPGFQLASDG 469          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Fly
Match: CG31999 (gene:FBgn0051999 transcript:FBtr0344870)

HSP 1 Score: 135.576 bits (340), Expect = 9.014e-33
Identity = 162/608 (26.64%), Postives = 237/608 (38.98%), Query Frame = 3
Query:  291 LKKCQDCQFNKVYNETLRRCVD-MDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNC-------------------------------RPPCPTN-KPHYWNSGCH-------QCKEGYRWNPLINICEDIDECTGPYRLQCEP--FKEICVRKPGLSTCET--QCSGG--TIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCS-EIKCEGYEELNNATK---------------------------ECHCKSGFKRNL---YTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEF--KNATCLDIDECVSLKD--ICGHLKCENTPGFFKCVCKSGYKMSNE-NVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPI--EVLNYDHYHVKVN-VKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVN 1859
            + +C     N  +  + + CV+ +   +  C  G+       KC DINECS     C   + C N  GSY C     CG GY  N ET  C D +EC  S   C S   C N  GSF C                               R P P    P Y  +           C  G+  N L   C D +EC     ++  P    E C+   G   CE+  QCS G  +      C D+DEC   ++NC + Q C N  G + CS  I  E    +  A+                             C CK+GF++      + +C D+DEC  +  +C  K  C N  G Y C CN GY+    N TC DI+EC   KD  +C  L C NTPG ++C C  GY ++ + N C D++EC        I ++       C N+ GSYKC    CP GY +  E  +     L     ++ + E C    P    Y  I   +   +P     I      L YD+    +  V+    T  +K  D +   +    ++   + V +   L    +I L++++ +      +  S+ +L +FV+
Sbjct:  329 IDECSHKSLNNCHVNSNQECVNTVGSYSCNCLPGFNLDATLNKCVDINECSINNHNCLPTQRCDNTIGSYICTRLQSCGTGYTLNAETGNCDDDDECTLSTHNCPSNYDCHNTRGSFRCYRKISTMLTTRTTSTTVPPLSLENARRSFTSRYPYPLAVHPEYSQNNDSISTNRRVDCSPGFYRNTL-GACIDTNEC-----MEQNPCGNHERCINTNGHFRCESLLQCSPGYKSTVDGKSCIDIDECDTGEHNCGERQICRNRNGGFVCSCPIGHELKRSIGGASTCVDTNECALEQRVCPLNAQCFNTIGAYYCECKAGFQKKSDGNNSTQCFDIDECQVIPGLCQQK--CLNFWGGYRCTCNSGYQLGPDNRTCNDINECEVHKDYKLCMGL-CINTPGSYQCSCPRGYILAADMNTCRDVDECATD----SINQVCTGRNDICTNIRGSYKCTTVNCPLGYSIDPEQKNRCRQNL-----NFCEGEECY-TQPSAFTYNFITFVSKLMIPPDGRTIFTLRGPLWYDNIEFDLKIVRIQATTNIQKATDGSFDTL----QNNNQVNVILKKSLEGPQDIELELSMTVYTNGMPRGKSVAKLFLFVS 913          

HSP 2 Score: 75.485 bits (184), Expect = 8.777e-14
Identity = 62/228 (27.19%), Postives = 91/228 (39.91%), Query Frame = 3
Query:  519 CGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNC----RPPCPTNKPHYWNSGCHQCKEGYR---------------WNPLINICEDIDECTGPYRLQCEP-FKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNC 1142
            C  GY  +     CID++EC + L  C S   C N  G ++C       CP     +++     CK+ Y+               ++     C DIDEC+      C     + CV   G  +C            N C D++EC+ N +NC  TQRC+N  G Y C+ ++               C +G+  N  TG C+D DEC      C +   C N  G + C
Sbjct:  236 CPSGYNLDKLDNKCIDIDECREDLHDCKSSQYCHNTNGGYHCLNVKEKECPPG--FHYDHDYDACKDDYKCKDRKCVKIQSCDKGFSLHNGTCSDIDECSHKSLNNCHVNSNQECVNTVGSYSCNCLPGFNLDATLNKCVDINECSINNHNCLPTQRCDNTIGSYICTRLQ--------------SCGTGYTLNAETGNCDDDDECTLSTHNCPSNYDCHNTRGSFRC 447          

HSP 3 Score: 63.929 bits (154), Expect = 3.009e-10
Identity = 62/207 (29.95%), Postives = 92/207 (44.44%), Query Frame = 3
Query:  858 KIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECV--SLKD--ICGHLKCENTPGFFKCVCKSGYKM-SNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLE-SICPSGYRVLSESSS 1460
            K+ N C D+DEC E+ ++C  +Q C+N  G Y C  +K            E  C  GF  +       D D        C +  +CK+        C+ G+   N TC DIDEC   SL +  +  + +C NT G + C C  G+ + +  N C DINEC+     C   +        C N +GSY C     C +GY + +E+ +
Sbjct:  244 KLDNKCIDIDECREDLHDCKSSQYCHNTNGGYHCLNVK------------EKECPPGFHYD------HDYD-------ACKDDYKCKDRKCVKIQSCDKGFSLHNGTCSDIDECSHKSLNNCHVNSNQECVNTVGSYSCNCLPGFNLDATLNKCVDINECSINNHNCLPTQ-------RCDNTIGSYICTRLQSCGTGYTLNAETGN 418          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Fly
Match: CG31999 (gene:FBgn0051999 transcript:FBtr0089144)

HSP 1 Score: 135.576 bits (340), Expect = 9.014e-33
Identity = 162/608 (26.64%), Postives = 237/608 (38.98%), Query Frame = 3
Query:  291 LKKCQDCQFNKVYNETLRRCVD-MDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNC-------------------------------RPPCPTN-KPHYWNSGCH-------QCKEGYRWNPLINICEDIDECTGPYRLQCEP--FKEICVRKPGLSTCET--QCSGG--TIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCS-EIKCEGYEELNNATK---------------------------ECHCKSGFKRNL---YTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEF--KNATCLDIDECVSLKD--ICGHLKCENTPGFFKCVCKSGYKMSNE-NVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPI--EVLNYDHYHVKVN-VKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVN 1859
            + +C     N  +  + + CV+ +   +  C  G+       KC DINECS     C   + C N  GSY C     CG GY  N ET  C D +EC  S   C S   C N  GSF C                               R P P    P Y  +           C  G+  N L   C D +EC     ++  P    E C+   G   CE+  QCS G  +      C D+DEC   ++NC + Q C N  G + CS  I  E    +  A+                             C CK+GF++      + +C D+DEC  +  +C  K  C N  G Y C CN GY+    N TC DI+EC   KD  +C  L C NTPG ++C C  GY ++ + N C D++EC        I ++       C N+ GSYKC    CP GY +  E  +     L     ++ + E C    P    Y  I   +   +P     I      L YD+    +  V+    T  +K  D +   +    ++   + V +   L    +I L++++ +      +  S+ +L +FV+
Sbjct:  329 IDECSHKSLNNCHVNSNQECVNTVGSYSCNCLPGFNLDATLNKCVDINECSINNHNCLPTQRCDNTIGSYICTRLQSCGTGYTLNAETGNCDDDDECTLSTHNCPSNYDCHNTRGSFRCYRKISTMLTTRTTSTTVPPLSLENARRSFTSRYPYPLAVHPEYSQNNDSISTNRRVDCSPGFYRNTL-GACIDTNEC-----MEQNPCGNHERCINTNGHFRCESLLQCSPGYKSTVDGKSCIDIDECDTGEHNCGERQICRNRNGGFVCSCPIGHELKRSIGGASTCVDTNECALEQRVCPLNAQCFNTIGAYYCECKAGFQKKSDGNNSTQCFDIDECQVIPGLCQQK--CLNFWGGYRCTCNSGYQLGPDNRTCNDINECEVHKDYKLCMGL-CINTPGSYQCSCPRGYILAADMNTCRDVDECATD----SINQVCTGRNDICTNIRGSYKCTTVNCPLGYSIDPEQKNRCRQNL-----NFCEGEECY-TQPSAFTYNFITFVSKLMIPPDGRTIFTLRGPLWYDNIEFDLKIVRIQATTNIQKATDGSFDTL----QNNNQVNVILKKSLEGPQDIELELSMTVYTNGMPRGKSVAKLFLFVS 913          

HSP 2 Score: 75.485 bits (184), Expect = 8.777e-14
Identity = 62/228 (27.19%), Postives = 91/228 (39.91%), Query Frame = 3
Query:  519 CGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNC----RPPCPTNKPHYWNSGCHQCKEGYR---------------WNPLINICEDIDECTGPYRLQCEP-FKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNC 1142
            C  GY  +     CID++EC + L  C S   C N  G ++C       CP     +++     CK+ Y+               ++     C DIDEC+      C     + CV   G  +C            N C D++EC+ N +NC  TQRC+N  G Y C+ ++               C +G+  N  TG C+D DEC      C +   C N  G + C
Sbjct:  236 CPSGYNLDKLDNKCIDIDECREDLHDCKSSQYCHNTNGGYHCLNVKEKECPPG--FHYDHDYDACKDDYKCKDRKCVKIQSCDKGFSLHNGTCSDIDECSHKSLNNCHVNSNQECVNTVGSYSCNCLPGFNLDATLNKCVDINECSINNHNCLPTQRCDNTIGSYICTRLQ--------------SCGTGYTLNAETGNCDDDDECTLSTHNCPSNYDCHNTRGSFRC 447          

HSP 3 Score: 63.929 bits (154), Expect = 3.009e-10
Identity = 62/207 (29.95%), Postives = 92/207 (44.44%), Query Frame = 3
Query:  858 KIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECV--SLKD--ICGHLKCENTPGFFKCVCKSGYKM-SNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLE-SICPSGYRVLSESSS 1460
            K+ N C D+DEC E+ ++C  +Q C+N  G Y C  +K            E  C  GF  +       D D        C +  +CK+        C+ G+   N TC DIDEC   SL +  +  + +C NT G + C C  G+ + +  N C DINEC+     C   +        C N +GSY C     C +GY + +E+ +
Sbjct:  244 KLDNKCIDIDECREDLHDCKSSQYCHNTNGGYHCLNVK------------EKECPPGFHYD------HDYD-------ACKDDYKCKDRKCVKIQSCDKGFSLHNGTCSDIDECSHKSLNNCHVNSNQECVNTVGSYSCNCLPGFNLDATLNKCVDINECSINNHNCLPTQ-------RCDNTIGSYICTRLQSCGTGYTLNAETGN 418          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0290277)

HSP 1 Score: 121.324 bits (303), Expect = 5.152e-28
Identity = 124/475 (26.11%), Postives = 180/475 (37.89%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEF---NIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCR-PP------------------------CPTNKPH---------YWNSGCHQ------------CKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNC------------------------------------QCNPGYEF-KNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKM-SNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPEN 1538
             C  G++   + K C+D++EC      C   + CRNLPGSY CI    C  GYE    +     C D++EC+Q    C   M+CEN+ GS+ C  PP                          T   H           N  C              C  GY  +  +  C+DIDEC      QC    ++C+ +PG   C  +           C D+DEC+++  NC+D   C N  G + C+                  C+ G++       C DVDEC  L+   G    C N+ G + C                                    +CNPGY    +  C+DIDEC      C H +C NT G FKC C  GY++ S++  C+DI+EC +    C            C N +G ++C     P    + + SS  ++ ++   T  Y         +PEN
Sbjct:  616 ACREGFRLSADGKSCEDVDECLVNNGGCQ--QVCRNLPGSYGCI----CAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDECLD-SNGQC---SQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCSDI--CINLLGTHACA------------------CERGYELAKDKLSCLDVDECAGLL-SGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSH-RCSNTEGSFKCSCPPGYELDSDQKTCQDIDECDQDKTSCITGT--------CINEIGGFRCEFPKFPVLPEIPTASSLPESPKIELKTPKYPDFTELSNEIPEN 1050          

HSP 2 Score: 114.005 bits (284), Expect = 8.443e-26
Identity = 109/384 (28.39%), Postives = 167/384 (43.49%), Query Frame = 3
Query:  360 DDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANI---CYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYE-ELNNATKECHCKSGFKRNLYTGK----------CEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN--ATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENV-CEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSS 1460
            D+T+ +C     +  E   C+DI+EC++   +C  +  C+N PG Y+C     C +G    +E  TC+  N C  +   C+   +C    G                  G   C+EG+R +     CED+DEC     +     +++C   PG   C        +K+  I   C+D+DEC++  + C+D   C N  G YTC  +   GY   L+N     H  +    +  T            C D+DEC      C +   C+NE G + C C  GY       TC DIDEC+     C  L C N PG F C C++G++++ +   C DI+EC++  G C            C NL+G++ C    C  GY +  +  S
Sbjct:  531 DNTSFSCICPTGYRSEAFSCQDIDECAEDTHLC--SHTCQNTPGGYQC----QCPEGLNL-VEEYTCLAENLCEVNNNGCE--QICLTARG------------------GVCACREGFRLSADGKSCEDVDECL----VNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTC--LCPPGYALGLDN-----HIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSH--FCQNEPGGFQCACPLGYALSEDMRTCQDIDECLDSNGQCSQL-CLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCSD---------ICINLLGTHAC---ACERGYELAKDKLS 861          

HSP 3 Score: 97.8265 bits (242), Expect = 1.162e-20
Identity = 132/490 (26.94%), Postives = 174/490 (35.51%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCI--------------------------------VKDYCGQGYEFNIETQTCIDLNEC-AQSLKYCDSGMV----CENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRW----------------NPLINI------CEDIDECTGPYRLQCEPFKEI-------------CVRKPGLSTCETQ--------------CSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCS-------------------EIKCEGYEE--LNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK-----NATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNEN-VCEDINE-------CTETPGI---CRIERLSLNN---RVECFNLVGSYKCLESICPSGYRVLSESSST 1463
            +C+ GY      K C DINEC+      +    C NLPGSY+C+                                    C  G++ + +   C D+NEC     +  D+  V    CEN IGSF C                  C EGY                  NP +N       C+D+ E  G YR  C    E+             C  + G+  C                 C  G    A  C D+DECAE+ + C+ T  C N  G Y C                    E+   G E+  L      C C+ GF+ +     CEDVDEC  L+   G +  C+N  G Y C C  GYE          C DIDEC      C   + CEN  G + C+C  GY +  +N +   +N         +ETP       I+  SL N      C N  G ++C    CP GY  LSE   T
Sbjct:  317 SCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRC-----------------TCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLPE--GSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLCSHT--CQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDEC--LVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQC---ACPLGY-ALSEDMRT 779          

HSP 4 Score: 95.5153 bits (236), Expect = 6.302e-20
Identity = 117/459 (25.49%), Postives = 176/459 (38.34%), Query Frame = 3
Query:  378 CESGYQFVFEE-KKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPP--------------------CPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDEC--TGPYRL--------QCE----PFKEICVRKPGLSTCETQCSGGT-----------IKIANICYDVD------------ECAENKNNC-TDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEF-----------------------------------------KNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSN----ENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRV 1442
            C  GY     +   C DI+EC +    C  +E C NLPG YKC     C +GY  +   ++C+D+NECA      +    CEN+ GS+ C  P                     P N      +G   C  G++ +     C+DI+EC   GP  L        +CE     F+  CV    L   +  C+  +            + A+ C D+             E +E++++C      C+   G   CS   C   E+  N +  C C +G++   ++  C+D+DEC     +C +   C+N  G Y CQC  G                                               +C D+DEC+     C  + C N PG + C+C +GY++         C DI+EC++    C  + L       C NL GSY CL   CP GY +
Sbjct:  276 CREGYTLDPNDYASCLDIDECLESNGGC--SEICENLPGEYKC----SCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAG-KTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASED--NTSFSCICPTGYRSEAFS--CQDIDECAEDTHLCSHT--CQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVNNGGCQQV-CRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQML-------CENLNGSYTCL---CPPGYAL 710          

HSP 5 Score: 52.7582 bits (125), Expect = 1.106e-6
Identity = 35/94 (37.23%), Postives = 49/94 (52.13%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPP 653
            + C  GY    ++K C DI+EC ++   C  +  C N  GS+KC     C  GYE + + +TC D++EC Q    C +G  C N IG F C  P
Sbjct:  925 IECNPGYTLGSDDK-CVDIDECQKQNGGC--SHRCSNTEGSFKC----SCPPGYELDSDQKTCQDIDECDQDKTSCITG-TCINEIGGFRCEFP 1010          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0301222)

HSP 1 Score: 121.324 bits (303), Expect = 5.152e-28
Identity = 124/475 (26.11%), Postives = 180/475 (37.89%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEF---NIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCR-PP------------------------CPTNKPH---------YWNSGCHQ------------CKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNC------------------------------------QCNPGYEF-KNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKM-SNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPEN 1538
             C  G++   + K C+D++EC      C   + CRNLPGSY CI    C  GYE    +     C D++EC+Q    C   M+CEN+ GS+ C  PP                          T   H           N  C              C  GY  +  +  C+DIDEC      QC    ++C+ +PG   C  +           C D+DEC+++  NC+D   C N  G + C+                  C+ G++       C DVDEC  L+   G    C N+ G + C                                    +CNPGY    +  C+DIDEC      C H +C NT G FKC C  GY++ S++  C+DI+EC +    C            C N +G ++C     P    + + SS  ++ ++   T  Y         +PEN
Sbjct:  616 ACREGFRLSADGKSCEDVDECLVNNGGCQ--QVCRNLPGSYGCI----CAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDECLD-SNGQC---SQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCSDI--CINLLGTHACA------------------CERGYELAKDKLSCLDVDECAGLL-SGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSH-RCSNTEGSFKCSCPPGYELDSDQKTCQDIDECDQDKTSCITGT--------CINEIGGFRCEFPKFPVLPEIPTASSLPESPKIELKTPKYPDFTELSNEIPEN 1050          

HSP 2 Score: 114.005 bits (284), Expect = 8.443e-26
Identity = 109/384 (28.39%), Postives = 167/384 (43.49%), Query Frame = 3
Query:  360 DDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANI---CYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYE-ELNNATKECHCKSGFKRNLYTGK----------CEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN--ATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENV-CEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSS 1460
            D+T+ +C     +  E   C+DI+EC++   +C  +  C+N PG Y+C     C +G    +E  TC+  N C  +   C+   +C    G                  G   C+EG+R +     CED+DEC     +     +++C   PG   C        +K+  I   C+D+DEC++  + C+D   C N  G YTC  +   GY   L+N     H  +    +  T            C D+DEC      C +   C+NE G + C C  GY       TC DIDEC+     C  L C N PG F C C++G++++ +   C DI+EC++  G C            C NL+G++ C    C  GY +  +  S
Sbjct:  531 DNTSFSCICPTGYRSEAFSCQDIDECAEDTHLC--SHTCQNTPGGYQC----QCPEGLNL-VEEYTCLAENLCEVNNNGCE--QICLTARG------------------GVCACREGFRLSADGKSCEDVDECL----VNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTC--LCPPGYALGLDN-----HIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSH--FCQNEPGGFQCACPLGYALSEDMRTCQDIDECLDSNGQCSQL-CLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCSD---------ICINLLGTHAC---ACERGYELAKDKLS 861          

HSP 3 Score: 97.8265 bits (242), Expect = 1.162e-20
Identity = 132/490 (26.94%), Postives = 174/490 (35.51%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCI--------------------------------VKDYCGQGYEFNIETQTCIDLNEC-AQSLKYCDSGMV----CENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRW----------------NPLINI------CEDIDECTGPYRLQCEPFKEI-------------CVRKPGLSTCETQ--------------CSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCS-------------------EIKCEGYEE--LNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK-----NATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNEN-VCEDINE-------CTETPGI---CRIERLSLNN---RVECFNLVGSYKCLESICPSGYRVLSESSST 1463
            +C+ GY      K C DINEC+      +    C NLPGSY+C+                                    C  G++ + +   C D+NEC     +  D+  V    CEN IGSF C                  C EGY                  NP +N       C+D+ E  G YR  C    E+             C  + G+  C                 C  G    A  C D+DECAE+ + C+ T  C N  G Y C                    E+   G E+  L      C C+ GF+ +     CEDVDEC  L+   G +  C+N  G Y C C  GYE          C DIDEC      C   + CEN  G + C+C  GY +  +N +   +N         +ETP       I+  SL N      C N  G ++C    CP GY  LSE   T
Sbjct:  317 SCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRC-----------------TCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLPE--GSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLCSHT--CQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDEC--LVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQC---ACPLGY-ALSEDMRT 779          

HSP 4 Score: 95.5153 bits (236), Expect = 6.302e-20
Identity = 117/459 (25.49%), Postives = 176/459 (38.34%), Query Frame = 3
Query:  378 CESGYQFVFEE-KKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPP--------------------CPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDEC--TGPYRL--------QCE----PFKEICVRKPGLSTCETQCSGGT-----------IKIANICYDVD------------ECAENKNNC-TDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEF-----------------------------------------KNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSN----ENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRV 1442
            C  GY     +   C DI+EC +    C  +E C NLPG YKC     C +GY  +   ++C+D+NECA      +    CEN+ GS+ C  P                     P N      +G   C  G++ +     C+DI+EC   GP  L        +CE     F+  CV    L   +  C+  +            + A+ C D+             E +E++++C      C+   G   CS   C   E+  N +  C C +G++   ++  C+D+DEC     +C +   C+N  G Y CQC  G                                               +C D+DEC+     C  + C N PG + C+C +GY++         C DI+EC++    C  + L       C NL GSY CL   CP GY +
Sbjct:  276 CREGYTLDPNDYASCLDIDECLESNGGC--SEICENLPGEYKC----SCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAG-KTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASED--NTSFSCICPTGYRSEAFS--CQDIDECAEDTHLCSHT--CQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVNNGGCQQV-CRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQML-------CENLNGSYTCL---CPPGYAL 710          

HSP 5 Score: 52.7582 bits (125), Expect = 1.106e-6
Identity = 35/94 (37.23%), Postives = 49/94 (52.13%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPP 653
            + C  GY    ++K C DI+EC ++   C  +  C N  GS+KC     C  GYE + + +TC D++EC Q    C +G  C N IG F C  P
Sbjct:  925 IECNPGYTLGSDDK-CVDIDECQKQNGGC--SHRCSNTEGSFKC----SCPPGYELDSDQKTCQDIDECDQDKTSCITG-TCINEIGGFRCEFP 1010          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0301221)

HSP 1 Score: 121.324 bits (303), Expect = 5.152e-28
Identity = 124/475 (26.11%), Postives = 180/475 (37.89%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEF---NIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCR-PP------------------------CPTNKPH---------YWNSGCHQ------------CKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNC------------------------------------QCNPGYEF-KNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKM-SNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPEN 1538
             C  G++   + K C+D++EC      C   + CRNLPGSY CI    C  GYE    +     C D++EC+Q    C   M+CEN+ GS+ C  PP                          T   H           N  C              C  GY  +  +  C+DIDEC      QC    ++C+ +PG   C  +           C D+DEC+++  NC+D   C N  G + C+                  C+ G++       C DVDEC  L+   G    C N+ G + C                                    +CNPGY    +  C+DIDEC      C H +C NT G FKC C  GY++ S++  C+DI+EC +    C            C N +G ++C     P    + + SS  ++ ++   T  Y         +PEN
Sbjct:  616 ACREGFRLSADGKSCEDVDECLVNNGGCQ--QVCRNLPGSYGCI----CAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTCQDIDECLD-SNGQC---SQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCSDI--CINLLGTHACA------------------CERGYELAKDKLSCLDVDECAGLL-SGGCSHECINKAGTFECGCPLGYILNDDGRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSH-RCSNTEGSFKCSCPPGYELDSDQKTCQDIDECDQDKTSCITGT--------CINEIGGFRCEFPKFPVLPEIPTASSLPESPKIELKTPKYPDFTELSNEIPEN 1050          

HSP 2 Score: 114.005 bits (284), Expect = 8.443e-26
Identity = 109/384 (28.39%), Postives = 167/384 (43.49%), Query Frame = 3
Query:  360 DDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANI---CYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYE-ELNNATKECHCKSGFKRNLYTGK----------CEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN--ATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENV-CEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSS 1460
            D+T+ +C     +  E   C+DI+EC++   +C  +  C+N PG Y+C     C +G    +E  TC+  N C  +   C+   +C    G                  G   C+EG+R +     CED+DEC     +     +++C   PG   C        +K+  I   C+D+DEC++  + C+D   C N  G YTC  +   GY   L+N     H  +    +  T            C D+DEC      C +   C+NE G + C C  GY       TC DIDEC+     C  L C N PG F C C++G++++ +   C DI+EC++  G C            C NL+G++ C    C  GY +  +  S
Sbjct:  531 DNTSFSCICPTGYRSEAFSCQDIDECAEDTHLC--SHTCQNTPGGYQC----QCPEGLNL-VEEYTCLAENLCEVNNNGCE--QICLTARG------------------GVCACREGFRLSADGKSCEDVDECL----VNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTC--LCPPGYALGLDN-----HIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSH--FCQNEPGGFQCACPLGYALSEDMRTCQDIDECLDSNGQCSQL-CLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCSD---------ICINLLGTHAC---ACERGYELAKDKLS 861          

HSP 3 Score: 97.8265 bits (242), Expect = 1.162e-20
Identity = 132/490 (26.94%), Postives = 174/490 (35.51%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCI--------------------------------VKDYCGQGYEFNIETQTCIDLNEC-AQSLKYCDSGMV----CENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRW----------------NPLINI------CEDIDECTGPYRLQCEPFKEI-------------CVRKPGLSTCETQ--------------CSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCS-------------------EIKCEGYEE--LNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK-----NATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNEN-VCEDINE-------CTETPGI---CRIERLSLNN---RVECFNLVGSYKCLESICPSGYRVLSESSST 1463
            +C+ GY      K C DINEC+      +    C NLPGSY+C+                                    C  G++ + +   C D+NEC     +  D+  V    CEN IGSF C                  C EGY                  NP +N       C+D+ E  G YR  C    E+             C  + G+  C                 C  G    A  C D+DECAE+ + C+ T  C N  G Y C                    E+   G E+  L      C C+ GF+ +     CEDVDEC  L+   G +  C+N  G Y C C  GYE          C DIDEC      C   + CEN  G + C+C  GY +  +N +   +N         +ETP       I+  SL N      C N  G ++C    CP GY  LSE   T
Sbjct:  317 SCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRC-----------------TCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLPE--GSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLCSHT--CQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDEC--LVNNGGCQQVCRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQC---ACPLGY-ALSEDMRT 779          

HSP 4 Score: 95.5153 bits (236), Expect = 6.302e-20
Identity = 117/459 (25.49%), Postives = 176/459 (38.34%), Query Frame = 3
Query:  378 CESGYQFVFEE-KKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPP--------------------CPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDEC--TGPYRL--------QCE----PFKEICVRKPGLSTCETQCSGGT-----------IKIANICYDVD------------ECAENKNNC-TDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEF-----------------------------------------KNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSN----ENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRV 1442
            C  GY     +   C DI+EC +    C  +E C NLPG YKC     C +GY  +   ++C+D+NECA      +    CEN+ GS+ C  P                     P N      +G   C  G++ +     C+DI+EC   GP  L        +CE     F+  CV    L   +  C+  +            + A+ C D+             E +E++++C      C+   G   CS   C   E+  N +  C C +G++   ++  C+D+DEC     +C +   C+N  G Y CQC  G                                               +C D+DEC+     C  + C N PG + C+C +GY++         C DI+EC++    C  + L       C NL GSY CL   CP GY +
Sbjct:  276 CREGYTLDPNDYASCLDIDECLESNGGC--SEICENLPGEYKC----SCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPAG-KTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHECQDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASED--NTSFSCICPTGYRSEAFS--CQDIDECAEDTHLCSHT--CQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVNNGGCQQV-CRNLPGSYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQML-------CENLNGSYTCL---CPPGYAL 710          

HSP 5 Score: 52.7582 bits (125), Expect = 1.106e-6
Identity = 35/94 (37.23%), Postives = 49/94 (52.13%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPP 653
            + C  GY    ++K C DI+EC ++   C  +  C N  GS+KC     C  GYE + + +TC D++EC Q    C +G  C N IG F C  P
Sbjct:  925 IECNPGYTLGSDDK-CVDIDECQKQNGGC--SHRCSNTEGSFKC----SCPPGYELDSDQKTCQDIDECDQDKTSCITG-TCINEIGGFRCEFP 1010          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Zebrafish
Match: BX663503.3 (latent-transforming growth factor beta-binding protein 4 [Source:NCBI gene;Acc:100333499])

HSP 1 Score: 157.918 bits (398), Expect = 8.330e-40
Identity = 135/434 (31.11%), Postives = 186/434 (42.86%), Query Frame = 3
Query:  345 RCVDMDDTNVTC--ESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCS--------------------EIKCEGYEELNN-ATKEC-HCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNC----------------------------------------QCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINEC---TETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVL 1445
            RC+D+     TC   +G+    ++  C+D NEC      C + E C N PGS++C+    C  GY+ N +   C+DL+EC Q    C +G  CEN +GSF C                  C+ GY+     N C DIDEC  P R    P KE CV   G   C   C  G   +   C D+DEC    + C D  RC N  G + CS                      +C G E LN+  +  C  C+ GF   L  G C D+DEC      C N G C+N +G + C                                         C PG+  +N  C DIDEC    D+C + +CENT G + C C+ G+++  EN+C+D+NEC    + PG+            EC N VGS+KC+   C  G+++L
Sbjct:  804 RCIDLPGGRHTCVCNTGFILNPQQGHCQDKNECVLTPRPCSVGE-CVNTPGSFRCV----CPAGYQTNSQQTLCVDLDECRQVPNPCINGR-CENTLGSFRC-----------------VCRTGYKLQD--NSCIDIDECVDPLRC---PGKE-CVNSQGSYRC-VSCRPGFDLLNGQCSDIDECRRTPSPCPDG-RCENTAGSFRCSCRTGYRLQANTCVDVNECEDPSQCPGQECLNSQGSYRCVSCRPGF--GLRNGACSDIDECRQTPSPCQN-GLCENTLGSFRCVCRTGYRLQGGTCTDVNECEDPSQCPGQECLNSQGSYRCVSCRPGFGLRNGACSDIDECRQTPDLCVNGRCENTMGSYSCSCRPGFRL-EENICKDVNECENELQCPGM------------ECVNSVGSFKCVS--CKPGFQLL 1188          

HSP 2 Score: 130.954 bits (328), Expect = 4.158e-31
Identity = 112/359 (31.20%), Postives = 167/359 (46.52%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNC-QCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLS 1448
            +C +GY+   +   C D+NEC   +      + C N  GSY+C+    C  G  F +    C D++EC Q+   C +G+ CEN +GSF C                  C+ GYR       C D++EC  P   QC P +E C+   G   C   C  G       C D+DEC +  + C +  RC N  G Y+CS                  C+ GF+  L    C+DV+EC++ +   G +  C N +G + C  C PG++  +  C D+DEC      C + +C+NTPG F+CVC  G+ +  + VC D++EC + P  C  +        +C N  GSYKC+   C  G+ + S
Sbjct:  980 SCRTGYRL--QANTCVDVNECEDPSQC--PGQECLNSQGSYRCV---SCRPG--FGLRNGACSDIDECRQTPSPCQNGL-CENTLGSFRC-----------------VCRTGYRLQG--GTCTDVNECEDPS--QC-PGQE-CLNSQGSYRC-VSCRPGFGLRNGACSDIDECRQTPDLCVNG-RCENTMGSYSCS------------------CRPGFR--LEENICKDVNECENELQCPGME--CVNSVGSFKCVSCKPGFQLLDGQCQDVDECSRTPRRCTNGQCKNTPGSFRCVCDVGFHL-QDGVCTDMDECVD-PLQCPGQ--------QCINSPGSYKCVP--CRDGHSMQS 1269          

HSP 3 Score: 98.2117 bits (243), Expect = 1.272e-20
Identity = 96/324 (29.63%), Postives = 131/324 (40.43%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSF---NCRPP-------------CPTNKPHYWNSGCHQCKEGYR------WNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDEC---DSLIPVCGNKGRCKNEIGRYNCQCNPGYE--FKNATCLDIDECVSLKDICGHLKCENTPGFFKC 1262
            V+C  G  F      C DI+EC Q  D+C +N  C N  GSY C  +        F +E   C D+NEC   L+    GM C N +GSF   +C+P              C        N  C      +R      ++    +C D+DEC  P  LQC    + C+  PG   C   C  G    +  C D+DEC  ++  C     C N  G Y                   C C  G++      +C D++EC   D   P    +G C N  G Y C C+ GY+      +C D+DEC +L  +C   +C NT G F C
Sbjct: 1099 VSCRPG--FGLRNGACSDIDECRQTPDLC-VNGRCENTMGSYSCSCRP------GFRLEENICKDVNECENELQC--PGMECVNSVGSFKCVSCKPGFQLLDGQCQDVDECSRTPRRCTNGQCKNTPGSFRCVCDVGFHLQDGVCTDMDECVDP--LQCP--GQQCINSPGSYKC-VPCRDGHSMQSGRCTDIDECVSDQV-CGAQSVCVNTDGSY------------------RCDCAPGYRAAGAGRQCRDINECLEGDFCFP----RGECVNTDGSYKCVCSQGYKSVANGTSCQDVDEC-ALDGVCQDGRCSNTEGSFLC 1382          

HSP 4 Score: 50.8322 bits (120), Expect = 6.217e-6
Identity = 31/93 (33.33%), Postives = 49/93 (52.69%), Query Frame = 3
Query: 1185 DIDECVSLKDICGHLKCENTPGF-FKCVCKSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESS 1457
            D+  C S   +CG  +C + PG    CVC +G+ ++  +  C+D NEC  TP  C +         EC N  GS++C   +CP+GY+  S+ +
Sbjct:  789 DVRVCESRPQVCGPGRCIDLPGGRHTCVCNTGFILNPQQGHCQDKNECVLTPRPCSVG--------ECVNTPGSFRC---VCPAGYQTNSQQT 870          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Zebrafish
Match: hmcn2 (hemicentin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9765])

HSP 1 Score: 156.377 bits (394), Expect = 3.874e-39
Identity = 114/398 (28.64%), Postives = 177/398 (44.47%), Query Frame = 3
Query:  354 DMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQS-LKYCDSGMVCENVIGSFNC--------------------RPPCPTNKPHYWNSGCHQCKEGYRWNPLI---NICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTC----------SEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPV-CGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKM-SNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            +M   +  C SG+    E   C+DI+ECSQ + +CH N+ C N  G+Y+C  K  CG G++ ++   +C D++EC +S +  C     C N +GSF C                    R  CP ++      G +QC +            +C DIDEC     + C  + +IC    G   C       +  +   C D+DECA+  + C    +C N  G + C              C G E  +  T     ++  +  L +          S++P   G+  R ++E       C  GY  K+ TC+DIDEC + +  C H +C NT G ++C C  GY++ SN   C+DI+ECT     C   ++       CFN  G Y+CL++ CP+ Y+
Sbjct: 3708 NMGGFSCACPSGFTISTESNSCQDIDECSQGSHLCHPNQQCVNTVGTYRCQAK--CGLGFKPSLVGTSCEDVDECQESAVSPCQQQ--CFNTLGSFRCTCHPGYQLVGHRCLDINECLRNVCPAHQQCRNTDGGYQCFDSCPAGMTAAENGVCVDIDECQDGSHM-CR-YSQICQNTIGGYGCVCPRGYRSQGVGRPCLDIDECAQVPSPCA--FQCRNVPGSFRCVCPPGTVLLGDGRSCAGLERGHIFTNSTRVQARLRPQLVSALERPYLTRLSVLPEHLGSSRRPRHE-------CPVGYTSKDGTCIDIDEC-AFRKPCQH-ECRNTIGSYQCTCPPGYQLLSNGRTCKDIDECTVQGVQCGPNQM-------CFNTRGGYQCLDTPCPNSYQ 4081          

HSP 2 Score: 132.88 bits (333), Expect = 1.391e-31
Identity = 87/304 (28.62%), Postives = 126/304 (41.45%), Query Frame = 3
Query:  375 TCESGYQFVFEEKK-CKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNA--TCLDIDECVSLKDICGHLKCENTPGFFKCVCKSG 1277
            TC  G  F+ +    C D +EC+  +   H    C N  G + C     C  G+  + E+ +C D++EC+Q    C     C N +G++ C+                +C  G++ + +   CED+DEC         P ++ C    G   C   C  G   + + C D++EC   +N C   Q+C N  G Y C +    G     N                 G C D+DEC     +C     C+N IG Y C C  GY  +     CLDIDEC  +   C   +C N PG F+CVC  G
Sbjct: 3676 TCPKG--FILDTASYCADEDECAVDSPCSH---SCNNNMGGFSCA----CPSGFTISTESNSCQDIDECSQGSHLCHPNQQCVNTVGTYRCQA---------------KCGLGFKPSLVGTSCEDVDECQ---ESAVSPCQQQCFNTLGSFRC--TCHPGYQLVGHRCLDINECL--RNVCPAHQQCRNTDGGYQCFDSCPAGMTAAEN-----------------GVCVDIDECQDGSHMCRYSQICQNTIGGYGCVCPRGYRSQGVGRPCLDIDECAQVPSPCA-FQCRNVPGSFRCVCPPG 3930          

HSP 3 Score: 107.457 bits (267), Expect = 1.665e-23
Identity = 70/250 (28.00%), Postives = 104/250 (41.60%), Query Frame = 3
Query:  831 ETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQ--------------------------------------------CNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCV--CKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            ET   G  +  A+ C D DECA + + C+ +  CNN  G ++C+                  C SGF  +  +  C+D+DEC     +C    +C N +G Y CQ                                            C+PGY+     CLDI+EC  L+++C  H +C NT G ++C   C +G   +   VC DI+EC +   +CR  ++       C N +G Y C   +CP GYR
Sbjct: 3675 ETCPKGFILDTASYCADEDECAVD-SPCSHS--CNNNMGGFSCA------------------CPSGFTISTESNSCQDIDECSQGSHLCHPNQQCVNTVGTYRCQAKCGLGFKPSLVGTSCEDVDECQESAVSPCQQQCFNTLGSFRCTCHPGYQLVGHRCLDINEC--LRNVCPAHQQCRNTDGGYQCFDSCPAGMTAAENGVCVDIDECQDGSHMCRYSQI-------CQNTIGGYGC---VCPRGYR 3891          

HSP 4 Score: 55.8398 bits (133), Expect = 1.593e-7
Identity = 34/105 (32.38%), Postives = 47/105 (44.76%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNC-RPPCPTNKPHYWNSG 689
            C  GY    ++  C DI+EC+ +    H    CRN  GSY+C     C  GY+     +TC D++EC      C    +C N  G + C   PCP +     N G
Sbjct: 3992 CPVGY--TSKDGTCIDIDECAFRKPCQH---ECRNTIGSYQCT----CPPGYQLLSNGRTCKDIDECTVQGVQCGPNQMCFNTRGGYQCLDTPCPNSYQRGRNPG 4087          

HSP 5 Score: 55.4546 bits (132), Expect = 2.073e-7
Identity = 39/131 (29.77%), Postives = 54/131 (41.22%), Query Frame = 3
Query:  249 PNNEC-AKYTEWDPVLKKCQDCQFNKVYNETLRRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSF 638
            P +EC   YT  D       +C F K      R  +       TC  GYQ +   + CKDI+EC+ +   C  N+ C N  G Y+C+    C   Y+      TC          + C S + C +V GSF
Sbjct: 3988 PRHECPVGYTSKDGTCIDIDECAFRKPCQHECRNTIG--SYQCTCPPGYQLLSNGRTCKDIDECTVQGVQCGPNQMCFNTRGGYQCL-DTPCPNSYQRGRNPGTC---------FRPCSSRLDCGSV-GSF 4105          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Zebrafish
Match: BX663503.3 (latent-transforming growth factor beta-binding protein 4 [Source:NCBI gene;Acc:100333499])

HSP 1 Score: 155.221 bits (391), Expect = 6.805e-39
Identity = 135/434 (31.11%), Postives = 186/434 (42.86%), Query Frame = 3
Query:  345 RCVDMDDTNVTC--ESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCS--------------------EIKCEGYEELNN-ATKEC-HCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNC----------------------------------------QCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINEC---TETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVL 1445
            RC+D+     TC   +G+    ++  C+D NEC      C + E C N PGS++C+    C  GY+ N +   C+DL+EC Q    C +G  CEN +GSF C                  C+ GY+     N C DIDEC  P R    P KE CV   G   C   C  G   +   C D+DEC    + C D  RC N  G + CS                      +C G E LN+  +  C  C+ GF   L  G C D+DEC      C N G C+N +G + C                                         C PG+  +N  C DIDEC    D+C + +CENT G + C C+ G+++  EN+C+D+NEC    + PG+            EC N VGS+KC+   C  G+++L
Sbjct:  563 RCIDLPGGRHTCVCNTGFILNPQQGHCQDKNECVLTPRPCSVGE-CVNTPGSFRCV----CPAGYQTNSQQTLCVDLDECRQVPNPCINGR-CENTLGSFRC-----------------VCRTGYKLQD--NSCIDIDECVDPLRC---PGKE-CVNSQGSYRC-VSCRPGFDLLNGQCSDIDECRRTPSPCPDG-RCENTAGSFRCSCRTGYRLQANTCVDVNECEDPSQCPGQECLNSQGSYRCVSCRPGF--GLRNGACSDIDECRQTPSPCQN-GLCENTLGSFRCVCRTGYRLQGGTCTDVNECEDPSQCPGQECLNSQGSYRCVSCRPGFGLRNGACSDIDECRQTPDLCVNGRCENTMGSYSCSCRPGFRL-EENICKDVNECENELQCPGM------------ECVNSVGSFKCVS--CKPGFQLL 947          

HSP 2 Score: 145.976 bits (367), Expect = 6.671e-36
Identity = 128/386 (33.16%), Postives = 178/386 (46.11%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCS--------------------EIKCEGYEELNNAT--KECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLK-CENTPGFFKCVCKSGYKMSNEN-VCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSS 1460
            +C +GY+   +   C D+NEC   +      + C N  GSY+C+    C  G  F +    C D++EC Q+   C +G+ CEN +GSF C                  C+ GYR       C D++EC  P   QC P +E C+   G   C   C  G       C D+DEC +  + C +  RC N  G Y+CS                    E++C G E +N+    K   CK GF+  L  G+C+DVDEC      C N G+CKN  G + C C+ G+  ++  C DIDECVS   +CG    C NT G ++C C  GY+ +     C DINEC        +E      R EC N  GSYKC   +C  GY+ ++  +S
Sbjct:  739 SCRTGYRL--QANTCVDVNECEDPSQC--PGQECLNSQGSYRCVS---CRPG--FGLRNGACSDIDECRQTPSPCQNGL-CENTLGSFRC-----------------VCRTGYRLQG--GTCTDVNECEDPS--QC-PGQE-CLNSQGSYRC-VSCRPGFGLRNGACSDIDECRQTPDLCVNG-RCENTMGSYSCSCRPGFRLEENICKDVNECENELQCPGMECVNSVGSFKCVSCKPGFQ--LLDGQCQDVDECSRTPRRCTN-GQCKNTPGSFRCVCDVGFHLQDGVCTDIDECVS-DQVCGAQSVCVNTDGSYRCDCAPGYRAAGAGRQCRDINEC--------LEGDFCFPRGECVNTDGSYKC---VCSQGYKSVANGTS 1074          

HSP 3 Score: 119.783 bits (299), Expect = 1.880e-27
Identity = 124/425 (29.18%), Postives = 177/425 (41.65%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTC----------SEIKCEGYEEL--------------NNATKECHCKSGFKRNLYTGKCEDVDEC-------------------------DSLIPVCGNKGRCKNEIGRYNC--QCNPGYEFKN-ATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNEN-VCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC-----LESICPSGYRVLSESSSTKA 1469
            V+C  G  F      C DI+EC Q  D+C +N  C N  GSY C  +        F +E   C D+NEC   L+    GM C N +GSF C                  CK G++   L   C+D+DEC+   R +C   +  C   PG   C   C  G      +C D+DEC  ++  C     C N  G Y C          +  +C    E                + + +C C  G+K       C+DVDEC                         DS   +CG++ RC+N IG ++C   C PGY+  + A C+D++EC + + +CG H  C+N  G + C+C  GY+ + +  +C DINEC    G+C   R        C+N+ GS+ C      E   P   R LS   +  A
Sbjct:  858 VSCRPG--FGLRNGACSDIDECRQTPDLC-VNGRCENTMGSYSCSCRP------GFRLEENICKDVNECENELQC--PGMECVNSVGSFKC----------------VSCKPGFQL--LDGQCQDVDECSRTPR-RCTNGQ--CKNTPGSFRC--VCDVGFHLQDGVCTDIDECVSDQV-CGAQSVCVNTDGSYRCDCAPGYRAAGAGRQCRDINECLEGDFCFPRGECVNTDGSYKCVCSQGYKSVANGTSCQDVDECALDGVCQDGRCSNTEGSFLYVNECQDSTGLICGSQ-RCENTIGSFHCVASCEPGYQITSTAECVDVNECAN-ETVCGAHAFCQNLIGTYHCLCDQGYESTGDGKICVDINECEAMQGVCGSAR--------CWNVEGSFTCECENGQEEFDPIAGRCLSREGTASA 1237          

HSP 4 Score: 77.0258 bits (188), Expect = 4.241e-14
Identity = 88/308 (28.57%), Postives = 125/308 (40.58%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYR-WNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGG-----TIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPG--YEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCK 1271
             +CE GYQ +    +C D+NEC+ +  +C  + +C+NL G+Y C+    C QGYE   + + C+D+NEC      C S   C NV GSF C                 +C+ G   ++P+   C   +      R        +   +PG    + +C  G     + KI  +   + EC      CT  Q       Y  C E     ++ L    K          N      +DVDEC    P     G C N I  Y C C  G  Y+ +   C D DEC S +D C   +C NT G F C C+
Sbjct: 1129 ASCEPGYQ-ITSTAECVDVNECANET-VCGAHAFCQNLIGTYHCL----CDQGYESTGDGKICVDINECEAMQGVCGSAR-CWNVEGSFTC-----------------ECENGQEEFDPIAGRCLSREGTASASR-------SLPQSRPGE---QKECYYGISQPYSCKILAVNTTLQECC-----CTAGQGWGLMCKYDICPEAGTAEFQTLCPNGKGYVTTEAGAFNY-----KDVDECKLFDPEVCKGGTCVNNIPGYACYCRSGSYYDTELLECTDNDECES-EDTCSGGRCVNTQGTFYCTCE 1391          

HSP 5 Score: 50.0618 bits (118), Expect = 9.954e-6
Identity = 31/93 (33.33%), Postives = 49/93 (52.69%), Query Frame = 3
Query: 1185 DIDECVSLKDICGHLKCENTPGF-FKCVCKSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESS 1457
            D+  C S   +CG  +C + PG    CVC +G+ ++  +  C+D NEC  TP  C +         EC N  GS++C   +CP+GY+  S+ +
Sbjct:  548 DVRVCESRPQVCGPGRCIDLPGGRHTCVCNTGFILNPQQGHCQDKNECVLTPRPCSVG--------ECVNTPGSFRC---VCPAGYQTNSQQT 629          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Zebrafish
Match: fbln2 (fibulin 2 [Source:ZFIN;Acc:ZDB-GENE-060711-1])

HSP 1 Score: 148.673 bits (374), Expect = 7.650e-37
Identity = 140/505 (27.72%), Postives = 209/505 (41.39%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDEC-TGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECV-SLKDICGHLKCENTPGFFKCVCKS-GYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEI-PIEVLNYDHYHVKV---NVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFV 1856
            + C SGYQ       C+DI+EC  +   C +   C+N  GS+ C  K  C  G+  +     CID++EC+   + C +G  C N +GS+ C+                 C  GY  +P    C D+DEC TG +R       +IC   PG   C+ Q       I  +C DV+EC          Q C N  G Y CS                  C +GF        CED++ECDS    C  +  C N  G Y C C  GY  K    TC DIDEC  S+ ++C   +C N PG + C C   GY MS N   C+DI+EC      C   +        CFN+ G ++CL   CP  YR +S+    +    +Y  C         Q +P  + Y  +  + +  +P +I  I P    + D+  + +   N    F+T+                       V++   + +  +  +D+ +KL  Q T   + L  +++F+
Sbjct:  973 ILCSSGYQL--RNGVCEDIDECVIRTHNCGMGFQCQNTDGSFTCKPKQRCLTGFTQDSHG-NCIDIDECSSVREPCTTGFNCINTVGSYTCQ------------RKIIMCSRGYHSSPDGARCIDVDECQTGTHRCG---EGQICHNLPGSHRCDCQTGYQYDTIRQLCVDVNECWRYPGRLC-AQTCENTPGSYQCS------------------CTTGFSLAFDGKNCEDINECDS--NPCSQE--CANIYGSYQCYCRAGYYLKEDGHTCEDIDECSQSIGNLCA-FECVNVPGSYTCACPPHGYSMSANGRTCQDIDECAIGSHNCSASQT-------CFNIQGGFRCLLFECPDNYRRVSDIRCERMSCPNYQQC---------QTMPLRITYYQLSFQTNIVIPAQIFRIGPSPAYSGDNIIISIPRGNEDGYFSTRKLNSF---------------TGAVYLHRQVREPRDFFIDVEMKLLRQGTFTTF-LARIYVFI 1403          

HSP 2 Score: 131.724 bits (330), Expect = 2.393e-31
Identity = 108/361 (29.92%), Postives = 155/361 (42.94%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKC-IVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQ---CSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN--ATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENV-CEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            +C  G+    +   C+D+NEC      C ++E C+N  GSY+C  V + C +G+  +   + C+D+NEC  +   C +   C N +G F C                  C  GY+      +CEDIDEC    R         C    G  TC+ +    +G T      C D+DEC+  +  CT    C N  G YTC               K   C  G+  +    +C DVDEC +    CG    C N  G + C C  GY++      C+D++EC           CENTPG ++C C +G+ ++ +   CEDINEC   P              EC N+ GSY+C    C +GY
Sbjct:  880 SCFPGFFLKPDGHTCEDVNECLNGRHNCSLDEVCKNHEGSYQCERVNEMCHKGF-IHKHNRDCVDVNECVTNTHTCRADERCVNSVGGFVCERMI-------------LCSSGYQLR--NGVCEDIDECV--IRTHNCGMGFQCQNTDGSFTCKPKQRCLTGFTQDSHGNCIDIDECSSVREPCTTGFNCINTVGSYTCQR-------------KIIMCSRGYHSSPDGARCIDVDECQTGTHRCGEGQICHNLPGSHRCDCQTGYQYDTIRQLCVDVNECWRYPGRLCAQTCENTPGSYQCSCTTGFSLAFDGKNCEDINECDSNPC-----------SQECANIYGSYQCY---CRAGY 1195          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Zebrafish
Match: hmcn1 (hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322])

HSP 1 Score: 145.591 bits (366), Expect = 1.145e-35
Identity = 111/391 (28.39%), Postives = 162/391 (41.43%), Query Frame = 3
Query:  300 CQDCQFNKVYNETLRRCVD-MDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNY----FGYYTCSEIK-----CEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYK-MSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            C D    +  N   + C++ +      CE GYQ     ++C DINEC Q+  +C  ++ C+N  G Y CI  D C  G        TCID++EC      C    +CEN  GS++C                  C  GYR   +   C DI+EC     L   P    CV  PG   C             +C        +  +C   +R  +Y    +GY T           + Y  L + +   +  +G +                 +    N    +N    Y C    G++ KN  CLDI+EC   +D C H +C NTPG  +C+C SGY+ M+N   C+DI+EC E    C   R+       CFN+ GSY+C+++ CP  Y+
Sbjct: 5165 CSDVNECQESNPCHQHCLNTIGSFRCACEPGYQL--RNRRCIDINECKQR--VCRSDQQCKNTRGGYTCI--DLCPTGMTKG-GNGTCIDIDECHDGTHQCRYNQICENTRGSYHC-----------------TCPRGYRSQGVGRPCLDINEC----ELVPVPCAYQCVNSPGSYKC-------------LCPPGLHLLGDGKSCAGLERLPSYETFSYGYRTSQSSSDRSSYLQRYHSLTSQSYHSYVPNGGRH----------------VANRPNSAPSRNRRSTYICP--HGFKTKNGHCLDINEC-EQRDTCQH-ECMNTPGSHRCLCPSGYRLMTNGKTCQDIDECLEQNIQCGANRM-------CFNMRGSYQCIDTPCPPNYQ 5487          

HSP 2 Score: 123.635 bits (309), Expect = 1.238e-28
Identity = 84/277 (30.32%), Postives = 115/277 (41.52%), Query Frame = 3
Query:  693 HQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIAN--ICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCV--CKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR---VLSESSSTKACQLSYPTCSY 1499
            +QC  G++ +P    C D +EC     ++  P    C    G   C   C  G    A+   C D+DEC+   + C D Q C N  G Y C                   C  GF+R      C DV+EC    P       C N IG + C C PGY+ +N  C+DI+EC   + +C    +C+NT G + C+  C +G        C DI+EC +    CR  ++       C N  GSY C    CP GYR   V         C+L    C+Y
Sbjct: 5065 NQCPSGFQLDPTGPYCSDENEC-----VEGNPCSHACHNAIGTYYC--SCPRGLTISADGRTCQDIDECSLGGHMCHDGQDCENTIGSYRCV----------------MRCGRGFRRTADGLSCSDVNECQESNPC---HQHCLNTIGSFRCACEPGYQLRNRRCIDINECK--QRVCRSDQQCKNTRGGYTCIDLCPTGMTKGGNGTCIDIDECHDGTHQCRYNQI-------CENTRGSYHC---TCPRGYRSQGVGRPCLDINECELVPVPCAY 5303          

HSP 3 Score: 116.316 bits (290), Expect = 2.786e-26
Identity = 89/305 (29.18%), Postives = 127/305 (41.64%), Query Frame = 3
Query:  252 NNECAKYTEWDPVLKKCQDCQFNKVYNETLRRCVDMDDTN-VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIAN-ICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPV-CGNKGRCKNEIGRYNCQCNPG 1157
            +N+C    + DP    C D       N     C +   T   +C  G     + + C+DI+ECS    +CH  + C N  GSY+C+++  CG+G+    +  +C D+NEC +S   C     C N IGSF C                  C+ GY+       C DI+EC    +  C   ++ C    G  TC   C  G  K  N  C D+DEC +  + C   Q C N  G Y C+                  C  G++       C D++EC+ L+PV C  +  C N  G Y C C PG
Sbjct: 5064 SNQCPSGFQLDPTGPYCSDENECVEGNPCSHACHNAIGTYYCSCPRGLTISADGRTCQDIDECSLGGHMCHDGQDCENTIGSYRCVMR--CGRGFRRTADGLSCSDVNECQES-NPCHQH--CLNTIGSFRC-----------------ACEPGYQLRN--RRCIDINECK---QRVCRSDQQ-CKNTRGGYTCIDLCPTGMTKGGNGTCIDIDECHDGTHQCRYNQICENTRGSYHCT------------------CPRGYRSQGVGRPCLDINECE-LVPVPCAYQ--CVNSPGSYKCLCPPG 5319          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000044417.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:16691548:16699432:-1 gene:ENSXETG00000002183.1 transcript:ENSXETT00000044417.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 159.073 bits (401), Expect = 8.994e-41
Identity = 123/384 (32.03%), Postives = 174/384 (45.31%), Query Frame = 3
Query:  330 NETLRRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCE-GYEELNN-----------------------ATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC 1409
            NE L       + +  CE    F   + KC DI+EC  K  IC     C+N PGS+ C  +        F+    +C+D+NEC Q+   C    +C N  GS++C                  CK G+  + +I  C+DIDEC+    + C+ +  +C+  PG   C  QC+ G   + N C D+DEC     NC     C N  G Y+C   +C+ G+  +N+                        +  C CK GF+ + +   C+DVDEC S   VCG   RC+N  G ++C CN G+   N +C DI+EC        H  C NT G F C CKSG+   N   CED+NEC   P +C +         +C N VGS+ C
Sbjct:   68 NECLSSTCINSEGSFRCECPLGFTVSDFKCTDIDEC--KNGICSPFASCQNSPGSFTCSCRS------GFSGNGTSCVDVNECIQNNGGCHGNAICNNTQGSYSC-----------------SCKGGFVGDGIIQ-CKDIDECSENSGI-CQ-YGGLCLNTPGSFRC--QCASGFQALNNTCQDIDECKTVNGNCPLNALCQNSLGSYSC---QCKAGFSGINSCSDIDECLSNPCHAQATYCINTQGSYSCTCKEGFRGDGF--NCKDVDEC-SASGVCGENSRCENSFGSFSCWCNSGFTMTNGSCADINECSPPHPCNEHANCNNTKGSFLCKCKSGFS-GNGTTCEDVNECGFEPPVCPLNS-------QCINEVGSFYC 407          

HSP 2 Score: 144.821 bits (364), Expect = 7.046e-36
Identity = 120/354 (33.90%), Postives = 159/354 (44.92%), Query Frame = 3
Query:  414 KCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTC-------------SEIK-------CEGYEELNNATKE--CHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC 1409
            +CKDI+ECS+ + IC     C N PGS++C     C  G  F     TC D++EC      C    +C+N +GS++C                 QCK G+     IN C DIDEC       C      C+   G  +C   C  G       C DVDEC+     C +  RC N FG ++C             ++I        C  +   NN      C CKSGF  N  T  CEDV+EC    PVC    +C NE+G + C+C  GYE   + CLDIDEC+       H  C N+PG + C+C  G+   N + CEDINEC +     R       N  +C N +GS+ C
Sbjct:  177 QCKDIDECSENSGICQYGGLCLNTPGSFRC----QCASG--FQALNNTCQDIDECKTVNGNCPLNALCQNSLGSYSC-----------------QCKAGFSG---INSCSDIDEC---LSNPCHAQATYCINTQGSYSC--TCKEGFRGDGFNCKDVDECSA-SGVCGENSRCENSFGSFSCWCNSGFTMTNGSCADINECSPPHPCNEHANCNNTKGSFLCKCKSGFSGNGTT--CEDVNECGFEPPVCPLNSQCINEVGSFYCECWEGYEKNGSLCLDIDECLHPSMCHHHSVCINSPGSYDCICVEGFT-GNGSFCEDINECEQENITHRCH-----NGSQCINTMGSFIC 490          

HSP 3 Score: 90.5077 bits (223), Expect = 2.496e-18
Identity = 66/221 (29.86%), Postives = 103/221 (46.61%), Query Frame = 3
Query:  840 CSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTC---SEIKCEGYE--ELNN----------ATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSES 1454
            C  G      +C D++ECA + + C     C N  G Y+C   S    +G+   ++N            +  C C  GF  + +  KC D+DEC +   +C     C+N  G + C C  G+     +C+D++EC+     C G+  C NT G + C CK G+       C+DI+EC+E  GIC+   L       C N  GS++C    C SG++ L+ +
Sbjct:   12 CKTGFDGDGTVCTDINECAASLHKCHKDSACVNTVGSYSCVCKSGYTGDGFACTDINECLSSTCINSEGSFRCECPLGFTVSDF--KCTDIDECKN--GICSPFASCQNSPGSFTCSCRSGFSGNGTSCVDVNECIQNNGGCHGNAICNNTQGSYSCSCKGGFVGDGIIQCKDIDECSENSGICQYGGL-------CLNTPGSFRCQ---CASGFQALNNT 218          

HSP 4 Score: 88.9669 bits (219), Expect = 7.647e-18
Identity = 89/297 (29.97%), Postives = 130/297 (43.77%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECD--SLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDEC-VSLKDICGHLKCENTPGFF 1256
            TC+ G++   +   CKD++ECS    +C  N  C N  GS+ C    +C  G  F +   +C D+NEC+     C+    C N  GSF C+                 CK G+  N     CED++EC   +     P    C+ + G   CE  C  G  K  ++C D+DEC    + C     C N  G Y                  +C C  GF  N     CED++EC+  ++   C N  +C N +G + CQCN G+    + CLD+DEC ++L +      C NT G +
Sbjct:  287 TCKEGFRG--DGFNCKDVDECSASG-VCGENSRCENSFGSFSC----WCNSG--FTMTNGSCADINECSPPHP-CNEHANCNNTKGSFLCK-----------------CKSGFSGNGTT--CEDVNEC--GFEPPVCPLNSQCINEVGSFYCE--CWEGYEKNGSLCLDIDECLH-PSMCHHHSVCINSPGSY------------------DCICVEGFTGN--GSFCEDINECEQENITHRCHNGSQCINTMGSFICQCNVGFGSNGSLCLDLDECAMNLSNCSSFQNCINTIGSY 529          

HSP 5 Score: 63.1586 bits (152), Expect = 9.842e-10
Identity = 49/165 (29.70%), Postives = 66/165 (40.00%), Query Frame = 3
Query: 1011 CHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSL-------------------------------KDICGHL-KCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC 1409
            C CK+GF  +     C D++EC + +  C     C N +G Y+C C  GY      C DI+EC+S                                  IC     C+N+PG F C C+SG+   N   C D+NEC +  G C    +       C N  GSY C
Sbjct:   10 CVCKTGFDGDGTV--CTDINECAASLHKCHKDSACVNTVGSYSCVCKSGYTGDGFACTDINECLSSTCINSEGSFRCECPLGFTVSDFKCTDIDECKNGICSPFASCQNSPGSFTCSCRSGFS-GNGTSCVDVNECIQNNGGCHGNAI-------CNNTQGSYSC 164          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000044357.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:16691548:16699432:-1 gene:ENSXETG00000002183.1 transcript:ENSXETT00000044357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.984 bits (380), Expect = 8.177e-38
Identity = 125/371 (33.69%), Postives = 159/371 (42.86%), Query Frame = 3
Query:  369 NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVK-DYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCS--------EIKCEGYEELNN---------------ATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC 1409
            + TC     F      C D+NEC Q    CH N  C N  GSY C  K  + G G         C D++EC+++   C  G +C N  GSF C                 QC  G++   L N C+DIDEC       C P   +C    G  +C  QC  G   I N C D+DEC  N   C     C N FG + CS           C   +E  N                +  C CK GF+ + +   C+DVDEC S   VCG   RC+N  G ++C CN G+   N +C DI+EC        H  C NT G F C CKSG+   N   CED+NEC   P +C +         +C N VGS+ C
Sbjct:  163 SFTCSCRSGFSGNGTSCVDVNECIQNNGGCHGNAICNNTQGSYSCSCKGGFVGDG------IIQCKDIDECSENSGICQYGGLCLNTPGSFRC-----------------QCASGFQ--ALNNTCQDIDECK-TVNGNC-PLNALCQNSLGSYSC--QCKAGFSGI-NSCSDIDECLSNP--CHAQATCKNTFGSFECSCNDWFVGNGFNCTDIDECINPSSCHSKANYCINTQGSYSCTCKEGFRGDGF--NCKDVDEC-SASGVCGENSRCENSFGSFSCWCNSGFTMTNGSCADINECSPPHPCNEHANCNNTKGSFLCKCKSGFS-GNGTTCEDVNECGFEPPVCPLNS-------QCINEVGSFYC 490          

HSP 2 Score: 132.494 bits (332), Expect = 1.000e-31
Identity = 115/349 (32.95%), Postives = 155/349 (44.41%), Query Frame = 3
Query:  414 KCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCR-------------------PPC---PTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTC-------------SEIK-------CEGYEELNNATKE--CHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTE 1328
            +CKDI+ECS+ + IC     C N PGS++C     C  G  F     TC D++EC      C    +C+N +GS++C+                    PC    T K  + +  C  C + +  N     C DIDEC  P    C      C+   G  +C   C  G       C DVDEC+     C +  RC N FG ++C             ++I        C  +   NN      C CKSGF  N  T  CEDV+EC    PVC    +C NE+G + C+C  GYE   + CLDIDEC+       H  C N+PG + C+C  G+   N + CEDINEC +
Sbjct:  220 QCKDIDECSENSGICQYGGLCLNTPGSFRC----QCASG--FQALNNTCQDIDECKTVNGNCPLNALCQNSLGSYSCQCKAGFSGINSCSDIDECLSNPCHAQATCKNTFGSFEC-SCNDWFVGNGFN--CTDIDECINPS--SCHSKANYCINTQGSYSC--TCKEGFRGDGFNCKDVDECSA-SGVCGENSRCENSFGSFSCWCNSGFTMTNGSCADINECSPPHPCNEHANCNNTKGSFLCKCKSGFSGNGTT--CEDVNECGFEPPVCPLNSQCINEVGSFYCECWEGYEKNGSLCLDIDECLHPSMCHHHSVCINSPGSYDCICVEGF-TGNGSFCEDINECEQ 551          

HSP 3 Score: 124.79 bits (312), Expect = 2.760e-29
Identity = 114/362 (31.49%), Postives = 151/362 (41.71%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKD-YCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNC---------------RPPCPTNKPHYWNS-GCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC 1409
            C++G  F  +   C DINEC+     CH +  C N  GSY C+ K  Y G G+        C D+NEC  +   C     C N  GS  C                  C  +     NS G  +C+    +      C DIDEC       C PF   C   PG  TC   C  G       C DV+EC +N   C     CNN  G Y+CS                  CK GF  +    +C+D+DEC     +C   G C N  G + CQC  G++  N TC DIDEC ++   C  +  C+N+ G + C CK+G+  S  N C DI+EC   P          + +  C N  GS++C
Sbjct:   12 CKTG--FDGDGTVCTDINECAASLHKCHKDSACVNTVGSYSCVCKSGYTGDGF-------ACTDINECLSANGGCHKDASCANTPGSRICTCNSGFTGNGITCMDNDECTASSSTCINSEGSFRCECPLGFTVSDFKCTDIDECKNGI---CSPFAS-CQNSPGSFTC--SCRSGFSGNGTSCVDVNECIQNNGGCHGNAICNNTQGSYSCS------------------CKGGFVGDGII-QCKDIDECSENSGICQYGGLCLNTPGSFRCQCASGFQALNNTCQDIDECKTVNGNCPLNALCQNSLGSYSCQCKAGF--SGINSCSDIDECLSNP---------CHAQATCKNTFGSFEC 328          

HSP 4 Score: 109.383 bits (272), Expect = 3.195e-24
Identity = 92/324 (28.40%), Postives = 133/324 (41.05%), Query Frame = 3
Query:  486 PGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSES 1454
             G Y C+ K        F+ +   C D+NECA SL  C     C N +GS++C                  CK GY  +     C DI+EC       C      C   PG   C   C+ G       C D DEC  + + C +++                         +  C C  GF  + +  KC D+DEC + I  C     C+N  G + C C  G+     +C+D++EC+     C G+  C NT G + C CK G+       C+DI+EC+E  GIC+   L       C N  GS++C    C SG++ L+ +
Sbjct:    5 AGDYFCVCKT------GFDGDGTVCTDINECAASLHKCHKDSACVNTVGSYSCV-----------------CKSGYTGDGFA--CTDINECLSA-NGGCHK-DASCANTPGSRIC--TCNSGFTGNGITCMDNDECTASSSTCINSE------------------------GSFRCECPLGFTVSDF--KCTDIDECKNGI--CSPFASCQNSPGSFTCSCRSGFSGNGTSCVDVNECIQNNGGCHGNAICNNTQGSYSCSCKGGFVGDGIIQCKDIDECSENSGICQYGGL-------CLNTPGSFRCQ---CASGFQALNNT 261          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000024069.1 (hemicentin 2 [Source:NCBI gene;Acc:100490941])

HSP 1 Score: 150.599 bits (379), Expect = 3.668e-37
Identity = 101/356 (28.37%), Postives = 154/356 (43.26%), Query Frame = 3
Query:  402 FEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTC----------SEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKM-SNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
             +E +C   N CS           C N  GS+ C     C  GY    + ++C D++EC     +C++G  C N  GS++C                 +C  G+R N     CED+DEC      Q  P ++ C+   G   C   C  G      IC D++EC +    C     C N  G Y C              C G E LNN        + F   +  G+    +   + +    N     N +G+ + +C  G+  +N  C DIDECV  ++ C H +C NT G ++C+C +GY++  N   C+DI+ECTE    C + ++       CFN  G ++CL++ CP+ Y
Sbjct: 3684 LDEDECDLRNPCSHT---------CHNTVGSFAC----SCPVGYTLAPDGRSCRDVDECILGTHHCEAGQQCINTGGSYHC---------------LLRCGPGFRPNAEGTACEDVDECA-----QSSPCQQRCLNTIGSYRC--ACDPGYQLRGTICVDINECLQVPKPCA--FECQNIAGSYKCLCPPGKQLLGDGRSCAGLERLNNTAALGQVGAQFDGAITNGRIHG-NNVYTWLSFSQNG----NLMGQSSSRCPSGFIRRNGVCTDIDECVQ-RNPCQH-ECRNTEGSYQCLCPAGYRLLPNNRNCQDIDECTEHRITCGMNQM-------CFNTRGGHQCLDTPCPASY 3988          

HSP 2 Score: 112.464 bits (280), Expect = 7.066e-25
Identity = 92/322 (28.57%), Postives = 130/322 (40.37%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDEC--------------TGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEF--KNATCLDIDECVSLKDICG-HLKCENTPGFFKCV---CKSGY 1280
            +C  GY    + + C+D++EC      C   + C N  GSY C+++  CG G+  N E   C D++ECAQS   C     C N IGS+ C                  C  GY+      IC DI+EC               G Y+  C P K++     G S    +    T  +  +    D    N          NN + + + S+    G     ++++   C SGF R    G C D+DEC    P    +  C+N  G Y C C  GY     N  C DIDEC   +  CG +  C NT G  +C+   C + Y
Sbjct: 3709 SCPVGYTLAPDGRSCRDVDECILGTHHCEAGQQCINTGGSYHCLLR--CGPGFRPNAEGTACEDVDECAQS-SPCQQR--CLNTIGSYRC-----------------ACDPGYQLRG--TICVDINECLQVPKPCAFECQNIAGSYKCLCPPGKQLL--GDGRSCAGLERLNNTAALGQVGAQFDGAITNGR-----IHGNNVYTWLSFSQ---NGNLMGQSSSR---CPSGFIRR--NGVCTDIDECVQRNPC---QHECRNTEGSYQCLCPAGYRLLPNNRNCQDIDECTEHRITCGMNQMCFNTRGGHQCLDTPCPASY 3988          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Xenopus
Match: ENSXETT00000044344.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:16690183:16699488:-1 gene:ENSXETG00000002183.1 transcript:ENSXETT00000044344.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.813 bits (351), Expect = 4.702e-34
Identity = 124/383 (32.38%), Postives = 164/383 (42.82%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECT---------------GPYRLQC----------------------EPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC 1409
            TC SGYQF   + KC D++EC+ K  +CH+   C N PGSY C+    C QG  FN     C+D+NEC  + K C     C N+ GS+NC                  CK G+  N L+  C DIDEC                G +R +C                       PF   C   PG  TC   C  G       C DV+EC +N   C     CNN  G Y+CS                  CK GF  +    +C+D+DEC     +C   G C N  G + CQC  G++  N TC DIDEC ++   C  +  C+N+ G + C CK+G+  S  N C DI+EC   P          + +  C N  GS++C
Sbjct:  178 TCASGYQFT--DNKCVDVDECANK--VCHVFSNCTNTPGSYSCV----CRQG--FNGNGLVCVDINECETNNK-CHIKANCFNLPGSYNCV-----------------CKPGFTGNGLV--CADIDECAQANICPAESTCINSEGSFRCECPLGFTVSDFKCTDIDECKNGICSPFAS-CQNSPGSFTCS--CRSGFSGNGTSCVDVNECIQNNGGCHGNAICNNTQGSYSCS------------------CKGGFVGDGII-QCKDIDECSENSGICQYGGLCLNTPGSFRCQCASGFQALNNTCQDIDECKTVNGNCPLNALCQNSLGSYSCQCKAGF--SGINSCSDIDECLSNP---------CHAQATCKNTFGSFEC 497          

HSP 2 Score: 132.109 bits (331), Expect = 1.761e-31
Identity = 107/344 (31.10%), Postives = 150/344 (43.60%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC 1409
            CE    F   + KC DI+EC  K  IC     C+N PGS+ C  +        F+    +C+D+NEC Q+   C    +C N  GS++C                  CK G+  + +I  C+DIDEC+    + C+ +  +C+  PG   C  QC+ G   + N C D+DEC     NC     C N  G Y+C                   CK+GF        C D+DEC  L   C  +  CKN  G + C CN  +      C DIDEC++         C+N  G +KC C  G+ + N   CED+NEC        ++  + +N   C N  GSY C
Sbjct:  296 CECPLGFTVSDFKCTDIDEC--KNGICSPFASCQNSPGSFTCSCRS------GFSGNGTSCVDVNECIQNNGGCHGNAICNNTQGSYSC-----------------SCKGGFVGDGIIQ-CKDIDECSENSGI-CQ-YGGLCLNTPGSFRC--QCASGFQALNNTCQDIDECKTVNGNCPLNALCQNSLGSYSC------------------QCKAGFSG---INSCSDIDEC--LSNPCHAQATCKNTFGSFECSCNDWFVGNGFNCTDIDECINPSSCHSKANCQNLYGGYKCECFQGF-LGNGFFCEDVNECA-------LKNETCSNDTVCINSEGSYVC 578          

HSP 3 Score: 120.939 bits (302), Expect = 5.669e-28
Identity = 139/490 (28.37%), Postives = 186/490 (37.96%), Query Frame = 3
Query:  369 NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCS--------EIKCEGYEELNNATK--------------ECHCKSGFKRNLYTGKCEDVDEC---------------------------------------DSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLK--CENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPY--KITEIPIEVLNYDHYHVKV 1643
            + TC     F      C D+NEC Q    CH N  C N  GSY C  K     G+  +   Q C D++EC+++   C  G +C N  GSF C                 QC  G++   L N C+DIDEC       C P   +C    G  +C  QC  G   I N C D+DEC  N   C     C N FG + CS           C   +E  N +               +C C  GF  N +   CEDV+EC                                        +  P C  KG C      Y C C+ G++    +C DIDEC   +D+C      C NTPG ++C+CK+G+ + N+  C DI+EC      C           ECFN VGSY+C    C +G+     + +     L YP            I   +L  +I  +    T PY    T  P     YD+ +V  
Sbjct:  332 SFTCSCRSGFSGNGTSCVDVNECIQNNGGCHGNAICNNTQGSYSCSCK----GGFVGDGIIQ-CKDIDECSENSGICQYGGLCLNTPGSFRC-----------------QCASGFQ--ALNNTCQDIDECK-TVNGNC-PLNALCQNSLGSYSC--QCKAGFSGI-NSCSDIDECLSNP--CHAQATCKNTFGSFECSCNDWFVGNGFNCTDIDECINPSSCHSKANCQNLYGGYKCECFQGFLGNGFF--CEDVNECALKNETCSNDTVCINSEGSYVCSCLNGTLLVNGSCVMPSSACRPTCHPKGLCHKTFMGYRCVCDVGFQGDGVSCADIDECT--RDVCKDDTRFCVNTPGSYRCICKNGFFL-NDTHCSDIDECATGAQDCHP-------LAECFNTVGSYECR---CQTGFHGNGRNCTE---NLLYP----------YGITVGDL--KIPAMSTDVTSPYIKPPTGFPFLGQTYDNIYVST 760          

HSP 4 Score: 117.857 bits (294), Expect = 6.190e-27
Identity = 120/440 (27.27%), Postives = 168/440 (38.18%), Query Frame = 3
Query:  396 FVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKD-YCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNC---------------RPPCPTNKPHYWNSGCH--------QCKEGYRWNPLINICEDIDECT-------------------GPYRLQCEPFKEI---------------------CVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTC--------SEIKCEGYEELNNA--------------TKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSES 1454
            F  +   C DINEC+     CH +  C N  GSY C+ K  Y G G+        C D+NEC  +   C     C N  GS  C                  C  +   +WN+ C          CK G++ N    +C DIDECT                   G Y+  C    +                      C   PG  +C   C  G      +C D++EC E  N C     C N  G Y C        + + C   +E   A              +  C C  GF  + +  KC D+DEC + I  C     C+N  G + C C  G+     +C+D++EC+     C G+  C NT G + C CK G+       C+DI+EC+E  GIC+   L       C N  GS++C    C SG++ L+ +
Sbjct:   16 FDGDGTVCTDINECAASLHKCHKDSACVNTVGSYSCVCKSGYTGDGF-------ACTDINECLSANGGCHKDASCANTPGSRICTCNSGFTGNGITCMDNDECTASSVCHWNASCINTPGSYYCSCKSGFKGNGYY-LCLDIDECTETPGVCSSAFGFYGCKNLPGSYQCTCASGYQFTDNKCVDVDECANKVCHVFSNCTNTPGSYSC--VCRQGFNGNGLVCVDINEC-ETNNKCHIKANCFNLPGSYNCVCKPGFTGNGLVCADIDECAQANICPAESTCINSEGSFRCECPLGFTVSDF--KCTDIDECKNGI--CSPFASCQNSPGSFTCSCRSGFSGNGTSCVDVNECIQNNGGCHGNAICNNTQGSYSCSCKGGFVGDGIIQCKDIDECSENSGICQYGGL-------CLNTPGSFRCQ---CASGFQALNNT 430          

HSP 5 Score: 98.2117 bits (243), Expect = 9.938e-21
Identity = 70/201 (34.83%), Postives = 93/201 (46.27%), Query Frame = 3
Query:  840 CSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRV 1442
            C  G      +C D++ECA + + C     C N  G Y+C                   CKSG+  + +   C D++EC S    C     C N  G   C CN G+     TC+D DEC +      +  C NTPG + C CKSG+K +   +C DI+ECTETPG+C     S      C NL GSY+C    C SGY+ 
Sbjct:   12 CKTGFDGDGTVCTDINECAASLHKCHKDSACVNTVGSYSCV------------------CKSGYTGDGF--ACTDINECLSANGGCHKDASCANTPGSRICTCNSGFTGNGITCMDNDECTASSVCHWNASCINTPGSYYCSCKSGFKGNGYYLCLDIDECTETPGVCS----SAFGFYGCKNLPGSYQC---TCASGYQF 185          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Xenopus
Match: FBLN2 (fibulin 2 [Source:NCBI gene;Acc:100487324])

HSP 1 Score: 133.65 bits (335), Expect = 6.106e-32
Identity = 134/484 (27.69%), Postives = 197/484 (40.70%), Query Frame = 3
Query:  423 DINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECT-GPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNN-CTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN--ATCLDIDECVSLKDICGHLKCENTPGFFKCVC-KSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFV 1856
            DI+EC      C   E C N  GSY CI +  C  GY   +    C D+NECA     C  G  C N +GSF C+                +C +GY  +    IC DIDEC  G +    E   + C   PG   C+ +           C DV+EC       C  T  C N  G Y CS                  C +GF+      +CEDV+EC S    C  +  C N  G Y C C  GY+  +   +C DIDECV          C NTPG ++C C ++GY +S N   C+DI+EC        +   + ++  EC+N+ GSYKCL   CP  YR +S     +    +Y  C             +N   RI  +R   T P  +  +P ++                + K   + +   S    P       ++++   +  + + +LD+ +KL  Q     + L+ +++F+
Sbjct:  526 DIDECVINRHTCATGERCVNTVGSYICIQERRCEIGY--TLVDGVCTDINECASLAAPCKQGFTCVNTLGSFVCQ------------RKQLKCNKGYESDENGTICIDIDECKLGTHNCSQE---QSCFNLPGSHRCDCKIGYRYDLFRKACLDVNECWIYPGRLCHHT--CENTVGSYKCS------------------CFAGFQLGQDGKQCEDVNECKS--NPCNQE--CTNVYGSYQCYCKEGYKLADDGISCEDIDECVQNFGSLCVFACVNTPGSYQCACPETGYTLSVNGRTCKDIDEC-------EVGTHNCSSSEECYNIQGSYKCLSYTCPENYRKVSNMVCERISCFNYQEC-------------QNSPVRISYLR--LTFPAGVV-VPAQIFRIGPSPTYAGDSIVLDIKKGNEENYFSSRKFNPYTG----IIYLQRPVKKAKDFLLDVEMKLFRQGVVTTF-LSRIYVFI 940          

HSP 2 Score: 92.4337 bits (228), Expect = 7.659e-19
Identity = 101/363 (27.82%), Postives = 141/363 (38.84%), Query Frame = 3
Query:  414 KCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVC-ENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINIC--------EDIDECTGPYRLQCEPFKEICVRKPGLSTC--ETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNEN-VCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSS 1460
            K  +I+EC      C   E C N  GS+ CI ++ C  G  F +    C              +G VC +N        P     K     SG  Q +     +P + +C         DIDEC    R  C    E CV   G   C  E +C  G   +  +C D++ECA     C     C N  G + C               K+  C  G++ +     C D+DEC      C  +  C N  G + C C  GY +      CLD++EC        H  CENT G +KC C +G+++  +   CED+NEC   P              EC N+ GSY+C    C  GY++  +  S
Sbjct:  425 KAYNIDECVLNTHTCIQGERCVNTVGSFICIQEERCESG--FTVVNGVC--------------TGTVCLKNKYIQGQTGPTGHQEKTQ--PSGPRQPRPDPHCDPALYLCCKSAVSHFLDIDECV-INRHTCAT-GERCVNTVGSYICIQERRCEIGYTLVDGVCTDINECASLAAPCKQGFTCVNTLGSFVCQR-------------KQLKCNKGYESDENGTICIDIDECKLGTHNCSQEQSCFNLPGSHRCDCKIGYRYDLFRKACLDVNECWIYPGRLCHHTCENTVGSYKCSCFAGFQLGQDGKQCEDVNECKSNP-----------CNQECTNVYGSYQCY---CKEGYKLADDGIS 740          

HSP 3 Score: 80.8777 bits (198), Expect = 3.323e-15
Identity = 71/238 (29.83%), Postives = 101/238 (42.44%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNEC-AQSLKYCDSGMVCENVIGSFNC----------------------RPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKI-ANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKC-EGYEELNNATKE 1010
            + C  GY+       C DI+EC      C   + C NLPGS++C     C  GY +++  + C+D+NEC     + C     CEN +GS+ C                        PC     + + S    CKEGY+       CEDIDEC   +   C      CV  PG   C    +G T+ +    C D+DEC    +NC+ ++ C N  G Y C    C E Y +++N   E
Sbjct:  602 LKCNKGYESDENGTICIDIDECKLGTHNCSQEQSCFNLPGSHRCD----CKIGYRYDLFRKACLDVNECWIYPGRLCHH--TCENTVGSYKCSCFAGFQLGQDGKQCEDVNECKSNPCNQECTNVYGSYQCYCKEGYKLADDGISCEDIDECVQNFGSLC---VFACVNTPGSYQCACPETGYTLSVNGRTCKDIDECEVGTHNCSSSEECYNIQGSYKCLSYTCPENYRKVSNMVCE 830          

HSP 4 Score: 52.7582 bits (125), Expect = 1.882e-6
Identity = 36/109 (33.03%), Postives = 52/109 (47.71%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQK-ADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRP-PCPTNKPHYWNSGCHQ 698
            C+ GY+   +   C+DI+EC Q    +C     C N PGSY+C   +    GY  ++  +TC D++EC      C S   C N+ GS+ C    CP N     N  C +
Sbjct:  728 CKEGYKLADDGISCEDIDECVQNFGSLCVFA--CVNTPGSYQCACPE---TGYTLSVNGRTCKDIDECEVGTHNCSSSEECYNIQGSYKCLSYTCPENYRKVSNMVCER 831          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 164.851 bits (416), Expect = 6.837e-42
Identity = 113/362 (31.22%), Postives = 158/362 (43.65%), Query Frame = 3
Query:  363 DTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNA--TCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYK-MSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            D +  C SG+        C D +EC+      H    C N  G+Y C     C +G     + +TC D++ECA     C +G  C+N IGS+ C   C T        G  +  +G         C+DI+EC      +  P  + C    G   C   C  G       C DV+EC +N   C   Q C N  G Y C ++                C SG  +    G C D+DEC      C     C+N  G Y C C  GY  +     C+DIDEC + +D C H +C+NT G ++CVC  GY+ M N   C+D++EC E    C   R+       CFN+ GSY+C+++ CP  Y+
Sbjct: 5086 DRSNQCPSGFILDSVGPFCADEDECTAGNPCSHT---CHNAIGAYYC----SCPKGLTIAADGRTCQDIDECALGGHTCRAGQDCDNTIGSYRCVVHCGT--------GFRRTSDGLS-------CQDINECQ-----ESSPCHQRCFNVIGSFHC--GCEAGYQLKGRKCIDVNECRQNV--CRPDQHCKNTRGGYKCIDL----------------CPSGMTK-AENGTCIDIDECKDGTHQCRYNQICENTRGSYRCACPRGYRSQGVGRPCIDIDECQN-RDTCQH-ECKNTIGSYQCVCPPGYRLMLNGKTCQDVDECLEQNVRCGPNRM-------CFNMRGSYQCIDTPCPPNYQ 5390          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Mouse
Match: Fbln1 (fibulin 1 [Source:MGI Symbol;Acc:MGI:95487])

HSP 1 Score: 157.918 bits (398), Expect = 2.256e-40
Identity = 152/533 (28.52%), Postives = 231/533 (43.34%), Query Frame = 3
Query:  342 RRCVDMDDTNV-TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCE---TQCSGG--TIKIANICYDVDECAENKNNCTDTQRCNNYFGYY---------------TCSEI-KCEGYE--------ELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN---ATCLDIDECV--SLKDICGHLKCENTPGFFKCVC-KSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEI-PIEVLNYDHYHVKVNV--KKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTE 1820
            ++C D  D  + +C  GYQ   +   C+DINEC   +  C + E C N  GS++C     CG GYE   E   C D++EC   +  C    +C+N +GSF CRP               QCK G+  + L N C DI+EC       C P  + C+   G  TC+     C  G    +    C DVDEC+     C     C N  G +               TC +I +C+ Y         E    +  C C +GF+ ++    CEDV+EC  L   C  +  C N  G Y C C  GY+  +    TC DIDEC   +   IC + +C N PG F+C C  SGY+++ N   C+DI+EC     +  I   S+N    CFN+ GS++CL   CP  YR    S+ T+  +L        +++ C + LP  + Y  +    +  +P  +  + P   +  D   + +    ++ F T  K         + +P  + + +++ +  DL     +   +     F S E
Sbjct:  190 QQCRDTGDEVICSCFVGYQLQSDGVSCEDINECITGSHNCRLGESCINTVGSFRCQRDSSCGTGYEL-TEDNNCKDIDECETGIHNCPPDFICQNTLGSFRCRPKL-------------QCKSGFIQDALGN-CIDINECLS-ISAPC-PVGQTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECSPPAEPCGKGHHCLNSPGSFRCECKAGFYFDGISRTCVDINECQRYPGRLCGHKCENTPGSFHCSCSAGFRLSVDGRSCEDVNEC--LNSPCSQE--CANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSY-RCINIPGSFQCSCPSSGYRLAPNGRNCQDIDEC-----VTGIHNCSINE--TCFNIQGSFRCLSFECPENYR---RSADTRCERL-----PCHENQECPR-LPLRITYYHLSFPTNIQVPAVVFRMGPSSAVPGDSMQLAITAGNEEGFFTTRKVSHHSGVVALTKPIPEPRDLLLTVKMDLYRHGTVSSFVAKLFIFVSAE 684          

HSP 2 Score: 74.3294 bits (181), Expect = 2.235e-13
Identity = 68/250 (27.20%), Postives = 102/250 (40.80%), Query Frame = 3
Query:  294 KKCQDCQFNKVYNETLRRCVDMDDTNVT--------------------CESGYQFVFEEKKCKDINECSQ-KADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINI-CEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKI-ANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKC 974
            K   +C      NE   RCVD+D+ +                      C++G+ F    + C DINEC +    +C     C N PGS+ C     C  G+  +++ ++C D+NEC  S         C NV GS+ C                  C+ GY+ + +  + CEDIDEC  P       ++  C+  PG   C    SG  +      C D+DEC    +NC+  + C N  G + C   +C
Sbjct:  338 KNVPNCGRGYHLNEEGTRCVDVDECSPPAEPCGKGHHCLNSPGSFRCECKAGFYFDGISRTCVDINECQRYPGRLC--GHKCENTPGSFHC----SCSAGFRLSVDGRSCEDVNECLNS----PCSQECANVYGSYQC-----------------YCRRGYQLSDVDGVTCEDIDECALPTGGHICSYR--CINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGSFRCLSFEC 558          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 155.606 bits (392), Expect = 7.115e-39
Identity = 114/382 (29.84%), Postives = 171/382 (44.76%), Query Frame = 3
Query:  300 CQDCQFNKVYNETLRRCVDMDDT-NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYK-MSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            CQD    +  +   +RC ++  + +  CE+GYQ   + +KC D+NEC Q  ++C  +++C+N  G YKCI  D C  G     E  TCID++EC      C    +CEN  GS+ C                  C  GYR   +   C DI+EC               V KP    C  QCS        IC    +   +  +C   +R +NY   Y  S    E +  + +  +       + + LY+   E  +   S         R +  I +    C  G E  + TC+DIDEC + +D C H +C+NT G ++CVC  GY+ M N   C+D++EC E    C   R+       CFN+ GSY+C+++ CP  Y+
Sbjct: 5189 CQDINECQESSPCHQRCFNVIGSFHCGCEAGYQL--KGRKCIDVNECRQ--NVCRPDQHCKNTRGGYKCI--DLCPSGMT-KAENGTCIDIDECKDGTHQCRYNQICENTRGSYRC-----------------ACPRGYRSQGVGRPCIDINECEQ-------------VPKP----CAHQCSNSPGSFKCICLPGQQLLGDGKSCAGLERLSNYGTQY--SSYTLERFSPVRSDYQPSQHYRQYSQ-LYSSYSEYRNSRASF-------SRNRRTIRK---TCPEGSEANHETCVDIDECQN-RDTCQH-ECKNTIGSYQCVCPPGYRLMLNGKTCQDVDECLEQNVRCGPNRM-------CFNMRGSYQCIDTPCPPNYQ 5507          

HSP 2 Score: 129.413 bits (324), Expect = 2.042e-30
Identity = 92/310 (29.68%), Postives = 127/310 (40.97%), Query Frame = 3
Query:  363 DTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNA--TCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKM 1286
            D +  C SG+        C D +EC+      H    C N  G+Y C     C +G     + +TC D++ECA     C +G  C+N IGS+ C   C T        G  +  +G         C+DI+EC      +  P  + C    G   C   C  G       C DV+EC +N   C   Q C N  G Y C ++                C SG  +    G C D+DEC      C     C+N  G Y C C  GY  +     C+DI+EC  +   C H +C N+PG FKC+C  G ++
Sbjct: 5086 DRSNQCPSGFILDSVGPFCADEDECTAGNPCSHT---CHNAIGAYYC----SCPKGLTIAADGRTCQDIDECALGGHTCRAGQDCDNTIGSYRCVVHCGT--------GFRRTSDGLS-------CQDINECQ-----ESSPCHQRCFNVIGSFHC--GCEAGYQLKGRKCIDVNECRQNV--CRPDQHCKNTRGGYKCIDL----------------CPSGMTK-AENGTCIDIDECKDGTHQCRYNQICENTRGSYRCACPRGYRSQGVGRPCIDINECEQVPKPCAH-QCSNSPGSFKCICLPGQQL 5346          

HSP 3 Score: 127.872 bits (320), Expect = 6.647e-30
Identity = 81/254 (31.89%), Postives = 112/254 (44.09%), Query Frame = 3
Query:  693 HQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIAN--ICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCV--CKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            +QC  G+  + +   C D DECT        P    C    G   C   C  G    A+   C D+DECA   + C   Q C+N  G Y C                  HC +GF+R      C+D++EC    P      RC N IG ++C C  GY+ K   C+D++EC   +++C     C+NT G +KC+  C SG   +    C DI+EC +    CR  ++       C N  GSY+C    CP GYR
Sbjct: 5089 NQCPSGFILDSVGPFCADEDECTAG-----NPCSHTCHNAIGAYYC--SCPKGLTIAADGRTCQDIDECALGGHTCRAGQDCDNTIGSYRCV----------------VHCGTGFRRTSDGLSCQDINECQESSPC---HQRCFNVIGSFHCGCEAGYQLKGRKCIDVNEC--RQNVCRPDQHCKNTRGGYKCIDLCPSGMTKAENGTCIDIDECKDGTHQCRYNQI-------CENTRGSYRC---ACPRGYR 5304          

HSP 4 Score: 63.929 bits (154), Expect = 6.665e-10
Identity = 43/142 (30.28%), Postives = 63/142 (44.37%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNC-RPPCPTNKPHYWNSGCHQCKEGYRWNPLINIC------EDIDECTGPYRLQ 779
            TC  G +   E   C DI+EC Q  D C     C+N  GSY+C+    C  GY   +  +TC D++EC +    C    +C N+ GS+ C   PCP N               Y+ +P++  C       D++    PY L+
Sbjct: 5417 TCPEGSEANHE--TCVDIDEC-QNRDTCQ--HECKNTIGSYQCV----CPPGYRLMLNGKTCQDVDECLEQNVRCGPNRMCFNMRGSYQCIDTPCPPN---------------YQRDPVLGFCLKNCPPNDLECTLSPYALE 5534          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Mouse
Match: Fbln1 (fibulin 1 [Source:MGI Symbol;Acc:MGI:95487])

HSP 1 Score: 152.14 bits (383), Expect = 2.530e-38
Identity = 133/408 (32.60%), Postives = 187/408 (45.83%), Query Frame = 3
Query:  342 RRCVDMDDTNV-TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCE---TQCSGG--TIKIANICYDVDECAENKNNCTDTQRCNNYFGYY---------------TCSEI-KCEGYE--------ELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN---ATCLDIDECV--SLKDICGHLKCENTPGFFKCVC-KSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSES 1454
            ++C D  D  + +C  GYQ   +   C+DINEC   +  C + E C N  GS++C     CG GYE   E   C D++EC   +  C    +C+N +GSF CRP               QCK G+  + L N C DI+EC       C P  + C+   G  TC+     C  G    +    C DVDEC+     C     C N  G +               TC +I +C+ Y         E    +  C C +GF+ ++    CEDV+EC  L   C  +  C N  G Y C C  GY+  +    TC DIDEC   +   IC + +C N PG F+C C  SGY+++ N   C+DI+EC     +  I   S+N    CFN+ GS++CL   CP  YR  +++
Sbjct:  190 QQCRDTGDEVICSCFVGYQLQSDGVSCEDINECITGSHNCRLGESCINTVGSFRCQRDSSCGTGYELT-EDNNCKDIDECETGIHNCPPDFICQNTLGSFRCRPKL-------------QCKSGFIQDALGN-CIDINECLS-ISAPC-PVGQTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECSPPAEPCGKGHHCLNSPGSFRCECKAGFYFDGISRTCVDINECQRYPGRLCGHKCENTPGSFHCSCSAGFRLSVDGRSCEDVNEC--LNSPCSQE--CANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSY-RCINIPGSFQCSCPSSGYRLAPNGRNCQDIDEC-----VTGIHNCSINE--TCFNIQGSFRCLSFECPENYRRSADT 568          

HSP 2 Score: 73.9442 bits (180), Expect = 3.012e-13
Identity = 68/250 (27.20%), Postives = 102/250 (40.80%), Query Frame = 3
Query:  294 KKCQDCQFNKVYNETLRRCVDMDDTNVT--------------------CESGYQFVFEEKKCKDINECSQ-KADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINI-CEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKI-ANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKC 974
            K   +C      NE   RCVD+D+ +                      C++G+ F    + C DINEC +    +C     C N PGS+ C     C  G+  +++ ++C D+NEC  S         C NV GS+ C                  C+ GY+ + +  + CEDIDEC  P       ++  C+  PG   C    SG  +      C D+DEC    +NC+  + C N  G + C   +C
Sbjct:  338 KNVPNCGRGYHLNEEGTRCVDVDECSPPAEPCGKGHHCLNSPGSFRCECKAGFYFDGISRTCVDINECQRYPGRLC--GHKCENTPGSFHC----SCSAGFRLSVDGRSCEDVNECLNS----PCSQECANVYGSYQC-----------------YCRRGYQLSDVDGVTCEDIDECALPTGGHICSYR--CINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGSFRCLSFEC 558          

HSP 3 Score: 52.373 bits (124), Expect = 1.859e-6
Identity = 61/249 (24.50%), Postives = 95/249 (38.15%), Query Frame = 3
Query:  258 ECAKYTEWDPVLKKCQDCQFNKVYNETL--RRCVDMDDT-NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEF-NIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECT----------------GPYRL----------------------------QCEPFKEICVRKPGLSTCETQCSGGTIK 860
            EC     +D + + C D    + Y   L   +C +   + + +C +G++   + + C+D+NEC         ++ C N+ GSY+C    YC +GY+  +++  TC D++ECA           C N+ GSF C   CP++              GYR  P    C+DIDEC                 G +R                              C P  E CVR P  +   T  S  T +
Sbjct:  385 ECKAGFYFDGISRTCVDINECQRYPGRLCGHKCENTPGSFHCSCSAGFRLSVDGRSCEDVNECLNSP----CSQECANVYGSYQC----YCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQCS--CPSS--------------GYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGSFRCLSFECPENYRRSADTFRQEKTDTVRCIKSCRPNDEACVRDPVHTVSHTVISLPTFR 609          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Mouse
Match: Hmcn2 (hemicentin 2 [Source:MGI Symbol;Acc:MGI:2677838])

HSP 1 Score: 150.214 bits (378), Expect = 3.946e-37
Identity = 120/432 (27.78%), Postives = 183/432 (42.36%), Query Frame = 3
Query:  330 NETLRRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANI--CYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKEC-------------HCKSGFK---RNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKM--SNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYP-TCSYTKSERCVQILPENLIYRIIQI 1562
            N  L   +  ++  V C  G++   +   C D +ECS     C  +  CRN PG + C     C  G+    + + C D++ECA +   C     C N++GS+NC                  C+ G+R     + CED+DEC      +C  + ++C   PG   C   C  G  +  +   C D++EC +    C    +C N  G Y C    C   + L    + C               +S F    R+             SL P  G      N +GR    C PG+  ++  C D+DEC  ++ +C H  C+NT G + C+C SGY++  S +N C+DINEC E    C   ++       CFN  GS++C+++ CP+ YR           Q S P TC    S+ C    P  L YR++ +
Sbjct: 4637 NFQLTTALQTEENEVGCPEGFEPDVQGAFCVDKDECSGGPSPC--SHTCRNAPGHFSC----SCPTGFSLAWDHRNCRDVDECAGNTHLCQEEQRCVNLLGSYNC---------------LASCRPGFRVTADGSNCEDVDECLEQLD-ECH-YNQLCENTPGGHHC--GCPRGYRQQGHSLPCLDINECLQLPTPC--VYQCQNLQGSYRC---LCPPGQTLLRDGRTCIPLERNRQNITIVSHRSPFGPWLRSRVPRPSSSYHTWVSLRPGSG----ALNSVGR--AWCPPGFIRQDGVCADLDEC-RVRSLCQH-ACQNTEGSYYCLCPSGYRLLPSGKN-CQDINECEEDGIECGPGQM-------CFNTRGSFQCVDTPCPTTYR-----------QGSSPGTCFRRCSQDCSASGPSTLQYRLLPL 5011          

HSP 2 Score: 96.2857 bits (238), Expect = 5.954e-20
Identity = 84/313 (26.84%), Postives = 129/313 (41.21%), Query Frame = 3
Query:  279 WDPVLKKCQD---CQFNKVYNETLRRCVDMDDTN---VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECT-----GPYRLQCEP-----FKEICVRKPGL----STCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGK-CEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNP 1154
            WD   + C+D   C  N    +  +RCV++  +     +C  G++   +   C+D++EC ++ D CH N+ C N PG + C     C +GY     +  C+D+NEC Q    C     C+N+ GS+ C   CP         G    ++G    PL    ++I   +     GP+     P     +      +PG     S     C  G I+   +C D+DEC   ++ C     C N  G Y C                   C SG+ R L +GK C+D++EC+     CG    C N  G + C   P
Sbjct: 4702 WDH--RNCRDVDECAGNTHLCQEEQRCVNLLGSYNCLASCRPGFRVTADGSNCEDVDECLEQLDECHYNQLCENTPGGHHC----GCPRGYRQQGHSLPCLDINECLQLPTPC--VYQCQNLQGSYRCL--CP--------PGQTLLRDGRTCIPLERNRQNITIVSHRSPFGPWLRSRVPRPSSSYHTWVSLRPGSGALNSVGRAWCPPGFIRQDGVCADLDEC-RVRSLC--QHACQNTEGSYYCL------------------CPSGY-RLLPSGKNCQDINECEEDGIECGPGQMCFNTRGSFQCVDTP 4974          
BLAST of Latent-transforming growth factor beta-binding protein vs. UniProt/SwissProt
Match: sp|P23142|FBLN1_HUMAN (Fibulin-1 OS=Homo sapiens OX=9606 GN=FBLN1 PE=1 SV=4)

HSP 1 Score: 156.377 bits (394), Expect = 5.874e-39
Identity = 156/560 (27.86%), Postives = 231/560 (41.25%), Query Frame = 3
Query:  342 RRCVDMDDTNV-TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRP---------------------------PCPTNKPHYWNSGCHQCKE-------GYRWNPLINICEDIDECTGPYRLQCEP--FKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN---ATCLDIDECV--SLKDICGHLKCENTPGFFKCVC-KSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR-----VLSESSST----KACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVND 1862
            ++C D  D  V +C  GYQ + +   C+D+NEC   +  C + E C N  GS++C     CG GYE   E  +C D++EC   +  C    +C+N +GSF CRP                           PCP         G + C++       GY  N     C D+DEC  P     EP      CV  PG   CE +       I+ +C DV+EC           +C N  G Y CS                  C  GF+ ++    CED++EC S    C  +  C N  G Y C C  GY+  +    TC DIDEC   +   IC + +C N PG F+C C  SGY+++ N   C+DI+EC     +  I   S+N    CFN+ G ++CL   CP  YR     +  E + T    K+C+ +  TC +      V  +   +I   +      T P +I  I +  +   H   + N+   F+       D  D II R  +     +V  +  +      VL + +           ++  +HIFV++
Sbjct:  188 QQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELT-EDNSCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPA----EPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCG-HKCENTLGSYLCS------------------CSVGFRLSVDGRSCEDINECSS--SPCSQE--CANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSY-RCINIPGSFQCSCPSSGYRLAPNGRNCQDIDEC-----VTGIHNCSINE--TCFNIQGGFRCLAFECPENYRRSAATLQQEKTDTVRCIKSCRPNDVTCVFDP----VHTISHTVIS--LPTFREFTRPEEI--IFLRAITPPHPASQANI--IFDITEGNLRDSFD-IIKRYMDGMTVGVVRQVRPIVGPFHAVLKLEMNYVVGGVVSHRNVVNVHIFVSE 700          
BLAST of Latent-transforming growth factor beta-binding protein vs. UniProt/SwissProt
Match: sp|Q8MJJ9|FBLN1_CHLAE (Fibulin-1 (Fragment) OS=Chlorocebus aethiops OX=9534 GN=FBLN1 PE=1 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 6.244e-39
Identity = 147/540 (27.22%), Postives = 221/540 (40.93%), Query Frame = 3
Query:  342 RRCVDMDDTNV-TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRP----------------------------PCPTN------KPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKE--ICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN---ATCLDIDECV--SLKDICGHLKCENTPGFFKCVC-KSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEI-PIEVLNYDHYHVKVNV--KKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTE 1820
            ++C D  D  V +C  GYQ + +   C+D+NEC   +  C + E C N  GS++C     CG GYE   E  +C D+++C   +  C    +C+N +GSF CRP                            PCPT       +  Y       C  GY  N     C D++EC  P     EP  +   CV  PG   CE +       I+ +C DV+EC           +C N  G Y CS                  C  GF+ ++    CED++EC S    C  +  C N  G Y C C  GY+  +    TC DIDEC   +   IC + +C N PG F+C C  SGY+++ N   C+DI+EC     +  I   S+N    CFN+ G ++CL   CP  YR    S++T+  +L           R    LP  + Y  +    +   P  +  + P   +  D   + +    ++ F T  K         + +P  + + +++ +  DL     +   +     F S E
Sbjct:  104 QQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYEL-TEDNSCKDIDQCESGIHNCLPDFICQNTLGSFRCRPKLQCKNGFIQDALANCIDINECLSIVSAPCPTGHTCINTEGSYTQKNVPNCGRGYHLNEEGTRC-DVNECAPPA----EPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNECQRYPGRLCG-HKCENTLGSYVCS------------------CSVGFRLSVDGRSCEDINECSS--SPCSQE--CANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSY-RCINIPGSFQCSCPASGYRLAPNGRNCQDIDEC-----VTGIHNCSINE--TCFNIQGGFRCLAFECPENYR---RSAATRCERLP------CHENRECSKLPLRITYYHLSFPTNIQAPAVVFRMGPSSAVPGDSMQLAITGGNEEGFFTTRKVSPHSGVVALTKPVPEPRDLLLTVKMDLYRHGTVSSFVAKLFIFVSAE 597          
BLAST of Latent-transforming growth factor beta-binding protein vs. UniProt/SwissProt
Match: sp|D3YXG0|HMCN1_MOUSE (Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 4.977e-38
Identity = 114/382 (29.84%), Postives = 171/382 (44.76%), Query Frame = 3
Query:  300 CQDCQFNKVYNETLRRCVDMDDT-NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYK-MSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            CQD    +  +   +RC ++  + +  CE+GYQ   + +KC D+NEC Q  ++C  +++C+N  G YKCI  D C  G     E  TCID++EC      C    +CEN  GS+ C                  C  GYR   +   C DI+EC               V KP    C  QCS        IC    +   +  +C   +R +NY   Y  S    E +  + +  +       + + LY+   E  +   S         R +  I +    C  G E  + TC+DIDEC + +D C H +C+NT G ++CVC  GY+ M N   C+D++EC E    C   R+       CFN+ GSY+C+++ CP  Y+
Sbjct: 5189 CQDINECQESSPCHQRCFNVIGSFHCGCEAGYQL--KGRKCIDVNECRQ--NVCRPDQHCKNTRGGYKCI--DLCPSGMT-KAENGTCIDIDECKDGTHQCRYNQICENTRGSYRC-----------------ACPRGYRSQGVGRPCIDINECEQ-------------VPKP----CAHQCSNSPGSFKCICLPGQQLLGDGKSCAGLERLSNYGTQY--SSYTLERFSPVRSDYQPSQHYRQYSQ-LYSSYSEYRNSRASF-------SRNRRTIRK---TCPEGSEANHETCVDIDECQN-RDTCQH-ECKNTIGSYQCVCPPGYRLMLNGKTCQDVDECLEQNVRCGPNRM-------CFNMRGSYQCIDTPCPPNYQ 5507          

HSP 2 Score: 129.413 bits (324), Expect = 1.428e-29
Identity = 92/310 (29.68%), Postives = 127/310 (40.97%), Query Frame = 3
Query:  363 DTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNA--TCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKM 1286
            D +  C SG+        C D +EC+      H    C N  G+Y C     C +G     + +TC D++ECA     C +G  C+N IGS+ C   C T        G  +  +G         C+DI+EC      +  P  + C    G   C   C  G       C DV+EC +N   C   Q C N  G Y C ++                C SG  +    G C D+DEC      C     C+N  G Y C C  GY  +     C+DI+EC  +   C H +C N+PG FKC+C  G ++
Sbjct: 5086 DRSNQCPSGFILDSVGPFCADEDECTAGNPCSHT---CHNAIGAYYC----SCPKGLTIAADGRTCQDIDECALGGHTCRAGQDCDNTIGSYRCVVHCGT--------GFRRTSDGLS-------CQDINECQ-----ESSPCHQRCFNVIGSFHC--GCEAGYQLKGRKCIDVNECRQNV--CRPDQHCKNTRGGYKCIDL----------------CPSGMTK-AENGTCIDIDECKDGTHQCRYNQICENTRGSYRCACPRGYRSQGVGRPCIDINECEQVPKPCAH-QCSNSPGSFKCICLPGQQL 5346          

HSP 3 Score: 127.872 bits (320), Expect = 4.649e-29
Identity = 81/254 (31.89%), Postives = 112/254 (44.09%), Query Frame = 3
Query:  693 HQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIAN--ICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCV--CKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            +QC  G+  + +   C D DECT        P    C    G   C   C  G    A+   C D+DECA   + C   Q C+N  G Y C                  HC +GF+R      C+D++EC    P      RC N IG ++C C  GY+ K   C+D++EC   +++C     C+NT G +KC+  C SG   +    C DI+EC +    CR  ++       C N  GSY+C    CP GYR
Sbjct: 5089 NQCPSGFILDSVGPFCADEDECTAG-----NPCSHTCHNAIGAYYC--SCPKGLTIAADGRTCQDIDECALGGHTCRAGQDCDNTIGSYRCV----------------VHCGTGFRRTSDGLSCQDINECQESSPC---HQRCFNVIGSFHCGCEAGYQLKGRKCIDVNEC--RQNVCRPDQHCKNTRGGYKCIDLCPSGMTKAENGTCIDIDECKDGTHQCRYNQI-------CENTRGSYRC---ACPRGYR 5304          

HSP 4 Score: 63.929 bits (154), Expect = 4.662e-9
Identity = 43/142 (30.28%), Postives = 63/142 (44.37%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNC-RPPCPTNKPHYWNSGCHQCKEGYRWNPLINIC------EDIDECTGPYRLQ 779
            TC  G +   E   C DI+EC Q  D C     C+N  GSY+C+    C  GY   +  +TC D++EC +    C    +C N+ GS+ C   PCP N               Y+ +P++  C       D++    PY L+
Sbjct: 5417 TCPEGSEANHE--TCVDIDEC-QNRDTCQ--HECKNTIGSYQCV----CPPGYRLMLNGKTCQDVDECLEQNVRCGPNRMCFNMRGSYQCIDTPCPPN---------------YQRDPVLGFCLKNCPPNDLECTLSPYALE 5534          
BLAST of Latent-transforming growth factor beta-binding protein vs. UniProt/SwissProt
Match: sp|Q08879|FBLN1_MOUSE (Fibulin-1 OS=Mus musculus OX=10090 GN=Fbln1 PE=1 SV=2)

HSP 1 Score: 152.14 bits (383), Expect = 1.770e-37
Identity = 133/408 (32.60%), Postives = 187/408 (45.83%), Query Frame = 3
Query:  342 RRCVDMDDTNV-TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCE---TQCSGG--TIKIANICYDVDECAENKNNCTDTQRCNNYFGYY---------------TCSEI-KCEGYE--------ELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN---ATCLDIDECV--SLKDICGHLKCENTPGFFKCVC-KSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSES 1454
            ++C D  D  + +C  GYQ   +   C+DINEC   +  C + E C N  GS++C     CG GYE   E   C D++EC   +  C    +C+N +GSF CRP               QCK G+  + L N C DI+EC       C P  + C+   G  TC+     C  G    +    C DVDEC+     C     C N  G +               TC +I +C+ Y         E    +  C C +GF+ ++    CEDV+EC  L   C  +  C N  G Y C C  GY+  +    TC DIDEC   +   IC + +C N PG F+C C  SGY+++ N   C+DI+EC     +  I   S+N    CFN+ GS++CL   CP  YR  +++
Sbjct:  190 QQCRDTGDEVICSCFVGYQLQSDGVSCEDINECITGSHNCRLGESCINTVGSFRCQRDSSCGTGYELT-EDNNCKDIDECETGIHNCPPDFICQNTLGSFRCRPKL-------------QCKSGFIQDALGN-CIDINECLS-ISAPC-PVGQTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECSPPAEPCGKGHHCLNSPGSFRCECKAGFYFDGISRTCVDINECQRYPGRLCGHKCENTPGSFHCSCSAGFRLSVDGRSCEDVNEC--LNSPCSQE--CANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSY-RCINIPGSFQCSCPSSGYRLAPNGRNCQDIDEC-----VTGIHNCSINE--TCFNIQGSFRCLSFECPENYRRSADT 568          

HSP 2 Score: 73.9442 bits (180), Expect = 2.107e-12
Identity = 68/250 (27.20%), Postives = 102/250 (40.80%), Query Frame = 3
Query:  294 KKCQDCQFNKVYNETLRRCVDMDDTNVT--------------------CESGYQFVFEEKKCKDINECSQ-KADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINI-CEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKI-ANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKC 974
            K   +C      NE   RCVD+D+ +                      C++G+ F    + C DINEC +    +C     C N PGS+ C     C  G+  +++ ++C D+NEC  S         C NV GS+ C                  C+ GY+ + +  + CEDIDEC  P       ++  C+  PG   C    SG  +      C D+DEC    +NC+  + C N  G + C   +C
Sbjct:  338 KNVPNCGRGYHLNEEGTRCVDVDECSPPAEPCGKGHHCLNSPGSFRCECKAGFYFDGISRTCVDINECQRYPGRLC--GHKCENTPGSFHC----SCSAGFRLSVDGRSCEDVNECLNS----PCSQECANVYGSYQC-----------------YCRRGYQLSDVDGVTCEDIDECALPTGGHICSYR--CINIPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGSFRCLSFEC 558          
BLAST of Latent-transforming growth factor beta-binding protein vs. UniProt/SwissProt
Match: sp|Q14766|LTBP1_HUMAN (Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens OX=9606 GN=LTBP1 PE=1 SV=4)

HSP 1 Score: 152.14 bits (383), Expect = 5.724e-37
Identity = 126/361 (34.90%), Postives = 161/361 (44.60%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGN---KGRCKNEIGRYNCQCNPGYEFKNA--TCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSN-ENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRV 1442
            C  GY+F  +++KC DI+EC+Q   +C     C N  GS+ CI    C  G+  + E   CID++EC +    C  G  C N +G+F C                  C  GYR       CEDIDEC  P         E CV  PG   C   C+ G       C DVDEC E  N C +   C+N  G Y CS                  C  G+ R      C D+DEC       GN    G+CKN  G + C C  GY+   A   C DIDEC   + +C H +C NT G F+CVC  GY+ S   + CEDINEC E   +C+        R +C N  GSY C    CP G+++
Sbjct:  900 CYEGYRFSEQQRKCVDIDECTQVQHLCSQGR-CENTEGSFLCI----CPAGFMASEEGTNCIDVDECLRP-DVCGEGH-CVNTVGAFRCE----------------YCDSGYRMT-QRGRCEDIDECLNPSTCP----DEQCVNSPGSYQC-VPCTEGFRGWNGQCLDVDECLE-PNVCANGD-CSNLEGSYMCS------------------CHKGYTRTPDHKHCRDIDECQQ-----GNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDEC-QHRHLCAHGQCRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDKSVCQ--------RGDCINTAGSYDC---TCPDGFQL 1194          

HSP 2 Score: 114.005 bits (284), Expect = 1.086e-24
Identity = 95/300 (31.67%), Postives = 135/300 (45.00%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECVSLKDICGHLKCENTPGFFKCVC 1268
            +C  GY    + K C+DI+EC Q+ ++C +N  C+N  GS++C     CGQGY+ +     C D++EC Q    C  G  C N  GSF C                  C +GYR + L + CEDI+EC     + C+  +  C+   G   C T   G  +     C D++EC E+   C     C N  G +                   C C+ GF  +     CED+DEC +   VC + G C N  G + C C  G++       C+D++EC  L  +CG   CEN  G F CVC
Sbjct: 1063 SCHKGYTRTPDHKHCRDIDEC-QQGNLC-VNGQCKNTEGSFRCT----CGQGYQLSAAKDQCEDIDEC-QHRHLCAHGQ-CRNTEGSFQCV-----------------CDQGYRASGLGDHCEDINECLEDKSV-CQ--RGDCINTAGSYDC-TCPDGFQLDDNKTCQDINEC-EHPGLCGPQGECLNTEGSF------------------HCVCQQGFSISADGRTCEDIDECVNNT-VCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVC 1313          

HSP 3 Score: 107.071 bits (266), Expect = 1.540e-22
Identity = 105/350 (30.00%), Postives = 154/350 (44.00%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENV-CEDINECTETPGICRIERLSLNNRVECFNLVGSYKCL 1412
            V C  G  F     +C D++EC +  ++C  N  C NL GSY C     C +GY    + + C D++EC Q    C +G  C+N  GSF C                  C +GY+ +   + CEDIDEC   +R  C   +  C    G   C          + + C D++EC E+K+ C     C N  G Y C+                  C  GF+ +     C+D++EC+    +CG +G C N  G ++C C  G+       TC DIDECV+      H  C+NT G F+C+C  G++   +   C D+NEC    G+C            C N+ GS+ C+
Sbjct: 1023 VPCTEG--FRGWNGQCLDVDECLE-PNVC-ANGDCSNLEGSYMC----SCHKGYTRTPDHKHCRDIDECQQG-NLCVNGQ-CKNTEGSFRCT-----------------CGQGYQLSAAKDQCEDIDECQ--HRHLCAHGQ--CRNTEGSFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGD-CINTAGSYDCT------------------CPDGFQLD-DNKTCQDINECEHPG-LCGPQGECLNTEGSFHCVCQQGFSISADGRTCEDIDECVNNTVCDSHGFCDNTAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVC--------GEAFCENVEGSFLCV 1312          

HSP 4 Score: 63.1586 bits (152), Expect = 5.972e-9
Identity = 100/367 (27.25%), Postives = 144/367 (39.24%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKE------ICV---RKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIK-CEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLI-PVCGN--------KGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSL-KDICGHLKCENTPGFFKCVCKSG-YKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCL 1412
            TC  G+Q   + K C+DINEC     +C     C N  GS+ C+    C QG+  + + +TC D++EC  +   CDS   C+N  GSF C                  C +G++       C D++EC     +  E F E      +CV        S    QC   T    ++  DVD+  E K  C           YY  ++   C+     N   +EC C SG             D C+    PV G         KG+     G  + +   G  +K     D DEC+   ++IC +  C NT   ++C CK G Y    +  C D++EC + P  C           +C N  GSY C 
Sbjct: 1187 TCPDGFQL-DDNKTCQDINECEHPG-LCGPQGECLNTEGSFHCV----CQQGFSISADGRTCEDIDECVNNT-VCDSHGFCDNTAGSFRCL-----------------CYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEYSPMTGQCRSRTSTDLDV--DVDQPKEEKKEC-----------YYNLNDASLCDNVLAPNVTKQECCCTSGVGWG---------DNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAG-GENYK-----DADECLLFGQEICKNGFCLNTRPGYECYCKQGTYYDPVKLQCFDMDEC-QDPSSCI--------DGQCVNTEGSYNCF 1492          
BLAST of Latent-transforming growth factor beta-binding protein vs. TrEMBL
Match: A0A2T7NK28 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_17323 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 6.182e-52
Identity = 121/357 (33.89%), Postives = 175/357 (49.02%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENV-CEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            +C +G+    + + C DINEC   A+ C  N+ C N PGSY+C     CG G+  + ++QTC D+NEC +    C+    C+N++GSF C                  C  GYR +     C DI+EC  P +    P    CV  PG   C T  +G ++  + IC D +EC E  + C+  + C N  G Y C ++                C  GF R + +G+C+D+DEC + I  C    RC N  G Y CQC  G++ +     C+D+DEC    DIC H  C NT G F+C C  GY+++ +   C+DINEC E       +R+       CFN  GS+ C++  CP+ Y
Sbjct: 3530 SCPAGFTLAADARTCNDINECLLDAE-CLPNQECINTPGSYQC--TSLCGDGFRRSQDSQTCEDINECVEQPDLCERS--CQNLVGSFRC-----------------SCPHGYRLSDG-GRCVDINECENPSK----PCSHDCVNMPGSYRC-TCPAGFSLANSYICQDRNECYEGTHRCSVEEECINTEGAYQCIKL----------------CPQGFIR-VASGECQDIDECATNIHRCFGNQRCINTDGGYQCQCPKGFQTRGPGQPCIDVDECSQRTDICQH-NCTNTQGSFQCTCPPGYRLAPDGYSCQDINECWE-------DRIQCGTDQVCFNTRGSFTCIDVPCPTNY 3833          

HSP 2 Score: 135.191 bits (339), Expect = 5.988e-29
Identity = 83/279 (29.75%), Postives = 128/279 (45.88%), Query Frame = 3
Query:  693 HQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNA-TCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY-RVLS-ESSSTKACQLSYPTCSYTKSERCV 1520
            +QC EG+  +   + C D DEC+     +  P    C   PG  +C           A  C D++EC  +   C   Q C N  G Y C+ +                C  GF+R+  +  CED++EC     +C  +  C+N +G + C C  GY   +   C+DI+EC +    C H  C N PG ++C C +G+ ++N  +C+D NEC E    C +E        EC N  G+Y+C++ +CP G+ RV S E      C  +   C    ++RC+
Sbjct: 3489 NQCPEGFFQDQEASYCNDDDECS-----RISPCSHYCHNAPGSFSCSCPAGFTLAADARTCNDINECLLDAE-CLPNQECINTPGSYQCTSL----------------CGDGFRRSQDSQTCEDINECVEQPDLC--ERSCQNLVGSFRCSCPHGYRLSDGGRCVDINECENPSKPCSH-DCVNMPGSYRCTCPAGFSLANSYICQDRNECYEGTHRCSVEE-------ECINTEGAYQCIK-LCPQGFIRVASGECQDIDECATNIHRC--FGNQRCI 3732          
BLAST of Latent-transforming growth factor beta-binding protein vs. TrEMBL
Match: A0A564Z323 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS11562 PE=4 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 7.727e-52
Identity = 157/543 (28.91%), Postives = 243/543 (44.75%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCR-PPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECT------GPYRLQCEPFKEICVRKPGLSTCET--QCSGGTIKIA--NICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCE-GYEELNNAT-----------------------------KECHCKSGFKRNLY-TGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYE--FKNATCLDIDECVSL--KDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIIL--RPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVND 1862
            C +GY F  E   C+DINEC   + +C   E C N PG Y C  K  C  GY+ N     C D++EC      C  G +C N  GS+ C   PC   + + +      C  G++   L N C DIDEC        P    C    ++CV   G   C T   C  G  ++     C D++ECA  +  C     C N  G Y C    CE G+  +N+ T                               C C +GF  + Y    C DV+EC   I  CG+  +C N+ G Y+C+C PGY   + N TC+DI+ECV +  ++IC    C NTPG F+C C SG+++ +   C DINEC E  GIC   R +      C NL GSY+C+   CP+ Y V S+  +   C L       T    C+   P  + +  I++    T    + E+   ++     +V++    A++T +K+ + + +S+ L  +P+ D + + + ++  +   A+I + + L        ++ S    +++  +
Sbjct:   32 CPNGYIFNEERNSCEDINECEMNSTLCRPFEKCTNRPGDYVCEPKLRCEWGYQLNSNGTACDDVDECKIRAFNCQHGQICVNTPGSYKCENSPCHYTERYDYTLEKCVCPSGFQH--LGNACVDIDECAEEEKHGDPQNPLCGAH-QVCVNTVGAYRCVTLSDCPKGFHRVTPKASCTDINECANGEAKCGSNMYCENTLGSYRC---LCERGFRNVNDTTCVDINECEVFRPEESCPDRRAKCVNTAGSYRCICPNGFVWHSYPVYACRDVNECVLGIDTCGHDHKCINDEGGYHCECAPGYRLNWDNRTCIDINECVEMGARNICQSGNCVNTPGSFRCDCPSGFRLGHGGTCIDINECQEHDGIC-TSRHARGITFSCVNLHGSYRCVSERCPTMY-VKSKVPNGYRCTLMPGYECNTFDPYCLNDRPLRMDHLHIELPAVLTKRLVLGELDSSIVKRGTVNVELLEHYAYDTCTKRHISVRNSLKLAVKPS-DRRTVELLLIKPIEPPADIFVSVRLSELIGQRSKVRSTTRFYLYATE 565          

HSP 2 Score: 138.658 bits (348), Expect = 7.730e-31
Identity = 108/295 (36.61%), Postives = 141/295 (47.80%), Query Frame = 3
Query:  609 MVCENVIGSFNCRPP-CPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCET--QCSGGTIKIAN--ICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDEC-------DSLIPVCGNKGRCKNEIGRYNC----QCNPGYE--FKNATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            M+C NV G   C P  CP       N  C  C  GY +N   N CEDI+EC     L C PF E C  +PG   CE   +C  G    +N   C DVDEC     NC   Q C N  G Y C    C   E  +   ++C C SGF+       C D+DEC       D   P+CG    C N +G Y C     C  G+      A+C DI+EC + +  CG ++ CENT G ++C+C+ G++  N+  C DINEC     + R E    + R +C N  GSY+C   ICP+G+
Sbjct:    1 MICVNVRGGMKCIPKKCPGKLRRNSNGECAPCPNGYIFNEERNSCEDINECEMNSTL-CRPF-EKCTNRPGDYVCEPKLRCEWGYQLNSNGTACDDVDECKIRAFNCQHGQICVNTPGSYKCENSPCHYTERYDYTLEKCVCPSGFQH--LGNACVDIDECAEEEKHGDPQNPLCGAHQVCVNTVGAYRCVTLSDCPKGFHRVTPKASCTDINECANGEAKCGSNMYCENTLGSYRCLCERGFRNVNDTTCVDINECE----VFRPEESCPDRRAKCVNTAGSYRC---ICPNGF 284          

HSP 3 Score: 67.781 bits (164), Expect = 4.536e-8
Identity = 61/203 (30.05%), Postives = 87/203 (42.86%), Query Frame = 3
Query:  930 CNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQ----CNPGYEFKN--ATCLDIDECVSLKDICGHLK-CENTPGFF------------------KCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLE-SICPSGYRVLSESSS 1460
            C N  G   C   KC G    N+  +   C +G+  N     CED++EC+    +C    +C N  G Y C+    C  GY+  +    C D+DEC      C H + C NTPG +                  KCVC SG++    N C DI+EC E       +         C N VG+Y+C+  S CP G+  ++  +S
Sbjct:    3 CVNVRGGMKCIPKKCPGKLRRNSNGECAPCPNGYIFNEERNSCEDINECEMNSTLCRPFEKCTNRPGDYVCEPKLRCEWGYQLNSNGTACDDVDECKIRAFNCQHGQICVNTPGSYKCENSPCHYTERYDYTLEKCVCPSGFQHLG-NACVDIDECAEEEKHGDPQNPLCGAHQVCVNTVGAYRCVTLSDCPKGFHRVTPKAS 204          
BLAST of Latent-transforming growth factor beta-binding protein vs. TrEMBL
Match: A0A564Z2L5 (Uncharacterized protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS11562 PE=4 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 4.830e-50
Identity = 143/385 (37.14%), Postives = 194/385 (50.39%), Query Frame = 3
Query:  342 RRCVDMDDT-NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRP-PCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCET--QCSGGTIKIAN--ICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDEC-------DSLIPVCGNKGRCKNEIGRYNC----QCNPGYE--FKNATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            ++C++ + + + TC++G+Q   E++ C DI+EC    DIC     CRN+ GSY+CI +  CG GY  N ETQ C D++EC      C   M+C NV G   C P  CP       N  C  C  GY +N   N CEDI+EC     L C PF E C  +PG   CE   +C  G    +N   C DVDEC     NC   Q C N  G Y C    C   E  +   ++C C SGF+       C D+DEC       D   P+CG    C N +G Y C     C  G+      A+C DI+EC + +  CG ++ CENT G ++C+C+ G++  N+  C DINEC     + R E    + R +C N  GSY+C   ICP+G+
Sbjct:  421 QQCINTEGSYDCTCKNGFQRTREDE-CVDIDECKLSHDICKAGYECRNVIGSYQCIRQVPCGFGYVLNQETQECEDIDECKAQPDICGPNMICVNVRGGMKCIPKKCPGKLRRNSNGECAPCPNGYIFNEERNSCEDINECEMNSTL-CRPF-EKCTNRPGDYVCEPKLRCEWGYQLNSNGTACDDVDECKIRAFNCQHGQICVNTPGSYKCENSPCHYTERYDYTLEKCVCPSGFQH--LGNACVDIDECAEEEKHGDPQNPLCGAHQVCVNTVGAYRCVTLSDCPKGFHRVTPKASCTDINECANGEAKCGSNMYCENTLGSYRCLCERGFRNVNDTTCVDINECE----VFRPEESCPDRRAKCVNTAGSYRC---ICPNGF 793          

HSP 2 Score: 120.168 bits (300), Expect = 1.829e-24
Identity = 112/386 (29.02%), Postives = 155/386 (40.16%), Query Frame = 3
Query:  309 CQFNKVYNETLRRCVDMDD--------------TNV------------------------TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCR-PPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECT------GPYRLQCEPFKEICVRKPGLSTCET--QCSGGTIKIA--NICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIP--VCGN-KGRCKNEIGRYNCQCNPGYEFKN---ATCLDIDECVSLKDICGH-LKCENTPGFFKCVCKSGYKMSNEN 1298
            C F  V N+  + C D+D+               NV                         C +GY F  E   C+DINEC   + +C   E C N PG Y C  K  C  GY+ N     C D++EC      C  G +C N  GS+ C   PC   + + +      C  G++   L N C DIDEC        P    C    ++CV   G   C T   C  G  ++     C D++ECA  +  C     C N  G Y                   C C+ GF RN+    C D++EC+   P   C + + +C N  G Y C C  G+ + +     C D++ECV   D CGH  KC N  G + C C  GY+++ +N
Sbjct:  480 CGFGYVLNQETQECEDIDECKAQPDICGPNMICVNVRGGMKCIPKKCPGKLRRNSNGECAPCPNGYIFNEERNSCEDINECEMNSTLCRPFEKCTNRPGDYVCEPKLRCEWGYQLNSNGTACDDVDECKIRAFNCQHGQICVNTPGSYKCENSPCHYTERYDYTLEKCVCPSGFQH--LGNACVDIDECAEEEKHGDPQNPLCGA-HQVCVNTVGAYRCVTLSDCPKGFHRVTPKASCTDINECANGEAKCGSNMYCENTLGSY------------------RCLCERGF-RNVNDTTCVDINECEVFRPEESCPDRRAKCVNTAGSYRCICPNGFVWHSYPVYACRDVNECVLGIDTCGHDHKCINDEGGYHCECAPGYRLNWDN 843          
BLAST of Latent-transforming growth factor beta-binding protein vs. TrEMBL
Match: A0A0X3PA73 (Fibrillin-3 (Fragment) OS=Schistocephalus solidus OX=70667 GN=FBN3 PE=4 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 6.382e-50
Identity = 161/545 (29.54%), Postives = 235/545 (43.12%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCK--EGYRWNPLINICEDIDECT----GPYRLQ--CEPFKEICVRKPGLSTCET--QCSGGTIK--IANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNN-----------------------------ATKECHCKSGFKRNLY-TGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYE--FKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQ---ILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILR-PTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVND 1862
            V C SGY+F  +   C DINEC+    +C   E C N PG + C  K  C  G + N     C D++EC+     C    +C N +GS+ C  P P +    W+   H C    GYR       C DIDEC     G   L   C+  K  CV  PG   C T   C  G  +  I   C D+DECA     C     C N  G Y C  +   GY+ +N+                              + +C C +GF  + Y    C+DV+EC     +CG+  +C NE G Y C+C  G+     N TC+D++EC      C    C NTPG F+C C SGY++S+++ C DINEC E   IC   +       +C NL G Y+C+   CP  YR L +  S   C L            C++   +L EN    ++     E L   + E+   ++       ++ V  A+  +S   M   D+  LR  + D + + V ++  L   A++++  NL         + S+ +L+IF  +
Sbjct:  461 VPCPSGYEFNEKLSSCDDINECALNQTLCRPFEKCVNRPGDFICEPKLRCKWGMQINANGTACEDVDECSAQTFNCQHHEICVNTVGSYYC-APSPCHYTEVWDYEKHMCTCPHGYRHKN--GECIDIDECAEDVAGVTNLNPLCKDGK-TCVNTPGGYRCVTLTGCPAGFKRNSIREPCMDIDECATGIAKCGLNMHCENTIGSYRC--LCQRGYKNVNDTACVDIDECKVFSSIESCADPRARCVNTAGSYKCICPNGFVWHSYPVYACKDVNECVITPDICGHGHKCVNEEGGYRCECANGFRTGMDNRTCVDVNECSESSGGCKDGICVNTPGGFRCDCPSGYRLSDQHQCVDINECQEKEDICEPRQARGLMVFKCLNLQGDYRCISEHCPKMYR-LEKMQSGFRCHLKPEHACRAYDHGCLRDRPLLIENYHIELVAPMKHEQL---LAEVDSSIIVNGTVRAELRVHYAYQMRSNLHMSTEDAFKLRLKSPDSRFVDVVLLRPLEAPADLLISANLFAVRGRMRALKSVTKLYIFTTE 995          

HSP 2 Score: 192.971 bits (489), Expect = 2.659e-48
Identity = 137/384 (35.68%), Postives = 187/384 (48.70%), Query Frame = 3
Query:  342 RRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCR-PPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCET--QCSGGTIKIAN--ICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDEC-------DSLIPVCGNKGRCKNEIGRYNC----QCNPGYEFKN--ATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            + C+  D+    C  GY++  +   C+DI+EC     IC     CRN+ GSY+CI +  CG GY  N ETQ C D++EC      C   M+C NV G   C    CP  +    +  C  C  GY +N  ++ C+DI+EC     L C PF E CV +PG   CE   +C  G    AN   C DVDEC+    NC   + C N  G Y C+   C   E  +     C C  G++     G+C D+DEC        +L P+C +   C N  G Y C     C  G++  +    C+DIDEC +    CG ++ CENT G ++C+C+ GYK  N+  C DI+EC     I        + R  C N  GSYKC   ICP+G+
Sbjct:  343 KMCIPKDNLPFKCPPGYEYKDDTGDCQDIDECKFNRTICRRGYKCRNILGSYQCIRQVPCGFGYILNPETQDCEDIDECKMDPDVCGPNMLCVNVRGGMRCMTKKCPGKQRRDSSGNCVPCPSGYEFNEKLSSCDDINECALNQTL-CRPF-EKCVNRPGDFICEPKLRCKWGMQINANGTACEDVDECSAQTFNCQHHEICVNTVGSYYCAPSPCHYTEVWDYEKHMCTCPHGYRHK--NGECIDIDECAEDVAGVTNLNPLCKDGKTCVNTPGGYRCVTLTGCPAGFKRNSIREPCMDIDECATGIAKCGLNMHCENTIGSYRCLCQRGYKNVNDTACVDIDECKVFSSI----ESCADPRARCVNTAGSYKC---ICPNGF 715          
BLAST of Latent-transforming growth factor beta-binding protein vs. TrEMBL
Match: A0A0V0J931 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR149309 PE=4 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 6.442e-50
Identity = 158/543 (29.10%), Postives = 234/543 (43.09%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECT----GPYRLQ--CEPFKEICVRKPGLSTCET--QCSGGTIK--IANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNN-----------------------------ATKECHCKSGFKRNLY-TGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYE--FKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQ---ILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILR-PTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVND 1862
            V C SGY+F  +   C DINEC+    +C   E C N PG + C  K  C  G + N     C D++EC+     C    +C N +GS+ C P  P +    W+   H C   + +      C DIDEC     G   L   C+  K  CV  PG   C T   C  G  +  I   C D+DECA     C     C N  G Y C  +   GY+ +N+                              + +C C +GF  + Y    C+DV+EC     +CG+  +C NE G Y C+C  G+     N TC+D++EC      C    C NTPG F+C C SGY++S+++ C DINEC E   IC   +       +C NL G Y+C+   CP  YR L +  S   C L            C++   +L EN    ++     E L   + E+   ++       ++ V  A+  +S   M   D+  LR  + D + + V ++  L   A++++  NL         + S+ +L+IF  +
Sbjct:  511 VPCPSGYEFNEKLSSCDDINECALNQTLCRPFEKCVNRPGDFICEPKLRCKWGMQINANGTACEDVDECSAQTFNCQHHEICVNTVGSYYCAPS-PCHYTEVWDYEKHMCTCPHGYRHKNGECIDIDECAEDVAGVTNLNPLCKDGK-TCVNTPGGYRCVTLTGCPAGFKRNSIREPCMDIDECATGIAKCGLNMHCENTIGSYRC--LCQRGYKNVNDTACVDIDECKVFSSIESCADPRARCVNTAGSYKCICPNGFVWHSYPVYACKDVNECVITPDICGHGHKCVNEEGGYRCECANGFRTGMDNRTCVDVNECSESSGGCKDGICVNTPGGFRCDCPSGYRLSDQHQCVDINECQEKEDICEPRQARGLMVFKCLNLQGDYRCISEHCPKMYR-LEKMQSGFRCHLKPEHACRAYDHGCLRDRPLLIENYHIELVAPMKHEQL---LAEVDSSIIVNGTVRAELRVHYAYQMRSNLHMSTEDAFKLRLKSPDSRFVDVVLLRPLEAPADLLISANLFAVRGRMRALKSVTKLYIFTTE 1045          

HSP 2 Score: 184.496 bits (467), Expect = 2.403e-45
Identity = 135/372 (36.29%), Postives = 181/372 (48.66%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCR-PPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCET--QCSGGTIKIAN--ICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDEC-------DSLIPVCGNKGRCKNEIGRYNC----QCNPGYEFKN--ATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            C+ GY     + +C DI+EC     IC     CRN+ GSY+CI +  CG GY  N ETQ C D++EC      C   M+C NV G   C    CP  +    +  C  C  GY +N  ++ C+DI+EC     L C PF E CV +PG   CE   +C  G    AN   C DVDEC+    NC   + C N  G Y C+   C   E  +     C C  G++     G+C D+DEC        +L P+C +   C N  G Y C     C  G++  +    C+DIDEC +    CG ++ CENT G ++C+C+ GYK  N+  C DI+EC     I        + R  C N  GSYKC   ICP+G+
Sbjct:  406 CKPGYTMS-RDGECIDIDECKFNRTICRRGYKCRNILGSYQCIRQVPCGFGYILNPETQDCEDIDECKMDPDVCGPNMLCVNVRGGMRCMTKKCPGKQRRDSSGNCVPCPSGYEFNEKLSSCDDINECALNQTL-CRPF-EKCVNRPGDFICEPKLRCKWGMQINANGTACEDVDECSAQTFNCQHHEICVNTVGSYYCAPSPCHYTEVWDYEKHMCTCPHGYRHK--NGECIDIDECAEDVAGVTNLNPLCKDGKTCVNTPGGYRCVTLTGCPAGFKRNSIREPCMDIDECATGIAKCGLNMHCENTIGSYRCLCQRGYKNVNDTACVDIDECKVFSSI----ESCADPRARCVNTAGSYKC---ICPNGF 765          

HSP 3 Score: 152.91 bits (385), Expect = 7.415e-35
Identity = 133/428 (31.07%), Postives = 179/428 (41.82%), Query Frame = 3
Query:  306 DCQFNKVYNETLRRCVDMDDT-----NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKD--------------YCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQ----------------CSGGTIKIANICYDVDECAENKNN-------CTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNAT-CLDIDECVSLKDI--CG--HLKCENTPGFFKCVCKSGYKMSNENV--CEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRV 1442
            +C+FN+       +C ++  +      V C  GY    E + C+DI+EC    D+C  N  C N+ G  +C+ K                C  GYEFN +  +C D+NECA +   C     C N  G F C P               +CK G + N     CED+DEC+      C+   EICV   G   C                   C  G       C D+DECAE+          C D + C N  G Y C  +                C +GFKRN     C D+DEC + I  CG    C+N IG Y C C  GY+  N T C+DIDEC     I  C     +C NT G +KC+C +G+   +  V  C+D+NEC  TP IC        +  +C N  G Y+C    C +G+R 
Sbjct:  423 ECKFNRTICRRGYKCRNILGSYQCIRQVPCGFGYILNPETQDCEDIDECKMDPDVCGPNMLCVNVRGGMRCMTKKCPGKQRRDSSGNCVPCPSGYEFNEKLSSCDDINECALNQTLCRPFEKCVNRPGDFICEPKL-------------RCKWGMQINANGTACEDVDECSA-QTFNCQ-HHEICVNTVGSYYCAPSPCHYTEVWDYEKHMCTCPHGYRHKNGECIDIDECAEDVAGVTNLNPLCKDGKTCVNTPGGYRCVTLT--------------GCPAGFKRNSIREPCMDIDECATGIAKCGLNMHCENTIGSYRCLCQRGYKNVNDTACVDIDECKVFSSIESCADPRARCVNTAGSYKCICPNGFVWHSYPVYACKDVNECVITPDIC-------GHGHKCVNEEGGYRCE---CANGFRT 811          

HSP 4 Score: 64.6994 bits (156), Expect = 6.343e-7
Identity = 44/116 (37.93%), Postives = 61/116 (52.59%), Query Frame = 3
Query: 1143 QCNPGYEFKNAT--CLDIDECVS-------LKDICGHLK--CENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESI-CPSGYRVLSES 1454
            +C PGYE+K+ T  C D+DEC             C +    C+NTPG F+C CK GY MS +  C DI+EC     ICR          +C N++GSY+C+  + C  GY +  E+
Sbjct:  354 KCPPGYEYKDDTGDCQDVDECTEGIYENNMYIAACPNATQVCKNTPGSFECGCKPGYTMSRDGECIDIDECKFNRTICR-------RGYKCRNILGSYQCIRQVPCGFGYILNPET 462          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Cavefish
Match: fbln1 (fibulin 1 [Source:NCBI gene;Acc:30240])

HSP 1 Score: 147.902 bits (372), Expect = 2.301e-37
Identity = 149/559 (26.65%), Postives = 228/559 (40.79%), Query Frame = 3
Query:  342 RRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDEC---TGPYRLQCEPFKEICVRKPGLSTCE---TQCSGG--TIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATK---------------------------ECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNA---TCLDIDECV--SLKDICGHLKCENTPGFFKCVCKS-GYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSS----------TKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVND 1862
            +RCV   +    C +GY+   + K C+DINEC   +  C   E C N  GSY+C  +  CG GYE   ++ +C D++EC  +   C     C+N  GSF C P               QC+ GY  + L   C DI+EC    GP      P  ++C+   G  TC+     C  G    +    C D+DECA + N C     C N  G Y C   +C      N+ T+                           +C C +GFK       C+D++EC+S    C  +  C N  G Y C C  GY+  +    TC DIDEC   +   IC + +C NTPG F C C + GY ++ N   C+D++EC      C       +    CFN+ G ++CL   CP  YR  SE+ +           K+CQ +  TC           +     +R  +    E + +  +  P    + D   +  ++++         +  +  II R        +V  +  L   A  VL + +           ++  +H+FV++
Sbjct:  105 QRCVG--NNTCACFAGYKLKPDGKNCEDINECLLGSHHCRPGERCINTMGSYRCQREVSCGTGYEL-TDSNSCKDIDECETNTHNCPKDFECQNTPGSFRCHPS-------------AQCQAGYIQDAL-GSCIDINECLSVAGPC-----PSGQLCINTVGSYTCQRNSVSCGRGYHLNEEGTRCVDIDECAGSDNACAG-HGCINLVGSYRC---ECRSGFTFNSITRVCEDINECRHFPGRLCAHKCDNVLGSYKCSCTTGFKLASDGRNCDDLNECES--SPCSQE--CANVYGSYQCYCRRGYQLSDVDGITCEDIDECALPTGGHICSY-RCHNTPGSFHCTCPAKGYTLAPNGRSCQDVDECVTGTHTC-------SETESCFNIQGGFRCLNFDCPPNYRRSSETRARVDRSDTIRCIKSCQPNDITCVLDPVHSVSHTVISLPTFR--EFNKPEEIVFLRSVTPSHYPHMDSPELIYDIQEG-------NIHNSFDIIKRVEHGMIVGVVRQVKPLVGPASTVLKLAMNYVMNGVVSHRNIINVHVFVSE 616          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Cavefish
Match: fbln1 (fibulin 1 [Source:NCBI gene;Acc:30240])

HSP 1 Score: 147.902 bits (372), Expect = 3.151e-37
Identity = 149/559 (26.65%), Postives = 228/559 (40.79%), Query Frame = 3
Query:  342 RRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDEC---TGPYRLQCEPFKEICVRKPGLSTCE---TQCSGG--TIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATK---------------------------ECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNA---TCLDIDECV--SLKDICGHLKCENTPGFFKCVCKS-GYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSS----------TKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVND 1862
            +RCV   +    C +GY+   + K C+DINEC   +  C   E C N  GSY+C  +  CG GYE   ++ +C D++EC  +   C     C+N  GSF C P               QC+ GY  + L   C DI+EC    GP      P  ++C+   G  TC+     C  G    +    C D+DECA + N C     C N  G Y C   +C      N+ T+                           +C C +GFK       C+D++EC+S    C  +  C N  G Y C C  GY+  +    TC DIDEC   +   IC + +C NTPG F C C + GY ++ N   C+D++EC      C       +    CFN+ G ++CL   CP  YR  SE+ +           K+CQ +  TC           +     +R  +    E + +  +  P    + D   +  ++++         +  +  II R        +V  +  L   A  VL + +           ++  +H+FV++
Sbjct:  132 QRCVG--NNTCACFAGYKLKPDGKNCEDINECLLGSHHCRPGERCINTMGSYRCQREVSCGTGYEL-TDSNSCKDIDECETNTHNCPKDFECQNTPGSFRCHPS-------------AQCQAGYIQDAL-GSCIDINECLSVAGPC-----PSGQLCINTVGSYTCQRNSVSCGRGYHLNEEGTRCVDIDECAGSDNACAG-HGCINLVGSYRC---ECRSGFTFNSITRVCEDINECRHFPGRLCAHKCDNVLGSYKCSCTTGFKLASDGRNCDDLNECES--SPCSQE--CANVYGSYQCYCRRGYQLSDVDGITCEDIDECALPTGGHICSY-RCHNTPGSFHCTCPAKGYTLAPNGRSCQDVDECVTGTHTC-------SETESCFNIQGGFRCLNFDCPPNYRRSSETRARVDRSDTIRCIKSCQPNDITCVLDPVHSVSHTVISLPTFR--EFNKPEEIVFLRSVTPSHYPHMDSPELIYDIQEG-------NIHNSFDIIKRVEHGMIVGVVRQVKPLVGPASTVLKLAMNYVMNGVVSHRNIINVHVFVSE 643          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Cavefish
Match: fbln1 (fibulin 1 [Source:NCBI gene;Acc:30240])

HSP 1 Score: 147.517 bits (371), Expect = 4.523e-37
Identity = 149/559 (26.65%), Postives = 228/559 (40.79%), Query Frame = 3
Query:  342 RRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDEC---TGPYRLQCEPFKEICVRKPGLSTCE---TQCSGG--TIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATK---------------------------ECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNA---TCLDIDECV--SLKDICGHLKCENTPGFFKCVCKS-GYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSS----------TKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVND 1862
            +RCV   +    C +GY+   + K C+DINEC   +  C   E C N  GSY+C  +  CG GYE   ++ +C D++EC  +   C     C+N  GSF C P               QC+ GY  + L   C DI+EC    GP      P  ++C+   G  TC+     C  G    +    C D+DECA + N C     C N  G Y C   +C      N+ T+                           +C C +GFK       C+D++EC+S    C  +  C N  G Y C C  GY+  +    TC DIDEC   +   IC + +C NTPG F C C + GY ++ N   C+D++EC      C       +    CFN+ G ++CL   CP  YR  SE+ +           K+CQ +  TC           +     +R  +    E + +  +  P    + D   +  ++++         +  +  II R        +V  +  L   A  VL + +           ++  +H+FV++
Sbjct:  151 QRCVG--NNTCACFAGYKLKPDGKNCEDINECLLGSHHCRPGERCINTMGSYRCQREVSCGTGYEL-TDSNSCKDIDECETNTHNCPKDFECQNTPGSFRCHPS-------------AQCQAGYIQDAL-GSCIDINECLSVAGPC-----PSGQLCINTVGSYTCQRNSVSCGRGYHLNEEGTRCVDIDECAGSDNACAG-HGCINLVGSYRC---ECRSGFTFNSITRVCEDINECRHFPGRLCAHKCDNVLGSYKCSCTTGFKLASDGRNCDDLNECES--SPCSQE--CANVYGSYQCYCRRGYQLSDVDGITCEDIDECALPTGGHICSY-RCHNTPGSFHCTCPAKGYTLAPNGRSCQDVDECVTGTHTC-------SETESCFNIQGGFRCLNFDCPPNYRRSSETRARVDRSDTIRCIKSCQPNDITCVLDPVHSVSHTVISLPTFR--EFNKPEEIVFLRSVTPSHYPHMDSPELIYDIQEG-------NIHNSFDIIKRVEHGMIVGVVRQVKPLVGPASTVLKLAMNYVMNGVVSHRNIINVHVFVSE 662          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Cavefish
Match: fbln2 (fibulin 2 [Source:ZFIN;Acc:ZDB-GENE-060711-1])

HSP 1 Score: 141.354 bits (355), Expect = 2.033e-35
Identity = 139/516 (26.94%), Postives = 215/516 (41.67%), Query Frame = 3
Query:  423 DINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQ---CSGG--TIKIANICYDVDECAENKNNCTDTQRCNNYFGYY---------------TCSEIK---------CEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECV-SLKDICGHLKCENTPGFFKCVC-KSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEI-PIEVLNYDHYHVKV---NVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFV 1856
            D+NEC      C   E C N  G+Y C     C  GY+  +    C D++EC      C SG+ C+N +GSF+C            +S   +C  G+  +   N C DIDEC+         F   C+   G  TC+ +   CS G  +      C DVDECA   + C + Q C+N  G +               TC +I          C    E    + +C C SGF        CED++ECD+    C  +  C N  G Y C C  GY  K    TC DIDEC  S+ ++C   +C N  G ++C C   GY MS N   C DI+EC      C   +        C+N+ GS++CL   CP  YR ++++   ++   ++  C         Q LP  + Y  +  + +  +P +I  I P      D+  + +   N +  F+T+                       V++   +P   + ++D+ +KL  Q T   + +  +++F+
Sbjct:   73 DLNECVTNTHTCLAGERCVNTVGAYVCERLISCPSGYQ--LRNGVCEDIDECVLRTHNCGSGLQCQNTLGSFHC------------SSKQQRCLTGFTQDTHSN-CIDIDECSVLSDACTAGFN--CINTVGSYTCQRKVVTCSRGFHSSNDGTRCVDVDECAMGTHTCGEGQVCHNTPGSFRCDCQTGYQYDSARRTCLDINECWRFPGRLCAQSCENTPGSYQCSCTSGFSLAFDGKNCEDLNECDN--NPCSQE--CANVYGSYQCYCRLGYYLKEDGHTCEDIDECSQSIGNLCA-FQCVNVQGSYQCACPPEGYSMSPNGRTCRDIDECATGAHNCSATQ-------TCYNIQGSFRCLSFTCPENYRKVTDTRCERSSCPNFQDC---------QNLPLRITYYQLSFQTNIVIPAQIFRIGPSPAYTGDNILISIPRGNEEGFFSTRRLNSF---------------TGAVYLQRQIPGPRDFLIDVEMKLLRQGTVTSF-IARIYVFI 534          

HSP 2 Score: 102.449 bits (254), Expect = 1.585e-22
Identity = 93/310 (30.00%), Postives = 126/310 (40.65%), Query Frame = 3
Query:  408 EKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDY-CGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGN--KGRCKNEIGRYNCQCNP-GYEFK--NATCLDIDECVSLKDICGHLK-CENTPGFFKCV---CKSGYKMSNENVCE 1307
               C DI+ECS  +D C     C N  GSY C  K   C +G+  + +   C+D++ECA     C  G VC N  GSF C                  C+ GY+++     C DI+EC   +R       + C   PG   C              C D++EC  + N C  +Q C N +G Y                  +C+C+ G+        CED+DEC   I   GN    +C N  G Y C C P GY       TC DIDEC +    C   + C N  G F+C+   C   Y+   +  CE
Sbjct:  160 HSNCIDIDECSVLSDACTAGFNCINTVGSYTCQRKVVTCSRGFHSSNDGTRCVDVDECAMGTHTCGEGQVCHNTPGSFRC-----------------DCQTGYQYDSARRTCLDINEC---WRFPGRLCAQSCENTPGSYQCSCTSGFSLAFDGKNCEDLNEC--DNNPC--SQECANVYGSY------------------QCYCRLGYYLKEDGHTCEDIDECSQSI---GNLCAFQCVNVQGSYQCACPPEGYSMSPNGRTCRDIDECATGAHNCSATQTCYNIQGSFRCLSFTCPENYRKVTDTRCE 424          

HSP 3 Score: 82.8037 bits (203), Expect = 3.349e-16
Identity = 68/235 (28.94%), Postives = 101/235 (42.98%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQ-SLKYCDSGMVCENVIGSFNCR----------------------PPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKI-ANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKC-EGYEELNNA 1001
            VTC  G+    +  +C D++EC+     C   + C N PGS++C     C  GY+++   +TC+D+NEC +   + C     CEN  GS+ C                        PC     + + S    C+ GY      + CEDIDEC+      C  F+  CV   G   C     G ++      C D+DECA   +NC+ TQ C N  G + C    C E Y ++ + 
Sbjct:  196 VTCSRGFHSSNDGTRCVDVDECAMGTHTCGEGQVCHNTPGSFRCD----CQTGYQYDSARRTCLDINECWRFPGRLC--AQSCENTPGSYQCSCTSGFSLAFDGKNCEDLNECDNNPCSQECANVYGSYQCYCRLGYYLKEDGHTCEDIDECSQSIGNLCA-FQ--CVNVQGSYQCACPPEGYSMSPNGRTCRDIDECATGAHNCSATQTCYNIQGSFRCLSFTCPENYRKVTDT 421          

HSP 4 Score: 67.0106 bits (162), Expect = 3.091e-11
Identity = 51/171 (29.82%), Postives = 72/171 (42.11%), Query Frame = 3
Query:  306 DCQFNKVYNETLRRCVDMDD-------------------TNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECT 761
            DCQ    Y+   R C+D+++                      +C SG+   F+ K C+D+NEC         ++ C N+ GSY+C    YC  GY    +  TC D++EC+QS+        C NV GS+ C  P                 EGY  +P    C DIDEC 
Sbjct:  240 DCQTGYQYDSARRTCLDINECWRFPGRLCAQSCENTPGSYQCSCTSGFSLAFDGKNCEDLNECDNNP----CSQECANVYGSYQC----YCRLGYYLKEDGHTCEDIDECSQSIGNL-CAFQCVNVQGSYQCACP----------------PEGYSMSPNGRTCRDIDECA 385          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Cavefish
Match: ltbp1 (latent transforming growth factor beta binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-091202-8])

HSP 1 Score: 144.05 bits (362), Expect = 2.428e-35
Identity = 122/380 (32.11%), Postives = 172/380 (45.26%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCS----------------------EIKC-EGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNAT-CLDIDECVSLKDICGH-LKCENTPGFFKCVCKSGYKMSNENV-CEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            C  GY+   E   C DI+EC+   D+C  N  C+N PGS+ C     C  G+  + E  +CID+NEC +  + C    +C N +GS+NCR                 C  GYR   L   CED+DEC             +C    G   C + C  G       C D+DEC + +  C   Q C+N+ GY++C+                      E  C  G+ +    +  C C++GF+      +C+DVDEC  L  +C   G+C N +G Y C C PGY   N T C D+DECV    +  H  KC NT G F  +C+ GY ++ +   CED++EC     +CR   +       C N VGS+ C    C  GY+
Sbjct:  674 CNEGYRLDDEGNTCIDIDECADSPDLCS-NGRCKNTPGSFLCA----CHLGFIPDEEGTSCIDMNEC-EVPRMCPENSLCVNTLGSYNCR----------------LCDSGYRLG-LSGQCEDVDECQDGRVCP----SGLCYNTLGSFMC-SPCPEGFQGRDGQCVDIDECLD-RLACAHGQ-CSNHEGYFSCTCDEGFVPASDGKACIDIDECQDESMCTRGHCQNTEGSFICSCETGFRLASSGEQCDDVDECQELTGLCDGVGQCVNNMGSYYCNCPPGYRQVNGTSCQDVDECVEEAHLQLHDGKCVNTEGSFLFICEPGYMLTQDPPGCEDVDECALNRSVCRGHGV-------CQNTVGSFMCQ---CDPGYQ 1013          

HSP 2 Score: 115.931 bits (289), Expect = 2.856e-26
Identity = 120/409 (29.34%), Postives = 164/409 (40.10%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCP---------------------------TNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNAT--------KECH------------------CKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNAT-CLDIDECVSLKDICGHLKCENTPGFFKCVCKS-GYKMSNENVCEDINECTETPGICRIER----LSLNNRVECFNLVGSYKCLESIC 1424
             C  G+    E   C D+NEC +   +C  N  C N  GSY C +   C  GY   +  Q C D++EC Q  + C SG+ C N +GSF C P CP                           +N   Y++     C EG+        C DIDEC           +  C    G   C  +           C DVDEC E    C    +C N  G Y C+     GY ++N  +        +E H                  C+ G+        CEDVDEC     VC   G C+N +G + CQC+PGY+  +   C+D++EC  L D+CG   CEN PG F CVC   G + +         +C  TP    +ER     +LN+   C N++ S   +E  C
Sbjct:  715 ACHLGFIPDEEGTSCIDMNEC-EVPRMCPENSLCVNTLGSYNCRL---CDSGYRLGLSGQ-CEDVDEC-QDGRVCPSGL-CYNTLGSFMCSP-CPEGFQGRDGQCVDIDECLDRLACAHGQCSNHEGYFSC---TCDEGFVPASDGKACIDIDECQDESMCT----RGHCQNTEGSFICSCETGFRLASSGEQCDDVDECQELTGLCDGVGQCVNNMGSYYCNCPP--GYRQVNGTSCQDVDECVEEAHLQLHDGKCVNTEGSFLFICEPGYMLTQDPPGCEDVDECALNRSVCRGHGVCQNTVGSFMCQCDPGYQDSDGQGCVDLNECDLLSDVCGEAVCENVPGSFLCVCPDEGLEFNRMTA-----KCLPTPKASSVERKECYYNLNDENLCDNVLTSSVTIEECC 1101          

HSP 3 Score: 68.5514 bits (166), Expect = 1.654e-11
Identity = 48/146 (32.88%), Postives = 77/146 (52.74%), Query Frame = 3
Query: 1011 CHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGY--EFKNATCLDIDECVSLKDICGHLKCENTPGFFKC-VCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            C C  G++ +     C D+DEC     +C N GRCKN  G + C C+ G+  + +  +C+D++EC   +    +  C NT G + C +C SGY++     CED++EC +     R+    L     C+N +GS+ C  S CP G++
Sbjct:  672 CICNEGYRLDDEGNTCIDIDECADSPDLCSN-GRCKNTPGSFLCACHLGFIPDEEGTSCIDMNECEVPRMCPENSLCVNTLGSYNCRLCDSGYRLGLSGQCEDVDECQDG----RVCPSGL-----CYNTLGSFMC--SPCPEGFQ 805          

HSP 4 Score: 50.447 bits (119), Expect = 6.138e-6
Identity = 28/76 (36.84%), Postives = 41/76 (53.95%), Query Frame = 3
Query: 1185 DIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNE-NVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC 1409
            ++DEC+    ICG   C NT   + C+C  GY++ +E N C DI+EC ++P +C   R        C N  GS+ C
Sbjct:  647 EVDECIVSPQICGPGFCYNTAESYSCICNEGYRLDDEGNTCIDIDECADSPDLCSNGR--------CKNTPGSFLC 714          

HSP 5 Score: 49.6766 bits (117), Expect = 9.895e-6
Identity = 90/374 (24.06%), Postives = 147/374 (39.30%), Query Frame = 3
Query:  333 ETLRRCVD-MDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAE---NKNNCTDTQRCNNYFG---YYTCS-EIKCEGYEELNNATKECHC--KSGFKRNLYTGKC--EDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLK-DICGHLKCENTPGFFKCVCKSGYKMSNENV-CEDINECTETPGICRIERLSLNNRVECFNLVGSYKCL 1412
            + + +CV+ M      C  GY+ V     C+D++EC ++A +   +  C N  GS+  I    C  GY    +   C D++ECA +   C    VC+N +GSF C                 QC  GY+ +     C D++EC        +   ++C    G + CE       +  + +C   DE  E       C  T + ++      YY  + E  C+     +   +EC C   +G+  N     C  +  D+   + P         N +            F  ++  D DEC     +IC    C NT G ++C CK+G+      + C D +EC +       E   ++   +C N  GSY+C 
Sbjct:  907 DGVGQCVNNMGSYYCNCPPGYRQV-NGTSCQDVDECVEEAHLQLHDGKCVNTEGSFLFI----CEPGYMLTQDPPGCEDVDECALNRSVCRGHGVCQNTVGSFMC-----------------QCDPGYQ-DSDGQGCVDLNEC--------DLLSDVC----GEAVCEN------VPGSFLCVCPDEGLEFNRMTAKCLPTPKASSVERKECYYNLNDENLCDNVLTSSVTIEECCCTLGAGWGDNCEVFPCPVQGTDQFAQMCPAGQGSVPTGNAV------------FGVSSAEDADECFLFGMEICKDGFCLNTDGGYECYCKAGFYYHETKLQCIDTDECAD-------ESNCVDG--QCLNNHGSYQCF 1218          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006555.1 (pep scaffold:Pmarinus_7.0:GL476370:200676:210822:-1 gene:ENSPMAG00000005922.1 transcript:ENSPMAT00000006555.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.976 bits (367), Expect = 8.359e-37
Identity = 119/358 (33.24%), Postives = 159/358 (44.41%), Query Frame = 3
Query:  387 GYQFVF---EEKKCKDINEC-SQKADICHINEYCRNLPGSYKC-IVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTG-KCEDVDECDSL-IPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            G +F++     +KC D+NEC +  +  C    YC N  GSY C  +  Y G G         C+D++EC      C +   C+N  GSF C                 QC  G++       C D++EC       C P    CV   G   C   C  G I    +C DVDEC    NNC+    C N  G +                  +C C +GF++   TG KC DV+EC +     CG    C N +G YNC C  GY      CLD+DEC+   + C  +  C+NTPG F+C C +G++ SN  VCEDINEC   P +C +  +       C N VGSY+C    C  GY
Sbjct:  695 GLKFIWISETGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGYIGNG-------TLCLDVDECLLPSNNCSANSTCKNTPGSFQC-----------------QCDAGFQKTG--EKCVDVNECHTSGSAACGP-GAYCVNTVGSYNCP--CLAGYIGNGTLCLDVDECLLPSNNCSANSTCKNTPGSF------------------QCQCDAGFQK---TGEKCVDVNECQTFGSAACGPGAYCVNTVGSYNCLCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQ-SNATVCEDINECGRVPAVCGLGTV-------CENTVGSYRC---PCAPGY 991          

HSP 2 Score: 144.436 bits (363), Expect = 2.629e-36
Identity = 125/382 (32.72%), Postives = 169/382 (44.24%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGY---EFNIETQTCIDLNECAQS-LKYCDSGMVCENVIGSFNCR--------------------PP--CPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTG-KCEDVDECD-SLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            C +GY  V + + C+D++EC      C     C NL G+Y CI    C  GY   EF ++ +TCID++EC ++    C  G  C N +GS+ CR                    P   C  N       G +QC+    +     +C D+DEC       C      CV   G   C   C  G I    +C DVDEC    NNC+    C N  G +                  +C C +GF++   TG KC DV+EC  S    CG    C N +G YNC C  GY      CLD+DEC+   + C  +  C+NTPG F+C C +G++ + E  C D+NEC +T G       +      C N VGSY CL   C +GY
Sbjct:   15 CVAGYAAVSDSRTCQDVDECQSGIYNCTQYSTCHNLDGNYTCI----CNSGYYLNEFPMQ-RTCIDVDECEKAGSALCGHGAYCANTLGSYACRCLVGYVGNGTVCLDVDECLLPSNNCSANSTCTNTPGSYQCQCDAGFQKTGEMCTDVDECLKFGSAACGQ-GAYCVNTVGSYNCP--CLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSF------------------QCQCDAGFQK---TGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEK-CVDVNEC-QTSG-----SAACGPGAYCVNTVGSYNCL---CLAGY 357          

HSP 3 Score: 127.872 bits (320), Expect = 6.172e-31
Identity = 117/379 (30.87%), Postives = 155/379 (40.90%), Query Frame = 3
Query:  396 FVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQ-SLKYCDSGMVCENVIGSFNC----------------------RPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTG-KCEDVDECD-SLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCVCKSGYK------MSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            +V     C D++EC   ++ C  N  C N PGSY+C     C  G++   E   C D++EC +     C  G  C N +GS+NC                         C  N       G  QC+    +      C D++EC       C P    CV   G   C   C  G I    +C DVDEC    NNC+    C N  G +                  +C C +GF++   TG KC DV+EC  S    CG    C N +G YNC C  GY      CLD+DEC+   + C  +  C+NTPG F+C C +G++            C D+NEC  T G       +      C N VGSY CL   C +GY
Sbjct:  108 YVGNGTVCLDVDECLLPSNNCSANSTCTNTPGSYQC----QCDAGFQKTGEM--CTDVDECLKFGSAACGQGAYCVNTVGSYNCPCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEKCVDVNECQTSGSAACGP-GAYCVNTVGSYNCP--CLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSF------------------QCQCDAGFQK---TGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCLCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQNVFPPPSETGEKCVDVNEC-HTSG-----SAACGPGAYCVNTVGSYNCL---CLAGY 447          

HSP 4 Score: 121.709 bits (304), Expect = 5.194e-29
Identity = 115/399 (28.82%), Postives = 162/399 (40.60%), Query Frame = 3
Query:  243 ILPNNECAKYTEWDPVLKKCQDCQFNKVYNETLRRCVDMDDT---------------------NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQS-LKYCDSGMVCENVIGSFNC----------------------RPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLY-----TG-KCEDVDECD-SLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCVCKSGYK 1283
            +LP+N C+  +         Q CQ +  + +T   C D+D+                      N  C +GY  +     C D++EC   ++ C  N  C+N PGS++C     C  G++   E   C+D+NEC  S    C  G  C N +GS+NC                         C  N       G  QC+    +      C D++EC       C P    CV   G   C   C  G I    +C DVDEC    NNC+    C N  G +                  +C C +GF +N++     TG KC DV+EC  S    CG    C N +G YNC C  GY      CLD+DEC+   + C  +  C+NTPG F+C C +G++
Sbjct:  122 LLPSNNCSANSTCTNTPGSYQ-CQCDAGFQKTGEMCTDVDECLKFGSAACGQGAYCVNTVGSYNCPCLAGY--IGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQC----QCDAGFQKTGEK--CVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEKCVDVNECQTSGSAACGP-GAYCVNTVGSYNC--LCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSF------------------QCQCDAGF-QNVFPPPSETGEKCVDVNECHTSGSAACGPGAYCVNTVGSYNCLCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQ 489          

HSP 5 Score: 120.553 bits (301), Expect = 1.248e-28
Identity = 104/326 (31.90%), Postives = 141/326 (43.25%), Query Frame = 3
Query:  474 CRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWN--PLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGK-CEDVDECDSL-IPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            C +  GS+KC     C  GY    +++TC D++EC   +  C     C N+ G++ C                  C  GY  N  P+   C D+DEC       C      C    G   C  +C  G +    +C DVDEC    NNC+    C N  G Y                  +C C +GF++   TG+ C DVDEC       CG    C N +G YNC C  GY      CLD+DEC+   + C  +  C+NTPG F+C C +G++ + E  C D+NEC +T G       +      C N VGSY C    C +GY
Sbjct:    4 CTDTIGSFKC----GCVAGYAAVSDSRTCQDVDECQSGIYNCTQYSTCHNLDGNYTCI-----------------CNSGYYLNEFPMQRTCIDVDECEKAGSALCG-HGAYCANTLGSYAC--RCLVGYVGNGTVCLDVDECLLPSNNCSANSTCTNTPGSY------------------QCQCDAGFQK---TGEMCTDVDECLKFGSAACGQGAYCVNTVGSYNCPCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEK-CVDVNEC-QTSG-----SAACGPGAYCVNTVGSYNC---PCLAGY 274          

HSP 6 Score: 108.227 bits (269), Expect = 1.267e-24
Identity = 119/441 (26.98%), Postives = 172/441 (39.00%), Query Frame = 3
Query:  243 ILPNNECAKYTEWDPVLKKCQDCQFNKVYNETLRRCVDMDDT---------------------NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQS-LKYCDSGMVCENVIGSFNC----------------------RPPCPTNKPHYWNSGCHQCK--EGYR--WNPLINI---CEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTC-------SEIKCEGYEELNNATKE----------CHCKSGFKRNLY----------------------TG-KCEDVDECDSL-IPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCVCKSGYKM 1286
            +LP+N C+  +         Q CQ +  + +T  +CVD+++                      N  C +GY  +     C D++EC   ++ C  N  C+N PGS++C     C  G++   E   C+D+NEC  S    C  G  C N +GS+NC                         C  N       G  QC+   G++  + P       C D++EC       C P    CV   G   C   C  G I    +C DVDEC    NNC+    C N  G + C       S+    G  + N  +             +C+S     LY                      TG KC DV+EC +     CG    C N +G YNC C  GY      CLD+DEC+   + C  +  C+NTPG F+C C +G+++
Sbjct:  205 LLPSNNCSANSTCKNTPGSFQ-CQCDAGFQKTGEKCVDVNECQTSGSAACGPGAYCVNTVGSYNCPCLAGY--IGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQC----QCDAGFQKTGEK--CVDVNECQTSGSAACGPGAYCVNTVGSYNCLCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQNVFPPPSETGEKCVDVNECHTSGSAACGP-GAYCVNTVGSYNC--LCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQSDFHGFGMRQCNLGSSYKLSIHKISLVMNCQSILGMMLYKLSKCCVLGSSAYSNVFPPPSETGEKCVDVNECQTFGSAACGPGAYCVNTVGSYNCLCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQI 633          

HSP 7 Score: 99.3673 bits (246), Expect = 6.628e-22
Identity = 85/287 (29.62%), Postives = 115/287 (40.07%), Query Frame = 3
Query:  369 NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQS-LKYCDSGMVCENVIGSFNC----------------------RPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGY 1160
            N  C +GY  +     C D++EC   ++ C  N  C+N PGS++C     C  G++   E   C+D+NEC  S    C  G  C N +GS+NC                         C  N       G  QC+    +      C D++EC       C P    CV   G   C   C  G I    +C DVDEC    NNC+    C N  G +                  +C C +GF+ N     CED++EC  +  VCG    C+N +G Y C C PGY
Sbjct:  736 NCPCLAGY--IGNGTLCLDVDECLLPSNNCSANSTCKNTPGSFQC----QCDAGFQKTGEK--CVDVNECHTSGSAACGPGAYCVNTVGSYNCPCLAGYIGNGTLCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQKTGEKCVDVNECQTFGSAACGP-GAYCVNTVGSYNC--LCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSF------------------QCQCDAGFQSNATV--CEDINECGRVPAVCGLGTVCENTVGSYRCPCAPGY 991          

HSP 8 Score: 69.707 bits (169), Expect = 1.247e-12
Identity = 56/154 (36.36%), Postives = 73/154 (47.40%), Query Frame = 3
Query: 1008 ECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGY---EFK-NATCLDIDEC-VSLKDICGHLK-CENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSE 1451
            +C C +G+     +  C+DVDEC S I  C     C N  G Y C CN GY   EF    TC+D+DEC  +   +CGH   C NT G + C C  GY + N  VC D++EC      C            C N  GSY+C    C +G++   E
Sbjct:   12 KCGCVAGYAAVSDSRTCQDVDECQSGIYNCTQYSTCHNLDGNYTCICNSGYYLNEFPMQRTCIDVDECEKAGSALCGHGAYCANTLGSYACRCLVGY-VGNGTVCLDVDECLLPSNNCSANS-------TCTNTPGSYQCQ---CDAGFQKTGE 154          

HSP 9 Score: 67.3958 bits (163), Expect = 6.662e-12
Identity = 74/276 (26.81%), Postives = 110/276 (39.86%), Query Frame = 3
Query:  378 CESGYQFVF-----EEKKCKDINEC-SQKADICHINEYCRNLPGSYKCI-VKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTN-KPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPV--CGNKGRCKNEIGRYNCQCNPGYEFKNA 1175
            C++G+Q VF       +KC D+NEC +  +  C    YC N  GSY C+ +  Y G G         C+D++EC      C +   C+N  GSF C+  C    +  +   G  QC  G  +   I+    +  C     +      + CV              G+   +N+     E  E    C D   C   FG   C       Y      +  C C +G+  N     C DVDEC  L+P   C     CKN  G + CQC+ G++ +++
Sbjct:  394 CDAGFQNVFPPPSETGEKCVDVNECHTSGSAACGPGAYCVNTVGSYNCLCLAGYIGNG-------TVCLDVDECLLPSNNCSANSTCKNTPGSFQCQ--CDAGFQSDFHGFGMRQCNLGSSYKLSIHKISLVMNCQSILGMMLYKLSKCCVL-------------GSSAYSNVFPPPSETGEK---CVDVNECQT-FGSAACGP---GAYCVNTVGSYNCLCLAGYIGNGTV--CLDVDEC--LLPSNNCSANSTCKNTPGSFQCQCDAGFQIQSS 636          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010139.1 (pep scaffold:Pmarinus_7.0:GL476784:79088:131893:1 gene:ENSPMAG00000009155.1 transcript:ENSPMAT00000010139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.568 bits (327), Expect = 1.202e-31
Identity = 134/404 (33.17%), Postives = 174/404 (43.07%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNA--TCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMS-NENVCEDINECTET---PG----------ICRIE-RLSLN--------------------NRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQ 1475
            TC  GYQ+  +  +C DI+ECS    +C  N  C N+ GS++CI    C  G+ F+     C D+NEC + +  C  G  C N+ GS+ C                  C  G+  N     CED++EC  P    C   K  CV  PG   C  +C  G       C DVDECA+   N      C N  G Y+C+                  C +GF+       CED+DEC + I VCG  G C N  G + C+C PGY   +    C DI+EC+S      H  C NT G F CVC  GYK S N   C+D++EC+E    PG           C  E  L LN                        C N  GSY+C+++ C  GYR+    SST  CQ
Sbjct:  729 TCHFGYQYNEQLGRCDDIDECSTVPRLC-ANGRCENVIGSFRCI----CRPGFIFDDSGAECQDINECLK-VNKCIGGR-CINLPGSYRCE----------------FCDAGHVMN-TRGQCEDVNECRNPN--TCPTAK--CVNTPGSYEC-VRCPSGFEGRNGHCIDVDECADG--NVCSNGICANTEGSYSCTP-----------------CGTGFRLTSNGKACEDIDECQNGI-VCGG-GDCVNTRGSFQCECQPGYHLSSGGDQCEDINECLSESVCEPHGDCLNTDGSFYCVCHHGYKSSANGRFCKDVDECSEGQQCPGGQCVNTEGSFTCECEPGLRLNPGTHTCVDIDECAEFDSSRCGSWRCENTHGSYRCVQA-CDRGYRL----SSTAECQ 1077          

HSP 2 Score: 113.235 bits (282), Expect = 3.739e-26
Identity = 131/453 (28.92%), Postives = 179/453 (39.51%), Query Frame = 3
Query:  309 CQFNKVYNETLRRCVDMDDTNVT-------------------CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQ---------------------------------------TCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECA-----ENKNNCTDTQR---CNNYFGYYT------------CSE-IKCEGYEELNN-ATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNC--QCNPGYEFKN-ATCLDIDECVSLKDICGHLK-CENTPGFFKCVCKSGYK-MSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCL 1412
            C F   YNE L RC D+D+ +                     C  G+ F     +C+DINEC  K + C I   C NLPGSY+C   ++C  G+  N   Q                                        CID++ECA     C +G +C N  GS++C P                C  G+R       CEDIDEC     + C      CV   G   CE Q         + C D++EC      E   +C +T     C  + GY +            CSE  +C G + +N   +  C C+ G + N  T  C D+DEC           RC+N  G Y C   C+ GY   + A C DIDEC+    +CG    CENT G F+C+C  GY  + +   C D+NEC     +C  + L       C N+ GS+ C+
Sbjct:  730 CHFGYQYNEQLGRCDDIDECSTVPRLCANGRCENVIGSFRCICRPGFIFDDSGAECQDINEC-LKVNKC-IGGRCINLPGSYRC---EFCDAGHVMNTRGQCEDVNECRNPNTCPTAKCVNTPGSYECVRCPSGFEGRNGHCIDVDECADG-NVCSNG-ICANTEGSYSCTP----------------CGTGFRLTSNGKACEDIDECQN--GIVCGGGD--CVNTRGSFQCECQPGYHLSSGGDQCEDINECLSESVCEPHGDCLNTDGSFYCVCHHGYKSSANGRFCKDVDECSEGQQCPGGQCVNTEGSFTCECEPGLRLNPGTHTCVDIDECAEFDSSRCGSWRCENTHGSYRCVQACDRGYRLSSTAECQDIDECLD-DTVCGRNGFCENTEGSFRCLCDQGYHDLQDGQECIDVNECEMFSSVCGDDAL-------CENVEGSFLCI 1147          

HSP 3 Score: 80.8777 bits (198), Expect = 4.787e-16
Identity = 83/298 (27.85%), Postives = 122/298 (40.94%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTC-----------SEIKCE--------------GYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQC---NPGYEFKNATCLD 1187
            C +G++     K C+DI+EC Q   +C   + C N  GS++C     C  GY  +     C D+NEC  S   C+    C N  GSF C                  C  GY+ +     C+D+DEC+     QC   +  CV   G  TCE +         + C D+DECAE  ++   + RC N  G Y C           S  +C+              G+ E    +  C C  G+       +C DV+EC+    VCG+   C+N  G + C C   N  ++  +  C+D
Sbjct:  895 CGTGFRLTSNGKACEDIDEC-QNGIVCGGGD-CVNTRGSFQC----ECQPGYHLSSGGDQCEDINECL-SESVCEPHGDCLNTDGSFYC-----------------VCHHGYKSSANGRFCKDVDECS--EGQQCPGGQ--CVNTEGSFTCECEPGLRLNPGTHTCVDIDECAEFDSSRCGSWRCENTHGSYRCVQACDRGYRLSSTAECQDIDECLDDTVCGRNGFCENTEGSFRCLCDQGYHDLQDGQECIDVNECEMFSSVCGDDALCENVEGSFLCICQQHNKEFDTMSGKCVD 1164          

HSP 4 Score: 70.0922 bits (170), Expect = 1.081e-12
Identity = 91/355 (25.63%), Postives = 132/355 (37.18%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTG--------KCEDVDECDSLIPVCGNKGRCKNEIGR--------YNCQCNPGYEFKN--------------------ATCLDIDECVSL-KDICGHLKCENTPGFFKCVCKSGYKMSNENV-CEDINECTE 1328
            C  GY+     + CKD++ECS+          C N  GS+ C     C  G   N  T TC+D++ECA+          CEN  GS+ C                  C  GYR +     C+DIDEC          F   C    G   C        ++    C DV+EC    + C D   C N  G + C  I  +  +E +  + +C  +     +   G           D + CD+++ V   +  C   +G         Y C      EFKN                        D DEC+   ++IC    C NT   +KC CKSG+    + + C D++ECT+
Sbjct:  978 CHHGYKSSANGRFCKDVDECSEGQQC--PGGQCVNTEGSFTC----ECEPGLRLNPGTHTCVDIDECAEFDSSRCGSWRCENTHGSYRC---------------VQACDRGYRLSSTAE-CQDIDECLDDTVCGRNGF---CENTEGSFRCLCDQGYHDLQDGQECIDVNECEMFSSVCGDDALCENVEGSFLC--ICQQHNKEFDTMSGKCVDRHSIVDSRAPGVETKECYVNLNDANFCDNVLAVNLTRHECCCTLGAGWGDNCEIYPCPVLGSVEFKNLCPHGKGFIPNEDIVYDTIPQDFKDADECILFGQEICKRGTCHNTEHGYKCFCKSGFYYDRQKLECLDVDECTD 1305          

HSP 5 Score: 63.929 bits (154), Expect = 1.008e-10
Identity = 42/120 (35.00%), Postives = 63/120 (52.50%), Query Frame = 3
Query: 1092 VCGNKGRCKNEIGRYNCQCNPGYEFKN--ATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENV-CEDINECTETPGICRIERLSLNNRV--ECFNLVGSYKCLESICPSGY 1436
            +CG  G+C N    Y C C+ GY++      C DIDEC ++  +C + +CEN  G F+C+C+ G+   +    C+DINEC           L +N  +   C NL GSY+C    C +G+
Sbjct:  713 ICG-PGQCYNLDVGYTCTCHFGYQYNEQLGRCDDIDECSTVPRLCANGRCENVIGSFRCICRPGFIFDDSGAECQDINEC-----------LKVNKCIGGRCINLPGSYRC--EFCDAGH 818          

HSP 6 Score: 47.7506 bits (112), Expect = 7.466e-6
Identity = 67/270 (24.81%), Postives = 101/270 (37.41%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQS------LKYC----DSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYD-VDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNP 1154
            C+ GY  + + ++C D+NEC   + +C  +  C N+ GS+ CI + +     EF+  +  C+D +    S       K C    +    C+NV+     R  C       W   C    E Y   P++   E               FK +C    G            I   +I YD + +  ++ + C         FG   C    C   E       +C CKSGF  +    +C DVDEC       G  G C N  G ++C C P
Sbjct: 1105 CDQGYHDLQDGQECIDVNECEMFSSVCGDDALCENVEGSFLCICQQH---NKEFDTMSGKCVDRHSIVDSRAPGVETKECYVNLNDANFCDNVLAVNLTRHECCCTLGAGWGDNC----EIYPC-PVLGSVE---------------FKNLCPHGKGF-----------IPNEDIVYDTIPQDFKDADECI-------LFGQEICKRGTCHNTEH----GYKCFCKSGFYYDRQKLECLDVDECTDEWSCEG--GSCVNTDGSFDCFCRP 1327          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008854.1 (pep scaffold:Pmarinus_7.0:GL476328:1008604:1022137:1 gene:ENSPMAG00000008009.1 transcript:ENSPMAT00000008854.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.413 bits (324), Expect = 1.399e-31
Identity = 122/381 (32.02%), Postives = 161/381 (42.26%), Query Frame = 3
Query:  348 CVDMDDTNVTCESGYQFVFEEKKCKDINECSQKAD-ICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNC--------------------RPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSL-IPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNEN--VCEDINECTETPGICRIERLSLNN---RVECFNLVGSYKC 1409
            C D+  +  TC+    +      C DINEC+  A  +C I   C NLPGSY+C    +C  GY       TC D+NEC      C S  +C+N  G + C                      PC         +G  QC     +    NICE +++CT P +  C     +C+   G S    QC  G      +C DVDEC   K  C     C N FG YTC      GY  LNN                   C D++EC S+ +  C    +C N IG Y+CQC PGY+     C D+DEC+     C HL C N  G ++C C+ GY  +  N  +C DI+EC         +  +LNN      C N  GS+KC
Sbjct:  226 CTDLIGS-FTCQCQPGYSSNGTMCLDINECANTASPMCPIGT-CENLPGSYRC----HCPSGYT--AANNTCRDVNECLIIPSPCGSNSICQNTPGFYTCLCSSGFTSVSGVCQDINECLANPCAAPASCINTAGGFQCNCPLDYQLNGNICEAVNQCTVPGQKLCSE-NAVCISTLGTSAYTCQCKAGYTGNGTVCTDVDECV--KKPCPVNTVCLNTFGSYTCQCAA--GYIYLNNT------------------CTDLNECSSVNLFSCPPNSKCVNAIGSYSCQCVPGYQDVKGACQDVDECLRDNGGCQHL-CFNNVGSYRCGCRPGYLSAGLNGYMCIDIDEC---------QNPTLNNCNQNAVCTNTRGSFKC 565          

HSP 2 Score: 115.161 bits (287), Expect = 4.644e-27
Identity = 118/402 (29.35%), Postives = 169/402 (42.04%), Query Frame = 3
Query:  255 NECAKYTEWDPVLKKCQDCQFNKVYNETLRRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIV-KDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLIN-ICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIAN-ICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECV-SLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLS 1448
            NEC + T+ +P+   C D  +N + N               C+ G+       +C+D+NEC      C  + +C N  GS+ C     + G GY        C D+NEC  +   C    +C N  G ++C                  C  GY  +P+ +  C DI+EC     +      + C    G   C    SG T+      C D++EC  N   C  +  C+N  G Y C+ ++  GY +LN+A                  CE+++EC  L   CG    C + IG + CQC PGY      CLDI+EC  +   +C    CEN PG ++C C SGY  +N N C D+NEC   P  C    +       C N  G Y CL   C SG+  +S
Sbjct:    1 NECLEKTDCNPLTSTCVDIVYNTLNNSGFY---------CQCKPGFAKNPTTGECEDVNECLLPQQ-CQTSAHCVNTFGSFTCACNAGFTGNGYN-------CQDINECLTNNGNCSD--ICVNEQGGYHCA-----------------CPVGYTLDPINHAACFDINEC----MVNKGNCSQNCQNTEGSFACTCW-SGYTMNTTTKTCVDINECLNNP--CGSSGSCSNIDGSYICNCLR--GY-QLNSAR----------------ICENINEC--LTSACGPNAICTDLIGSFTCQCQPGYSSNGTMCLDINECANTASPMCPIGTCENLPGSYRCHCPSGYTAAN-NTCRDVNECLIIPSPCGSNSI-------CQNTPGFYTCL---CSSGFTSVS 327          

HSP 3 Score: 112.849 bits (281), Expect = 2.714e-26
Identity = 124/402 (30.85%), Postives = 164/402 (40.80%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCR-----------------------PPCPT----NKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEP--FKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTC--------SEIKCEGYEE------------------LNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDEC--VSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC 1409
            TC SGY      K C DINEC      C  +  C N+ GSY C     C +GY+ N   + C ++NEC  S   C    +C ++IGSF C+                       P CP     N P  +   CH C  GY      N C D++EC     +   P     IC   PG  TC   CS G   ++ +C D++EC  N   C     C N  G + C        +   CE   +                  L  +   C CK+G+  N     C DVDEC  +   C     C N  G Y CQC  GY + N TC D++EC  V+L     + KC N  G + C C  GY+   +  C+D++EC    G C+           CFN VGSY+C
Sbjct:  155 TCWSGYTMNTTTKTCVDINECLNNP--CGSSGSCSNIDGSYIC----NCLRGYQLN-SARICENINECLTSA--CGPNAICTDLIGSFTCQCQPGYSSNGTMCLDINECANTASPMCPIGTCENLPGSYR--CH-CPSGYTA--ANNTCRDVNEC----LIIPSPCGSNSICQNTPGFYTC--LCSSGFTSVSGVCQDINECLANP--CAAPASCINTAGGFQCNCPLDYQLNGNICEAVNQCTVPGQKLCSENAVCISTLGTSAYTCQCKAGYTGNGTV--CTDVDEC--VKKPCPVNTVCLNTFGSYTCQCAAGYIYLNNTCTDLNECSSVNLFSCPPNSKCVNAIGSYSCQCVPGYQ-DVKGACQDVDECLRDNGGCQH---------LCFNNVGSYRC 520          

HSP 4 Score: 87.8113 bits (216), Expect = 2.373e-18
Identity = 107/405 (26.42%), Postives = 148/405 (36.54%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPP-----------------CPTNKPHYWNSGCH----------QCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAE-NKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKE-----------------------CHCKSGFKRNLYTG-KCEDVDEC-DSLIPVCGNKGRCKNEIGRYNCQCNP-----------------------------------------GYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCED 1310
            C SGY        C+D+NEC      C  N  C+N PG Y C+    C  G  F   +  C D+NEC  +   C +   C N  G F C  P                  P  K    N+ C           QCK GY  N  +  C D+DEC    +  C P   +C+   G  TC  QC+ G I + N C D++EC+  N  +C    +C N  G Y+C  +   GY+++  A ++                       C C+ G+      G  C D+DEC +  +  C     C N  G + C C P                                         G+      C D++EC++         C +  G FKC+C  GY  SN NVC D
Sbjct:  278 CPSGY--TAANNTCRDVNECLIIPSPCGSNSICQNTPGFYTCL----CSSG--FTSVSGVCQDINECLANP--CAAPASCINTAGGFQCNCPLDYQLNGNICEAVNQCTVPGQKLCSENAVCISTLGTSAYTCQCKAGYTGNGTV--CTDVDECV---KKPC-PVNTVCLNTFGSYTC--QCAAGYIYLNNTCTDLNECSSVNLFSCPPNSKCVNAIGSYSCQCVP--GYQDVKGACQDVDECLRDNGGCQHLCFNNVGSYRCGCRPGYLSAGLNGYMCIDIDECQNPTLNNCNQNAVCTNTRGSFKCACKPYFKGDGITCDIGRCGYPINSCDPNAICDISNPQSPRCVCPSGWVGTGKKCYDVNECLNPCTCPASTTCMDLDGGFKCICPPGYIFSN-NVCVD 661          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000017.1 (pep scaffold:Pmarinus_7.0:GL477746:39241:65692:1 gene:ENSPMAG00000000015.1 transcript:ENSPMAT00000000017.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.946 bits (315), Expect = 3.078e-30
Identity = 126/424 (29.72%), Postives = 165/424 (38.92%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYE--FNIETQ-----------------------TCIDLNECAQS-LKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAE-NKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYE-----------------------------------------FKNAT-CLDIDECVSLKDIC-GHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            C +GY  V + + C+D++EC      C     CRNL G+Y CI    C  GYE   +I TQ                       TCID++EC ++    C  G  C N +GS+ CR                 C  GY  N  +  C D+DEC  P    C      C   PG   C  QC  G  K   +C DVDEC +     C     C N  G Y C                   C +G+  N     C DVDEC      C     CKN  G + CQC+ G++                                           N T CLD+DEC+   + C  +  C+NTPG F+C C +G++ SN  VCEDI+EC   P +C +  +       C N VGSY+C    C  GY+
Sbjct:  445 CVAGYAVVSDSRTCQDVDECQSGIYNCTQYSTCRNLEGNYTCI----CNSGYESAHSIPTQGVYSFEFKHSNLSPPPQPPESGETCIDVDECQKAGSALCGHGAYCANTLGSYACR-----------------CLVGYVGNGTV--CLDVDECLLPSN-NCSA-NSTCTNTPGFYQC--QCDAGFQKTGEMCTDVDECLKFGSAVCGQGAYCVNMVGSYNCP------------------CLAGYIGNGTV--CLDVDECQLPSNNCSANSTCKNTPGSFQCQCDAGFQKTAEICVDVNECQTSGSAACGPGAYCVNTVGSYNCQCLAGYIGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQCQCDAGFQ-SNATVCEDIDECGRVPTVCGLGTV-------CENTVGSYRC---PCAPGYQ 810          

HSP 2 Score: 117.472 bits (293), Expect = 1.225e-27
Identity = 126/437 (28.83%), Postives = 182/437 (41.65%), Query Frame = 3
Query:  246 LPNNECAKYTEWDPVLKKCQDCQFNKVYNETLRRCVDMDDT---------------------NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNN------------CTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPV--CGNKGRCKNEIGRYNCQCNPGYE--FKNAT-CLDIDECVSLKDIC-GHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            LP+N C+  +         Q CQ +  + +T   CVD+++                      N  C +GY  +     C D++EC   ++ C  N  C+N PGS++C     C  G++ N     C D++EC +    C  G VCEN +GS+ C  PC    P Y  +  H   E        N+         PY      F           T         ++  N+C +  E A + +N            CTD   C   FG   C +     Y      +  C C +G+  N     C DVDEC  L+P   C     C N  G Y CQC+ G++    N T CLD+DEC+   + C  +  C+N PG F+C C +G++ SN  VCEDI+EC   P +C +  +       C N VGSY+C    C  GY+
Sbjct:  659 LPSNNCSANSTCKNTPGSFQ-CQCDAGFQKTAEICVDVNECQTSGSAACGPGAYCVNTVGSYNCQCLAGY--IGNGTVCLDVDECLLPSNNCSANSTCKNTPGSFQC----QCDAGFQSN--ATVCEDIDECGRVPTVCGLGTVCENTVGSYRC--PC---APGYQRNTNHTILETSFLYTFTNV---------PYHRASVIFGRPMTEAFECCTLIHYVEYNKVERCNVCSNTAENAFSYSNLPPSHPPETGEMCTDVDECLK-FGSAACGQ---GAYCVNTVGSYNCPCLAGYIGNGTV--CLDVDEC--LLPSNNCSANSTCTNTPGSYQCQCDAGFQRYIGNGTVCLDVDECLLPSNNCSANSTCKNMPGSFQCQCDAGFQ-SNATVCEDIDECGRVPTVCGLGTV-------CENTVGSYRC---PCAPGYQ 1053          

HSP 3 Score: 95.1301 bits (235), Expect = 1.550e-20
Identity = 100/321 (31.15%), Postives = 130/321 (40.50%), Query Frame = 3
Query:  426 INECSQKADICHINEYCRNLPGSYKCIV-KDYCGQGYEFNIETQTCIDLNECAQSLKYCDS--GMVCENVIGSFNC----------------------RPPCP-----TNKPHYWNSGCHQCKEGYRWNPLINICEDIDEC-TGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNAT--CLDIDEC-VSLKDICGHLK--CENTPGFFKCVCKSGY 1280
            I+EC+  + +C  N +C N PG Y C     + G G+  + +  TC+  +EC+     C S     C N IGS++C                      +  CP     TN    +   C    EG  WN     C+DIDEC TG +   C      C+   G   C   C+ G       C D++EC  N   C DT+ C N  G Y                  +C C  G+ RN     C DVDEC    P   N   C N IG Y C C  GY+F +    C D DEC VS  + C      C+N  G F C CK+GY
Sbjct:    1 IDECALNSSLCVKNAHCVNTPGHYDCSCNAGFRGNGF-IDCQESTCLHEDECSVKNNPCLSVNNSFCNNSIGSYSCICTSGYNGTTCEVTDINECISGQNNCPVNANCTNTIGSYTCACKLGYEGNGWN-----CKDIDECMTGNH---CNSNGSECMNTDGSYYC--TCALGFTGNGTYCADINECTANPYLCQDTEECMNGIGSY------------------KCECLPGYIRNGTI--CTDVDECKKSQPCDANTMVCSNTIGSYTCLCKAGYQFDSTARICTDTDECVVSSLNNCSRTTGLCQNFDGSFTCQCKAGY 290          

HSP 4 Score: 87.4261 bits (215), Expect = 3.651e-18
Identity = 122/442 (27.60%), Postives = 169/442 (38.24%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEY-CRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECA-QSLKYCD-SGMVCENVIGSFNCRPPCP--------TNKPHYWNSGCHQCKEGYRWNPL----INICE------------DIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATK----------------------------ECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGY--------------EFKNA-------------TCLDIDECVSLKD-ICGHLK-CENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSE 1451
            CE    ++     C D++EC +K+  C  N   C N  GSY C+ K     GY+F+   + C D +EC   SL  C  +  +C+N  GSF C+            T K  +   G  QC+       L    + +C+            D+DEC  P     +P K       G    +  C         +C DVDEC    +NCT  Q C N  G +TCS      +  +N   K                            +C C +G+     +  C+DVDEC S I  C     C+N  G Y C CN GY              EFK++             TC+D+DEC      +CGH   C NT G + C C  GY + N  VC D++EC      C            C N  G Y+C    C +G++   E
Sbjct:  198 CECLPGYIRNGTICTDVDEC-KKSQPCDANTMVCSNTIGSYTCLCK----AGYQFDSTARICTDTDECVVSSLNNCSRTTGLCQNFDGSFTCQCKAGYTGDGVTCTGKLCFHVVGVPQCRGAVILCNLAVGVVLLCDFTPIKLYKKKVFDVDECNPPENAT-QPCKGPVGDLYGRD--DAHC---------VCPDVDECIRGLHNCT--QNCTNIEGGFTCSCFA--RFSSVNGTCKRKFHLSTSFVHVAYVYTLWPSTDTIGSFKCGCVAGYAVVSDSRTCQDVDECQSGIYNCTQYSTCRNLEGNYTCICNSGYESAHSIPTQGVYSFEFKHSNLSPPPQPPESGETCIDVDECQKAGSALCGHGAYCANTLGSYACRCLVGY-VGNGTVCLDVDECLLPSNNCSANST-------CTNTPGFYQCQ---CDAGFQKTGE 607          

HSP 5 Score: 82.8037 bits (203), Expect = 1.209e-16
Identity = 88/271 (32.47%), Postives = 109/271 (40.22%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTG-PYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDEC--DSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATC 1181
            C SGY     E    DINEC    + C +N  C N  GSY C  K     GYE N     C D++EC        +G  C N  GS+ C                  C  G+  N     C DI+ECT  PY  Q     E C+   G   CE  C  G I+   IC DVDEC +++    +T  C+N  G YT                  C CK+G++ +     C D DEC   SL       G C+N  G + CQC  GY     TC
Sbjct:   77 CTSGYNGTTCEVT--DINECISGQNNCPVNANCTNTIGSYTCACK----LGYEGN--GWNCKDIDECMTGNHCNSNGSECMNTDGSYYCT-----------------CALGFTGNGT--YCADINECTANPYLCQ---DTEECMNGIGSYKCE--CLPGYIRNGTICTDVDECKKSQPCDANTMVCSNTIGSYT------------------CLCKAGYQFDSTARICTDTDECVVSSLNNCSRTTGLCQNFDGSFTCQCKAGYTGDGVTC 297          

HSP 6 Score: 80.8777 bits (198), Expect = 4.261e-16
Identity = 114/404 (28.22%), Postives = 155/404 (38.37%), Query Frame = 3
Query:  294 KKCQDCQFNKVYNETLRRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSG-MVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQC---SGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEI--------KCEGYEELN---NATKECHCKSG--FKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLD----IDECVSLKDICGHLKCENTPGFFKCVCKSGYK-MSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            K   +C      N     C++ D +   C     F      C DINEC+    +C   E C N  GSYKC     C  GY  N     C D++EC +S + CD+  MVC N IGS+ C                  CK GY+++    IC D DEC       C     +C    G  TC+ +      G      +C+ V    + +        CN   G     +         K    +E N   NAT+ C    G  + R+     C DVDEC   +  C     C N  G + C C   +   N TC          V +  +       +T G FKC C +GY  +S+   C+D++EC    GI    + S      C NL G+Y C   IC SGY 
Sbjct:  130 KDIDECMTGNHCNSNGSECMNTDGS-YYCTCALGFTGNGTYCADINECTANPYLCQDTEECMNGIGSYKC----ECLPGYIRN--GTICTDVDECKKS-QPCDANTMVCSNTIGSYTCL-----------------CKAGYQFDSTARICTDTDECVVSSLNNCSRTTGLCQNFDGSFTCQCKAGYTGDGVTCTGKLCFHVVGVPQCRG---AVILCNLAVGVVLLCDFTPIKLYKKKVFDVDECNPPENATQPCKGPVGDLYGRDDAHCVCPDVDECIRGLHNC--TQNCTNIEGGFTCSCFARFSSVNGTCKRKFHLSTSFVHVAYVYTLWPSTDTIGSFKCGCVAGYAVVSDSRTCQDVDECQS--GIYNCTQYST-----CRNLEGNYTC---ICNSGYE 493          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000328.1 (pep scaffold:Pmarinus_7.0:GL477118:5217:33136:-1 gene:ENSPMAG00000000285.1 transcript:ENSPMAT00000000328.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.176 bits (313), Expect = 4.369e-30
Identity = 144/554 (25.99%), Postives = 210/554 (37.91%), Query Frame = 3
Query:  345 RCVDMD-DTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFN-----------------IETQTC----------------IDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDEC-TGPYRLQCEPFKEICVRKPGLSTCETQCSGGTI--KIANICYDVDECAENKNN-CTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGY---EFKNATCLDIDECVSLKDICGHL---KCENTPGFFKCVCKS-GYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEI-PIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSA-EIVLDINLKLSFQSTEQIYSLNELHIFVND 1862
            +CV+        C  GY+   +   C+D+NEC      C   + C N  GS++C  +  CG GYE                     TQ C                 D+NEC   L  C  G  C N +GSF C+                 C  GY  +P    C D+DEC TG +  QC   ++ C   PG   C   C+ G     +   C D++EC +     C+ T  C N  G Y CS                  C  GF+       CED +EC+S    C  +  C N IG Y C C  G+   E    TC D+DEC SL    G L   +C N PG F+C C + GY MS N   C D          C       ++   CFN+ G ++CL   CPS YR  +E+   +        C+ +         P  + Y  +    +  LP  I  I P      D   + +         + ++M+    ++              M   PDS  +++L++ ++L  Q T   + L +++ F+  
Sbjct:  588 KCVEASTGAQCACHIGYRLRSDAVSCEDVNECLTDEHHCQEGQRCINTAGSFRCQREISCGTGYELTELNHCQGGHSLIKNKNIFFTQFCKRRAKGGSLQPPEGSGADINECTTQLDICQLGYNCINTVGSFTCQ------------RNIINCGRGYHASPDGGRCVDVDECQTGAH--QCGDGQQ-CQNTPGSYRCN--CASGYYYDTLGRTCVDINECRQYPGRLCSHT--CENVPGSYHCS------------------CSRGFQLGTDGKTCEDTNECESS--PCSQE--CANVIGSYQCYCRRGFQPSEVDGVTCEDVDEC-SLPGSNGGLCAYRCANVPGSFECYCPAYGYTMSPNGRSCLDCGPRGTGTHNC-------SSSENCFNMQGGFRCLSYHCPSNYRRSAENRCERMSCADPQDCASS---------PVRITYYQLSFPRTVPLPANIFRIGPSPAYAGDTITLGLTAGNHEGLFATRKMNAYTGVVY-------------MQRAPDSPRDLLLNVEMRLFRQGTFTTF-LAKIYAFITS 1069          

HSP 2 Score: 102.449 bits (254), Expect = 8.807e-23
Identity = 87/319 (27.27%), Postives = 129/319 (40.44%), Query Frame = 3
Query:  492 SYKCIVKDYCGQ-----GYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEP---FKEICVRKPGLSTCETQCSGGTIKIA-NICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECVSLKD-ICGHLKCENTPGFFKCVCKSGYKMSNEN-VCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC 1409
            ++KC+      Q     GY    +  +C D+NEC     +C  G  C N  GSF C+                 C  GY          +++ C G + L       F + C R+           GG+++       D++EC    + C     C N  G +TC                  +C  G+  +   G+C DVDEC +    CG+  +C+N  G Y C C  GY +     TC+DI+EC      +C H  CEN PG + C C  G+++  +   CED NEC  +P              EC N++GSY+C
Sbjct:  586 AHKCVEASTGAQCACHIGYRLRSDAVSCEDVNECLTDEHHCQEGQRCINTAGSFRCQREI-------------SCGTGYELT-------ELNHCQGGHSLIKNKNIFFTQFCKRR---------AKGGSLQPPEGSGADINECTTQLDICQLGYNCINTVGSFTCQR-------------NIINCGRGYHASPDGGRCVDVDECQTGAHQCGDGQQCQNTPGSYRCNCASGYYYDTLGRTCVDINECRQYPGRLCSH-TCENVPGSYHCSCSRGFQLGTDGKTCEDTNECESSP-----------CSQECANVIGSYQC 850          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Nematostella
Match: EDO44417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVN4])

HSP 1 Score: 145.591 bits (366), Expect = 3.252e-37
Identity = 157/563 (27.89%), Postives = 216/563 (38.37%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWN---------------SGCH-------------QCKEGYRWNPLINICEDIDECT-GPYRLQCEPFKEICVRKPGLSTCET---QCSGGTIKIANICY-DVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNN----------------------ATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDEC-------VSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSE----TLPYKI-TEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVN 1859
            C+ GY+   E  KC D++EC+     C     CRNLPG+Y C   + C  G E       C+D++ECA     C     C N  GS+ C  PCP  +    N               SG                C  G    P    C DIDECT G Y    +   + C    G   C+    +CS G       C  D+DECA     C   Q C N  G Y C   +  GY   N                        +  C C+ GFK       C D+DEC    P C ++  C+N  G Y C C  GY       +C DIDEC       V L   C   +C N+PG ++C C +GYK+S    C DI+ECTETP IC            C N  G Y+C+  +CP  Y    +      C+L   TCS      C  I  + L +    +R  E       Y + T    E +   +     N K  F  +   Q  +     +  TE+ + ++ F         E+++   L+  ++ST        L++FV+
Sbjct:   38 CKRGYKA--EGPKCVDVDECATGIAFCPPGNVCRNLPGTYICSSPNTCPAGKE--KRGSDCVDIDECATGQARCPPTTRCVNADGSYRC-VPCPAGRKLENNQCVDIDECVNGNICGSGSRCVNTEGSYKCVQMSCGPGKTLQPGTG-CVDIDECTEGSYPCAAD---QTCQNVFGSYRCQASAIKCSRGYEPQNGRCVVDIDECASGIARCGREQFCENVEGAYRCVTCR-TGYRFTNGRCVDRDECRIGVVCAHECTNTPGSFICSCRRGFKLEPDKRSCRDIDECSLPNPPCQHE--CRNRYGSYQCYCKDGYTLAADKRSCDDIDECRGQQYSSVGLYSPC-QYQCLNSPGSYRCTCPAGYKLSGGRNCYDIDECTETPNIC------TRPDTVCRNAFGYYRCIPFVCPPKY---YKKEGDNGCKL-IDTCSEIPD--CASIREKGLRFYTFSLRKGEESKKLFDYSLWTRGYQETVTIQYRFASGNEKGHFEIRRLNQNQVEIWTRITMTEEAEYVLQFY-------GEVIVGGKLESRYRST--------LYVFVS 560          

HSP 2 Score: 140.198 bits (352), Expect = 2.393e-35
Identity = 128/384 (33.33%), Postives = 171/384 (44.53%), Query Frame = 3
Query:  417 CKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPP--CPTNKPHYWNSGC---HQCKEGYRWNPLINICEDIDECTGPYR-LQCEPFKEI----------------------CVRKPGLSTC-ETQCS-GGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTC--SEIKC-EGYEELNNATKECHCKSGFKRNLYTGKC-EDVDECDSLIPVCGNKGRCKNEIGRYNC-QCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSS 1460
            C DINEC+     C   + C N  GSY+CI    C +GY+   E   C+D++ECA  + +C  G VC N+ G++ C  P  CP  K     S C    +C  G    P    C + D   G YR + C   +++                      CV   G   C +  C  G T++    C D+DEC E    C   Q C N FG Y C  S IKC  GYE  N                  G+C  D+DEC S I  CG +  C+N  G Y C  C  GY F N  C+D DEC  +  +C H +C NTPG F C C+ G+K+  ++  C DI+EC+     C+          EC N  GSY+C    C  GY + ++  S
Sbjct:    8 CLDINECATGQVTCGDGQICLNTKGSYRCI----CKRGYK--AEGPKCVDVDECATGIAFCPPGNVCRNLPGTYICSSPNTCPAGK-EKRGSDCVDIDECATGQARCPPTTRCVNAD---GSYRCVPCPAGRKLENNQCVDIDECVNGNICGSGSRCVNTEGSYKCVQMSCGPGKTLQPGTGCVDIDECTEGSYPCAADQTCQNVFGSYRCQASAIKCSRGYEPQN------------------GRCVVDIDECASGIARCGREQFCENVEGAYRCVTCRTGYRFTNGRCVDRDEC-RIGVVCAH-ECTNTPGSFICSCRRGFKLEPDKRSCRDIDECSLPNPPCQH---------ECRNRYGSYQCY---CKDGYTLAADKRS 349          

HSP 3 Score: 78.1814 bits (191), Expect = 3.457e-15
Identity = 67/195 (34.36%), Postives = 88/195 (45.13%), Query Frame = 3
Query:  867 NICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQ----CNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCV-CKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSG 1433
             +C D++ECA  +  C D Q C N  G Y                   C CK G+K      KC DVDEC + I  C     C+N  G Y C     C  G E + + C+DIDEC + +  C    +C N  G ++CV C +G K+ N N C DI+EC     IC        +   C N  GSYKC++  C  G
Sbjct:    6 GVCLDINECATGQVTCGDGQICLNTKGSY------------------RCICKRGYKAE--GPKCVDVDECATGIAFCPPGNVCRNLPGTYICSSPNTCPAGKEKRGSDCVDIDECATGQARCPPTTRCVNADGSYRCVPCPAGRKLEN-NQCVDIDECVNG-NIC-------GSGSRCVNTEGSYKCVQMSCGPG 171          

HSP 4 Score: 60.077 bits (144), Expect = 1.503e-9
Identity = 46/140 (32.86%), Postives = 66/140 (47.14%), Query Frame = 3
Query: 1041 LYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC--GHLKCENTPGFFKC----VCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRV 1442
            L  G C D++EC +    CG+   C N  G Y C C  GY+ +   C+D+DEC +    C  G++ C N PG + C     C +G K    + C DI+EC      C            C N  GSY+C+   CP+G ++
Sbjct:    3 LTNGVCLDINECATGQVTCGDGQICLNTKGSYRCICKRGYKAEGPKCVDVDECATGIAFCPPGNV-CRNLPGTYICSSPNTCPAG-KEKRGSDCVDIDECATGQARCPPT-------TRCVNADGSYRCVP--CPAGRKL 131          

HSP 5 Score: 52.7582 bits (125), Expect = 3.525e-7
Identity = 34/93 (36.56%), Postives = 47/93 (50.54%), Query Frame = 3
Query: 1161 EFKNATCLDIDECVSLKDICGHLK-CENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLE-SICPSG 1433
            E  N  CLDI+EC + +  CG  + C NT G ++C+CK GYK      C D++EC      C    +       C NL G+Y C   + CP+G
Sbjct:    2 ELTNGVCLDINECATGQVTCGDGQICLNTKGSYRCICKRGYKAEGPK-CVDVDECATGIAFCPPGNV-------CRNLPGTYICSSPNTCPAG 86          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Nematostella
Match: EDO33295 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL3])

HSP 1 Score: 140.584 bits (353), Expect = 5.244e-35
Identity = 122/381 (32.02%), Postives = 165/381 (43.31%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCI--DLNECAQSLKYCDSGM----------------VCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIAN-ICYDVDECAENKNNCTD-----TQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEF-KNATCLDIDECVSLKDICGHLKCENTPGFFKCV--CKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            C  G+  + +E+ C+D++ECS  +  C   + C N PG+Y+C  +  CG GY        C+     EC Q L   D G                 +C+N  G+F C                  C+ G+        CED+DEC+ P   +C P  + CV  PG   CE+ C  G  K A+  C DVDECAE ++  +      T  C N  G Y+C+                  C  GF   L  GKC D+DEC   + V  N G C+N  G Y C C  GYE      C DIDEC     +CG  +C NT G +KC+  C  G+K + E  C D+NEC E    C+           C N  GS+ C    CP G++
Sbjct:  123 CRPGFYLLDDERTCEDLDECSLPSTKCPDGQRCVNTPGNYRC--ESPCGAGYS-KAADGACVGPQPTECPQGLMKNDKGTYCIDIDECQFPGACSHICQNGYGTFRC-----------------ICRPGFYLLDDERTCEDLDECSLP-STKC-PDGQRCVNTPGNYRCESPCGAGYSKAADGACVDVDECAEFRSRPSRGTHPCTHSCQNTLGSYSCT------------------CDKGFA--LKDGKCLDIDEC---VGVVCNHG-CRNTDGSYECYCFSGYELIAGGQCRDIDECRVNASVCGPKQCANTMGGYKCLDSCSLGFKRTLEGACVDVNECVEGGHDCKFTHF-------CMNTHGSFYC---TCPRGFK 447          

HSP 2 Score: 134.42 bits (337), Expect = 5.313e-33
Identity = 111/356 (31.18%), Postives = 156/356 (43.82%), Query Frame = 3
Query:  420 KDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGC-----HQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLI--PVCGNKG---RCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESS 1457
            ++I+EC       HI   C+N  G+++CI    C  G+    + +TC DL+EC+     C  G  C N  G++ C  PC        +  C      +C +G   N     C DIDEC  P          IC    G   C  +     +     C D+DEC+     C D QRC N  G Y C                E  C +G+ +    G C DVDEC      P  G       C+N +G Y+C C+ G+  K+  CLDIDECV +  +C H  C NT G ++C C SGY++     C DI+EC     +C  +        +C N +G YKCL+S C  G++   E +
Sbjct:   97 RNIDECLFPGACSHI---CQNGYGTFRCI----CRPGFYLLDDERTCEDLDECSLPSTKCPDGQRCVNTPGNYRCESPCGAGYSKAADGACVGPQPTECPQGLMKNDKGTYCIDIDECQFPGAC-----SHICQNGYGTFRCICRPGFYLLDDERTCEDLDECSLPSTKCPDGQRCVNTPGNYRC----------------ESPCGAGYSKAA-DGACVDVDECAEFRSRPSRGTHPCTHSCQNTLGSYSCTCDKGFALKDGKCLDIDECVGV--VCNH-GCRNTDGSYECYCFSGYELIAGGQCRDIDECRVNASVCGPK--------QCANTMGGYKCLDS-CSLGFKRTLEGA 411          

HSP 3 Score: 119.398 bits (298), Expect = 3.702e-28
Identity = 125/484 (25.83%), Postives = 184/484 (38.02%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGM-----VCENVIGSFNCRPPCPTNKPHYW----------------NSGCHQ--------CKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIK-IANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK-------------------------------------------NATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNEN-VCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPI 1607
            C  G+  + +E+ C+D++ECS  +  C   + C N PG+Y+C  +  CG GY        C+D++ECA+       G       C+N +GS++C      +K                    N GC          C  GY        C DIDEC     + C P  + C    G   C   CS G  + +   C DV+EC E  ++C  T  C N  G + C+                  C  GFK     G C+DV+EC     +C  K  C+N  G + C C PG   K                                             +C+DIDEC S +      +C NT G ++C C  GY+ S +   C D +EC  + G+C+ +        +CFN  GSY+C+++ CP+ Y  L        C L    C+          LP  +      +R    +P  +   PI
Sbjct:  228 CRPGFYLLDDERTCEDLDECSLPSTKCPDGQRCVNTPGNYRC--ESPCGAGYS-KAADGACVDVDECAEFRSRPSRGTHPCTHSCQNTLGSYSCT----CDKGFALKDGKCLDIDECVGVVCNHGCRNTDGSYECYCFSGYELI-AGGQCRDIDECRVNASV-CGP--KQCANTMGGYKCLDSCSLGFKRTLEGACVDVNECVEGGHDCKFTHFCMNTHGSFYCT------------------CPRGFKSKTPGGPCQDVNECVDFPGLCQYK--CQNTRGSFKCLCPPGGYLKADGLSCGGIDGCVLNNLKCDQRCGFSEQGYSCECVKGYRLAIDRQSCVDIDECSSNQTNSCQYQCINTEGGYQCKCPPGYRTSPDGRTCMDDDECAGSDGVCQRDE-------QCFNTKGSYRCVQTSCPANYNQLGPGFCVTPCSLQ-GYCTPQALRYYTTTLPYGVPANQDLLRLIPHIPPHLLAQPI 672          

HSP 4 Score: 51.2174 bits (121), Expect = 1.249e-6
Identity = 53/208 (25.48%), Postives = 80/208 (38.46%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEG-YEELN 995
            TC  G++       C+D+NEC     +C     C+N  GS+KC+    C  G     +  +C  ++ C               V+ +  C   C  ++  Y      +C +GYR       C DIDEC+      C+     C+   G   C+      T      C D DECA +   C   ++C N  G Y C +  C   Y +L 
Sbjct:  441 TCPRGFKSKTPGGPCQDVNECVDFPGLCQYK--CQNTRGSFKCL----CPPGGYLKADGLSCGGIDGC---------------VLNNLKCDQRCGFSEQGYSC----ECVKGYRLAIDRQSCVDIDECSSNQTNSCQ---YQCINTEGGYQCKCPPGYRTSPDGRTCMDDDECAGSDGVCQRDEQCFNTKGSYRCVQTSCPANYNQLG 620          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Nematostella
Match: EDO38787 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBY9])

HSP 1 Score: 128.257 bits (321), Expect = 1.111e-32
Identity = 104/344 (30.23%), Postives = 141/344 (40.99%), Query Frame = 3
Query:  258 ECAKYTEWDPVLKKCQDCQFNKVYNETLR--RCVDMDDT-NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGY 1280
            EC+     D +   C D      +    R  RCV+   T    C  GY    +   C+DINEC      C  +E C N  GSY C     CG G+    + +TC D++EC +    C  G  C N+ G + C                  C +GY+ +     C D+DEC    RL       +C   PG   C         K    C DV+EC   +  C +  RC N  G Y                   C CK GF  +  +  C DVDEC + I  C  +G C N  G + C C+ GY     TC+DI+EC++  ++C H +C N  G F C C+ GY
Sbjct:   28 ECSAGLTLDSIQNACVDINECNTWQGLCRNGRCVNKQGTFECICNQGYGLTADRMDCEDINECLVDNGRC--SEMCNNTLGSYLC----DCGAGFALQPDGRTCRDIDECMERPDVCGPGNTCNNIEGGYYC-----------------TCGKGYKQSVDSRSCIDVDECQEDPRL---CTNGVCRNTPGSFECLCAKGYAIAKGTTACVDVNECQTGQAMCHENARCANLVGSY------------------RCECKPGFIGDGSS--CTDVDECTTGIAQCSEQGTCVNTPGSHRCVCHEGYTGDGITCVDINECLADPNLCEHGQCINKAGSFMCDCEIGY 325          

HSP 2 Score: 117.857 bits (294), Expect = 4.863e-29
Identity = 107/347 (30.84%), Postives = 142/347 (40.92%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANI--CYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC 1409
            C +G      +  C DINEC+    +C  N  C N  G+++CI    C QGY    +   C D+NEC      C    +C N +GS+ C                  C  G+   P    C DIDEC     + C P    C    G   C   C  G  +  +   C DVDEC E+   CT+   C N  G +                  EC C  G+     T  C DV+EC +   +C    RC N +G Y C+C PG+    ++C D+DEC +    C     C NTPG  +CVC  GY   +   C DINEC   P +C           +C N  GS+ C
Sbjct:   29 CSAGLTLDSIQNACVDINECNTWQGLCR-NGRCVNKQGTFECI----CNQGYGLTADRMDCEDINECLVDNGRCSE--MCNNTLGSYLC-----------------DCGAGFALQPDGRTCRDIDECMERPDV-CGP-GNTCNNIEGGYYC--TCGKGYKQSVDSRSCIDVDECQEDPRLCTNGV-CRNTPGSF------------------ECLCAKGYAIAKGTTACVDVNECQTGQAMCHENARCANLVGSYRCECKPGFIGDGSSCTDVDECTTGIAQCSEQGTCVNTPGSHRCVCHEGY-TGDGITCVDINECLADPNLCE--------HGQCINKAGSFMC 319          

HSP 3 Score: 102.449 bits (254), Expect = 7.196e-24
Identity = 86/286 (30.07%), Postives = 121/286 (42.31%), Query Frame = 3
Query:  561 IDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYE--FKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC 1409
            ID++EC    + C +G +C N  GS+ C                 +C  G   + + N C DI+EC   ++  C   +  CV K G   C      G       C D++EC  +   C+  + CNN  G Y C                   C +GF        C D+DEC     VCG    C N  G Y C C  GY+    + +C+D+DEC     +C +  C NTPG F+C+C  GY ++     C D+NEC     +C       +    C NLVGSY+C
Sbjct:    1 IDVDECTMYPQLCRNG-ICVNTPGSYRC-----------------ECSAGLTLDSIQNACVDINECN-TWQGLCRNGR--CVNKQGTFECICNQGYGLTADRMDCEDINECLVDNGRCS--EMCNNTLGSYLCD------------------CGAGFALQPDGRTCRDIDECMERPDVCGPGNTCNNIEGGYYCTCGKGYKQSVDSRSCIDVDECQEDPRLCTNGVCRNTPGSFECLCAKGYAIAKGTTACVDVNECQTGQAMC-------HENARCANLVGSYRC 238          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Nematostella
Match: EDO49410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGE4])

HSP 1 Score: 132.109 bits (331), Expect = 2.129e-32
Identity = 133/405 (32.84%), Postives = 169/405 (41.73%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCR---------------PPCPTNK---------PHYWNSGCHQCKEGYRWNPLINICEDIDEC-TGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTC---------------------SEIKCEGYEELNNATKE--CHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEF--KNATCLDIDECVSLKDICGHLK--CENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            C+ GY    +   CKDI+EC+ K D C  N  C N+ GS+ C     C +G+E N   +TCI  NEC      C    VC N  GSF CR                 C T +          +   S   QC EGY  +     C D++EC TG +         +C    G   C  +C  G I     C D DEC   KN+C     C N  G Y+C                     S++ C+      N      C CKSGF+ +  T  C DVDEC     +CGN   C N +G Y C+C  G+E   ++  C DIDEC      C H+   C N PG F C C +G+ + +  +C DINEC E    C I         EC N VGSY C    C  GY
Sbjct:  279 CKKGY--TGDGITCKDIDECTNKTDDCDANALCTNVLGSFVC----RCLKGFEGN--GKTCIHDNECESGANDCSPDAVCTNTPGSFVCRCNKGFTGDGKICIDVDECKTGQVKCGENEVCANSLGSFTCQCAEGYERDSQ-GKCADVNECKTGKHDCS---VNALCTNTDGTFIC--RCLRGYIGDGKTCIDFDECKLPKNDCDVNAECINSIGSYSCICKPGFTGNGKTCTDKNECVGSDLLCDPNALCTNTPGSYLCRCKSGFQGDGKT--CADVDECIKSDDICGNNTECLNNVGSYTCKCKEGFEDNDQDKHCKDIDECSDGSHDC-HVNAICTNVPGTFLCRCINGF-LGDGKLCADINECFEGTANCDI-------NAECTNSVGSYNCQ---CMEGY 655          

HSP 2 Score: 120.553 bits (301), Expect = 1.603e-28
Identity = 119/409 (29.10%), Postives = 173/409 (42.30%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNC----------RPPCPTNKPHYWNSGCHQ--------------CKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENK-NNCTDTQRCNNYFGYY-------------TCSEI---------KCEGYEELNNATKE--CHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSES 1454
            C+ GY+   E   C D +EC+    IC  N  C N PGSY+C  K    +GY+ + +   C D +ECA  +  CD   VC N +GS+ C          R P   N+     + C Q              CK G++ N +  +C DIDEC    +  C+P   +C    G   C  +C  G      +C D+DEC   + NNC     C N FG +             TC ++         KC+      N+     C CK G+  +  T  C+D+DEC +    C     C N +G + C+C  G+E    TC+  +EC S  + C     C NTPG F C C  G+   +  +C D++E       C+  ++       C N +GS+ C    C  GY   S+ 
Sbjct:   30 CKPGYKGNGE--ICTDADECTATPGICGENSICINTPGSYQCSCK----EGYQPSSDGN-CDDYDECAGGIADCDINSVCTNTLGSYKCTCKQGFVGDGRFPVDINECEVRIADCSQNATCTNTNGSYSCTCKAGFQGNGI--VCRDIDECQ-AGKYSCDP-NALCTNTEGSYVC--RCLKGFTGDGLVCSDIDECKVTELNNCDANALCTNIFGTFVCRCRKGFVGDGKTCVDVDECASVLHNKCDPNALCTNSVGSYVCRCKKGYTGDGIT--CKDIDECTNKTDDCDANALCTNVLGSFVCRCLKGFEGNGKTCIHDNECESGANDCSPDAVCTNTPGSFVCRCNKGF-TGDGKICIDVDE-------CKTGQVKCGENEVCANSLGSFTCQ---CAEGYERDSQG 412          

HSP 3 Score: 117.857 bits (294), Expect = 1.099e-27
Identity = 130/456 (28.51%), Postives = 176/456 (38.60%), Query Frame = 3
Query:  276 EWDPVLKKCQDCQFNKVYNETLRRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAEN-KNNCTDTQRCNNYFGYYTC--------SEIKCEGYEELNNATKEC---------------HCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLK-CENTPGFFKCVCKSGYKMSNENVCEDINEC-------------TETPG--ICRIERLSLNN-------------------RVECFNLVGSYKCLESICPSGYRVLSESSSTK 1466
            ++D       DC  N V   TL           TC+ G  FV + +   DINEC  +   C  N  C N  GSY C  K     G++ N     C D++EC      CD   +C N  GS+ CR                 C +G+  + L+  C DIDEC       C+    +C    G   C  +C  G +     C DVDECA    N C     C N  G Y C          I C+  +E  N T +C                C  GF+ N  T  C   +EC+S    C     C N  G + C+CN G+      C+D+DEC + +  CG  + C N+ G F C C  GY+  ++  C D+NEC             T T G  ICR  R  + +                     EC N +GSY C   IC  G+    ++ + K
Sbjct:   85 DYDECAGGIADCDINSVCTNTLGS------YKCTCKQG--FVGDGRFPVDINECEVRIADCSQNATCTNTNGSYSCTCK----AGFQGN--GIVCRDIDECQAGKYSCDPNALCTNTEGSYVCR-----------------CLKGFTGDGLV--CSDIDECKVTELNNCDA-NALCTNIFGTFVC--RCRKGFVGDGKTCVDVDECASVLHNKCDPNALCTNSVGSYVCRCKKGYTGDGITCKDIDECTNKTDDCDANALCTNVLGSFVCRCLKGFEGNGKT--CIHDNECESGANDCSPDAVCTNTPGSFVCRCNKGFTGDGKICIDVDECKTGQVKCGENEVCANSLGSFTCQCAEGYERDSQGKCADVNECKTGKHDCSVNALCTNTDGTFICRCLRGYIGDGKTCIDFDECKLPKNDCDVNAECINSIGSYSC---ICKPGFTGNGKTCTDK 499          

HSP 4 Score: 103.219 bits (256), Expect = 5.502e-23
Identity = 94/309 (30.42%), Postives = 127/309 (41.10%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKC-IVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNEN 1298
            C  GY+    + KC D+NEC      C +N  C N  G++ C  ++ Y G G       +TCID +EC      CD    C N IGS++C                  CK G+  N     C D +EC G   L C+P   +C   PG   C  +C  G       C DVDEC ++ + C +   C N  G YTC                   CK GF+ N     C+D+DEC      C     C N  G + C+C  G+      C DI+EC      C  + +C N+ G + C C  GY    +N
Sbjct:  402 CAEGYERD-SQGKCADVNECKTGKHDCSVNALCTNTDGTFICRCLRGYIGDG-------KTCIDFDECKLPKNDCDVNAECINSIGSYSCI-----------------CKPGFTGNG--KTCTDKNECVGS-DLLCDP-NALCTNTPGSYLC--RCKSGFQGDGKTCADVDECIKSDDICGNNTECLNNVGSYTC------------------KCKEGFEDNDQDKHCKDIDECSDGSHDCHVNAICTNVPGTFLCRCINGFLGDGKLCADINECFEGTANCDINAECTNSVGSYNCQCMEGYTGDGKN 661          

HSP 5 Score: 79.7221 bits (195), Expect = 1.308e-15
Identity = 85/285 (29.82%), Postives = 116/285 (40.70%), Query Frame = 3
Query:  564 DLNECAQ-SLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCE-DVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC 1409
            D++EC+   +  C +   C N  GSF C                 +CK GY+ N    IC D DECT    +  E    IC+  PG   C  +  G        C D DECA    +C     C N  G Y C+                  CK GF   +  G+   D++EC+  I  C     C N  G Y+C C  G++     C DIDEC + K  C  +  C NT G + C C  G+   +  VC DI+EC  T      E  + +    C N+ G++ C
Sbjct:    1 DVDECSTPGVATCSNLATCINTPGSFKC-----------------ECKPGYKGNG--EICTDADECTATPGICGE--NSICINTPGSYQCSCK-EGYQPSSDGNCDDYDECAGGIADCDINSVCTNTLGSYKCT------------------CKQGF---VGDGRFPVDINECEVRIADCSQNATCTNTNGSYSCTCKAGFQGNGIVCRDIDECQAGKYSCDPNALCTNTEGSYVCRCLKGF-TGDGLVCSDIDECKVT------ELNNCDANALCTNIFGTFVC 235          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Nematostella
Match: EDO27742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8E5])

HSP 1 Score: 130.954 bits (328), Expect = 2.558e-32
Identity = 131/398 (32.91%), Postives = 164/398 (41.21%), Query Frame = 3
Query:  291 LKKCQD---CQFNKVYNETLRRCVDMDDT-NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLIN-ICEDIDECT-GPYRLQCE---------PFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            L  C D   C+ N       R CV+ D +    C+ GY  V     C+DINEC+     C  +  C N  GSY C  K        F +   TC D++ECA  +  C +   C N  GS+ CR                 CK GY    L+N  C D++ECT  PY    E          FK  C  KPG +   ++  G        C D DECA     C  +  C N  G YT                  C CK G+   L    C+D+DEC   +  C     C N  G Y C+C  G+   N TC DIDEC      C     C N  G + C CK GY + N+  C D+NECTETP +C  E     N + C N  GS+KC    C  GY
Sbjct:   98 LTSCDDIDECKLNISTCPANRYCVNNDGSYTCKCKPGYTLV--NNTCEDINECALGVANCPASADCVNNNGSYTCRCKP------GFTLVNNTCKDIDECALGVATCPASADCVNNDGSYTCR-----------------CKRGYT---LVNKTCTDVNECTETPYICSGENSICENTDGSFK--CSCKPGYTPKFSKAVGDAPANLTSCDDTDECALGVATCPASADCVNNDGSYT------------------CRCKRGYT--LVNKTCKDIDECALGVATCPASADCVNNNGSYTCRCKRGFTLVNNTCKDIDECALGVATCPASADCVNNDGSYTCRCKRGYTLVNK-TCTDVNECTETPYVCSGE-----NSI-CENTDGSFKCS---CKPGY 435          

HSP 2 Score: 127.102 bits (318), Expect = 5.032e-31
Identity = 118/373 (31.64%), Postives = 155/373 (41.55%), Query Frame = 3
Query:  420 KDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDS-GMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPL-INICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICG--HLKCENTPGFFKCVCKSGY----------KMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSES-SSTKACQLSYPTC 1493
             DI+EC+     C  +  C N  GSY C     C +GY   +  +TC D+NEC ++   C     +CEN  GSF C     + KP Y      +  +     P  +  C+DIDEC     +   P    CV   G  TC  +C  G   + N C D++ECA    NC  +  C N  G YT                  C CK GF   L    C+D+DEC   +  C     C N  G Y C+C  GY   N TC D++EC     IC   +  CENT G FKC CK GY            +N   C+D +EC      C           +C N  GSY C    C  GY +++++      C L   TC
Sbjct:    8 SDIDECALGVATCPASADCVNNDGSYTC----RCKRGYT--LVNKTCTDVNECTETPYVCSGENSICENTDGSFKC-----SCKPGYT----PKFSKAVGDAPANLTSCDDIDEC--KLNISTCPANRYCVNNDGSYTC--KCKPGYTLVNNTCEDINECALGVANCPASADCVNNNGSYT------------------CRCKPGFT--LVNNTCKDIDECALGVATCPASADCVNNDGSYTCRCKRGYTLVNKTCTDVNECTETPYICSGENSICENTDGSFKCSCKPGYTPKFSKAVGDAPANLTSCDDTDECALGVATCPAS-------ADCVNNDGSYTCR---CKRGYTLVNKTCKDIDECALGVATC 331          

HSP 3 Score: 121.324 bits (303), Expect = 3.713e-29
Identity = 116/409 (28.36%), Postives = 160/409 (39.12%), Query Frame = 3
Query:  360 DDTNVTCESGYQFVFEEKKCKDINECSQKADICHI-NEYCRNLPGSYKCIVKDYCGQGY---------EFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTC---------------------SEIKCEGYEEL---NNATKECHCKSGFKRNLYTG---------KCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSES 1454
            +D + TC     +    K C D+NEC++   +C   N  C N  GS+KC     C  GY         +      +C D++EC  ++  C +   C N  GS+ C+                 CK GY    + N CEDI+EC     +   P    CV   G  TC  +C  G   + N C D+DECA     C  +  C N  G YTC                     +   C G   +    + + +C CK G+                 C+D DEC   +  C     C N  G Y C+C  GY   N TC DIDEC      C     C N  G + C CK G+ + N N C+DI+EC      C           +C N  GSY C    C  GY +++++
Sbjct:   29 NDGSYTCRCKRGYTLVNKTCTDVNECTETPYVCSGENSICENTDGSFKC----SCKPGYTPKFSKAVGDAPANLTSCDDIDECKLNISTCPANRYCVNNDGSYTCK-----------------CKPGYTL--VNNTCEDINECA--LGVANCPASADCVNNNGSYTC--RCKPGFTLVNNTCKDIDECALGVATCPASADCVNNDGSYTCRCKRGYTLVNKTCTDVNECTETPYICSGENSICENTDGSFKCSCKPGYTPKFSKAVGDAPANLTSCDDTDECALGVATCPASADCVNNDGSYTCRCKRGYTLVNKTCKDIDECALGVATCPASADCVNNNGSYTCRCKRGFTLVN-NTCKDIDECALGVATCPAS-------ADCVNNDGSYTCR---CKRGYTLVNKT 399          

HSP 4 Score: 116.316 bits (290), Expect = 1.600e-27
Identity = 120/389 (30.85%), Postives = 159/389 (40.87%), Query Frame = 3
Query:  360 DDTNVTCESGYQFVFEEKKCKDINECSQKADICHI-NEYCRNLPGSYKCIVKDYCGQGY---------EFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLIN-ICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVC-GNKGRCKNEIGRYNCQCNPGY--EFKNA---------TCLDIDEC-VSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSES 1454
            +D + TC     +    K C D+NEC++   IC   N  C N  GS+KC     C  GY         +      +C D +ECA  +  C +   C N  GS+ CR                 CK GY    L+N  C+DIDEC     +   P    CV   G  TC  +C  G   + N C D+DECA     C  +  C N  G YTC                   CK G+   L    C DV+EC     VC G    C+N  G + C C PGY  +F  A         +C DIDEC +++     +  C N  G + C CK GY + N N CEDI+EC      C           +C N  GSY C    C  G+ +++ +
Sbjct:  205 NDGSYTCRCKRGYTLVNKTCTDVNECTETPYICSGENSICENTDGSFKC----SCKPGYTPKFSKAVGDAPANLTSCDDTDECALGVATCPASADCVNNDGSYTCR-----------------CKRGYT---LVNKTCKDIDECA--LGVATCPASADCVNNNGSYTC--RCKRGFTLVNNTCKDIDECALGVATCPASADCVNNDGSYTC------------------RCKRGYT--LVNKTCTDVNECTETPYVCSGENSICENTDGSFKCSCKPGYTPKFSKAVGDAPANLTSCDDIDECKLNISTCPANRYCVNNDGSYTCKCKPGYTLVN-NTCEDIDECALGVANCPAS-------ADCVNNDGSYTCR---CKRGFTLVNNT 534          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Medaka
Match: FBLN1 (fibulin 1 [Source:NCBI gene;Acc:101160948])

HSP 1 Score: 144.821 bits (364), Expect = 5.967e-36
Identity = 123/381 (32.28%), Postives = 166/381 (43.57%), Query Frame = 3
Query:  342 RRCVDMDDT-NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN---ATCLDIDECVSLKDICGHLKCENTPGFFKCVC-KSGYKMSNEN-VCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTK 1466
            R CV+ + + +  C++G+ +    KKC+DI+EC+     C  N  C N  GS++C     CG GY  +   + C+D+NEC      C  G  C N +GSF CR            S    C  GY  N     CED+DEC       C      CV   G   CE Q       I+ +C DV+EC           +C N  G Y CS IK                  GFK       CEDVDEC+  I  C  +  C N  G Y C C  GYE  +    TC DIDEC ++ ++C + +C NT G F C C  SGY +  +   C+D++EC      C            CFN+ G ++CL   CP  +R  +  S  +
Sbjct:  302 RACVNTEGSYHCECQTGFMYSRVSKKCEDIDECALWTSTCGANFVCVNTDGSFQCHPDKACGDGYILDPAGK-CVDVNECVTHSHPCRPGQACINTVGSFYCR------------SIVASCARGYHLNADGTHCEDVDECV--LHNVCGSHGS-CVNVEGSYRCECQNGFTFNSISKLCEDVNECRHYSGRLC-AHKCENTEGSYHCSCIK------------------GFKLAENGNNCEDVDECE--INPCSQE--CANVYGSYQCYCRRGYELNDIDGITCEDIDEC-AIPNVCSY-RCINTVGGFNCTCPSSGYTLGPDGRSCQDVDECAAGTHTCSASE-------NCFNIQGGFRCLYFDCPPNFRRATSGSEAE 634          

HSP 2 Score: 142.124 bits (357), Expect = 4.768e-35
Identity = 125/417 (29.98%), Postives = 176/417 (42.21%), Query Frame = 3
Query:  315 FNKVYNETLRRCVD-------MDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCH---------------------------QCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTC--ETQCSGGTI-KIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNAT--CLDIDECVSLKD-ICGHLKCENTPGFFKCVCKSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRV 1442
            F     + +R C D       +++    C  G+Q   +   C+DI+EC      C   + C N  GS+ C  K  CG GY    E   C D++ECA     C++  VC N  GS+ C+P     + +  +S  +                           +C+ G+ ++ +   CEDIDEC          F  +CV   G   C  +  C  G I   A  C DV+EC  + + C   Q C N  G + C  I                C  G+  N     CEDVDEC  L  VCG+ G C N  G Y C+C  G+ F + +  C D++EC      +C H KCENT G + C C  G+K++ N N CED++EC   P              EC N+ GSY+C    C  GY +
Sbjct:  156 FTTPPPQRMRSCQDANCSQLCLENAMCACREGFQMKMDGVTCQDIDECLTGRHNCGPGQVCLNTDGSFDC--KPRCGTGYVLTAENH-CEDIDECALWTHNCEANFVCVNTAGSYRCQPKTGCEEGYIQDSAGNCIDMDECLKGNVCGSRACVNTEGSYHCECQTGFMYSRVSKKCEDIDECALWTSTCGANF--VCVNTDGSFQCHPDKACGDGYILDPAGKCVDVNECVTHSHPCRPGQACINTVGSFYCRSIVAS-------------CARGYHLNADGTHCEDVDEC-VLHNVCGSHGSCVNVEGSYRCECQNGFTFNSISKLCEDVNECRHYSGRLCAH-KCENTEGSYHCSCIKGFKLAENGNNCEDVDECEINP-----------CSQECANVYGSYQCY---CRRGYEL 538          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Medaka
Match: FBLN1 (fibulin 1 [Source:NCBI gene;Acc:101160948])

HSP 1 Score: 144.821 bits (364), Expect = 1.045e-35
Identity = 123/381 (32.28%), Postives = 166/381 (43.57%), Query Frame = 3
Query:  342 RRCVDMDDT-NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN---ATCLDIDECVSLKDICGHLKCENTPGFFKCVC-KSGYKMSNEN-VCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTK 1466
            R CV+ + + +  C++G+ +    KKC+DI+EC+     C  N  C N  GS++C     CG GY  +   + C+D+NEC      C  G  C N +GSF CR            S    C  GY  N     CED+DEC       C      CV   G   CE Q       I+ +C DV+EC           +C N  G Y CS IK                  GFK       CEDVDEC+  I  C  +  C N  G Y C C  GYE  +    TC DIDEC ++ ++C + +C NT G F C C  SGY +  +   C+D++EC      C            CFN+ G ++CL   CP  +R  +  S  +
Sbjct:  440 RACVNTEGSYHCECQTGFMYSRVSKKCEDIDECALWTSTCGANFVCVNTDGSFQCHPDKACGDGYILDPAGK-CVDVNECVTHSHPCRPGQACINTVGSFYCR------------SIVASCARGYHLNADGTHCEDVDECV--LHNVCGSHGS-CVNVEGSYRCECQNGFTFNSISKLCEDVNECRHYSGRLC-AHKCENTEGSYHCSCIK------------------GFKLAENGNNCEDVDECE--INPCSQE--CANVYGSYQCYCRRGYELNDIDGITCEDIDEC-AIPNVCSY-RCINTVGGFNCTCPSSGYTLGPDGRSCQDVDECAAGTHTCSASE-------NCFNIQGGFRCLYFDCPPNFRRATSGSEAE 772          

HSP 2 Score: 139.428 bits (350), Expect = 4.610e-34
Identity = 121/364 (33.24%), Postives = 162/364 (44.51%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTC--ETQCSGGTI-KIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNAT--CLDIDECVSLKD-ICGHLKCENTPGFFKCVCKSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRV 1442
              C  G+ F   E KC+DI+EC+     C  N  C N  GSY+C  K  C +GY        CID++EC +    C S   C N  GS++C                 +C+ G+ ++ +   CEDIDEC          F  +CV   G   C  +  C  G I   A  C DV+EC  + + C   Q C N  G + C  I                C  G+  N     CEDVDEC  L  VCG+ G C N  G Y C+C  G+ F + +  C D++EC      +C H KCENT G + C C  G+K++ N N CED++EC   P              EC N+ GSY+C    C  GY +
Sbjct:  365 AACAPGFHFT-PENKCRDIDECALWTHNCEANFVCVNTAGSYRCQPKTGCEEGY-IQDSAGNCIDMDECLKG-NVCGS-RACVNTEGSYHC-----------------ECQTGFMYSRVSKKCEDIDECALWTSTCGANF--VCVNTDGSFQCHPDKACGDGYILDPAGKCVDVNECVTHSHPCRPGQACINTVGSFYCRSIVAS-------------CARGYHLNADGTHCEDVDEC-VLHNVCGSHGSCVNVEGSYRCECQNGFTFNSISKLCEDVNECRHYSGRLCAH-KCENTEGSYHCSCIKGFKLAENGNNCEDVDECEINP-----------CSQECANVYGSYQCY---CRRGYEL 676          

HSP 3 Score: 133.65 bits (335), Expect = 3.780e-32
Identity = 117/376 (31.12%), Postives = 166/376 (44.15%), Query Frame = 3
Query:  363 DTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDEC-TGPYRLQCEPFKEICVRKPGLSTCETQCSGG-TIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNAT--CLDIDECVSLKDICG-HLKCENTPGFFKC----VCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC--LESICPSGYRVLSESS 1457
            D    C +GY  +  E  C+DI+EC+ ++  C  N  C N  GS++C  K+ C  GY     T +C+D+NEC      C     C N  GS+ CR            S    CK+GY+       CED++EC T  +        EIC+   G   C+  C+ G      N C D+DECA   +NC     C N  G Y C                +  C+ G+ ++   G C D+DEC     VCG++  C N  G Y+C+C  G+ +   +  C DIDEC      CG +  C NT G F+C     C  GY +     C D+NEC      CR  +        C N VGS+ C  + + C  GY + ++ +
Sbjct:  224 DCKPRCGTGY-VLTAENHCEDIDECAFESHNCEANFVCLNTAGSFRCERKNVCRDGY-IQDSTGSCVDINECLTHTDACQPDQFCINSEGSYTCR------------STTDDCKQGYQLTADGLRCEDVNECLTSSHNC---AHGEICLNTEGSFYCQAACAPGFHFTPENKCRDIDECALWTHNCEANFVCVNTAGSYRCQ--------------PKTGCEEGYIQD-SAGNCIDMDECLKG-NVCGSRA-CVNTEGSYHCECQTGFMYSRVSKKCEDIDECALWTSTCGANFVCVNTDGSFQCHPDKACGDGYILDPAGKCVDVNECVTHSHPCRPGQA-------CINTVGSFYCRSIVASCARGYHLNADGT 558          

HSP 4 Score: 103.605 bits (257), Expect = 1.346e-22
Identity = 103/348 (29.60%), Postives = 141/348 (40.52%), Query Frame = 3
Query:  519 CGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQ--CSGGTIKIA-NICYDVDECAENKNNCTDTQRCNNYFGYYTCSE---------------IKCEGYEELNNATKEC-----------------HCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQ----CNPGY-EFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSN-ENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCL-ESICPSGY 1436
            C +G++  ++  TC D++EC      C  G VC N  GSF+C+P C T               GY      N CEDIDEC       CE    +C+   G   CE +  C  G I+ +   C D++EC  + + C   Q C N  G YTC                 ++CE   E   ++  C                  C  GF       KC D+DEC      C     C N  G Y CQ    C  GY +     C+D+DEC+   ++CG   C NT G + C C++G+  S     CEDI+EC      C    +       C N  GS++C  +  C  GY
Sbjct:  184 CREGFQMKMDGVTCQDIDECLTGRHNCGPGQVCLNTDGSFDCKPRCGT---------------GYVLTAE-NHCEDIDECAFESH-NCEA-NFVCLNTAGSFRCERKNVCRDGYIQDSTGSCVDINECLTHTDACQPDQFCINSEGSYTCRSTTDDCKQGYQLTADGLRCEDVNECLTSSHNCAHGEICLNTEGSFYCQAACAPGFHFTPEN-KCRDIDECALWTHNCEANFVCVNTAGSYRCQPKTGCEEGYIQDSAGNCIDMDECLK-GNVCGSRACVNTEGSYHCECQTGFMYSRVSKKCEDIDECALWTSTCGANFV-------CVNTDGSFQCHPDKACGDGY 504          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Medaka
Match: FBLN1 (fibulin 1 [Source:NCBI gene;Acc:101160948])

HSP 1 Score: 144.436 bits (363), Expect = 1.123e-35
Identity = 122/381 (32.02%), Postives = 166/381 (43.57%), Query Frame = 3
Query:  342 RRCVDMDDT-NVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN---ATCLDIDECVSLKDICGHLKCENTPGFFKCVC-KSGYKMSNEN-VCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTK 1466
            R CV+ + + +  C++G+ +    KKC+DI+EC+     C  N  C N  GS++C     CG GY  +   + C+D+NEC      C  G  C N +GSF CR    +            C  GY  N     CED+DEC       C      CV   G   CE Q       I+ +C DV+EC           +C N  G Y CS IK                  GFK       CEDVDEC+  I  C  +  C N  G Y C C  GYE  +    TC DIDEC ++ ++C + +C NT G F C C  SGY +  +   C+D++EC      C            CFN+ G ++CL   CP  +R  +  S  +
Sbjct:  390 RACVNTEGSYHCECQTGFMYSRVSKKCEDIDECALWTSTCGANFVCVNTDGSFQCHPDKACGDGYILDPAGK-CVDVNECVTHSHPCRPGQACINTVGSFYCRSIVAS------------CARGYHLNADGTHCEDVDECV--LHNVCGSHGS-CVNVEGSYRCECQNGFTFNSISKLCEDVNECRHYSGRLC-AHKCENTEGSYHCSCIK------------------GFKLAENGNNCEDVDECE--INPCSQE--CANVYGSYQCYCRRGYELNDIDGITCEDIDEC-AIPNVCSY-RCINTVGGFNCTCPSSGYTLGPDGRSCQDVDECAAGTHTCSASE-------NCFNIQGGFRCLYFDCPPNFRRATSGSEAE 722          

HSP 2 Score: 132.494 bits (332), Expect = 8.728e-32
Identity = 131/425 (30.82%), Postives = 169/425 (39.76%), Query Frame = 3
Query:  375 TCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKC-IVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPC-------PTNKPH------YWNSGCHQ------------------CKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKC--EGY--------EELNNATKECH-----------------------CKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNAT--CLDIDECVSLKD-ICGHLKCENTPGFFKCVCKSGYKMS-NENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRV 1442
             C  GY        C DINEC    D C  +++C N  GSY C    D C QGY+   +   C D+NEC  S   C  G +C N  GSF C+  C       P NK         W   C                    C+EGY  +   N C D+DEC              CV   G   CE Q      +++  C D+DECA   + C     C N  G + C   K   +GY         ++N      H                       C  G+  N     CEDVDEC  L  VCG+ G C N  G Y C+C  G+ F + +  C D++EC      +C H KCENT G + C C  G+K++ N N CED++EC   P              EC N+ GSY+C    C  GY +
Sbjct:  224 VCRDGY-IQDSTGSCVDINECLTHTDACQPDQFCINSEGSYTCRSTTDDCKQGYQLTADGLRCEDVNECLTSSHNCAHGEICLNTEGSFYCQAACAPGFHFTPENKCRDIDECALWTHNCEANFVCVNTAGSYRCQPKTGCEEGYIQDSAGN-CIDMDECLKGNVCG----SRACVNTEGSYHCECQTGFMYSRVSKKCEDIDECALWTSTCGANFVCVNTDGSFQCHPDKACGDGYILDPAGKCVDVNECVTHSHPCRPGQACINTVGSFYCRSIVASCARGYHLNADGTHCEDVDEC-VLHNVCGSHGSCVNVEGSYRCECQNGFTFNSISKLCEDVNECRHYSGRLCAH-KCENTEGSYHCSCIKGFKLAENGNNCEDVDECEINP-----------CSQECANVYGSYQCY---CRRGYEL 626          

HSP 3 Score: 114.005 bits (284), Expect = 7.483e-26
Identity = 115/391 (29.41%), Postives = 159/391 (40.66%), Query Frame = 3
Query:  420 KDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPP---------------------------------CPTNKPHYW-NSGCHQCKEGYRWNPLINICEDIDEC-TGPYRLQCEPFKEICVRKPGLSTCETQCSGG-TIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNAT--CLDIDECVSLKDICG-HLKCENTPGFFKC----VCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC--LESICPSGYRVLSESS 1457
            KDI+EC      C   + C N  GS+ C  K  CG GY    E   C D++ECA     C++  VC N  GSF C                                    C  ++  Y   S    CK+GY+       CED++EC T  +        EIC+   G   C+  C+ G      N C D+DECA   +NC     C N  G Y C                +  C+ G+ ++   G C D+DEC     VCG++  C N  G Y+C+C  G+ +   +  C DIDEC      CG +  C NT G F+C     C  GY +     C D+NEC      CR  +        C N VGS+ C  + + C  GY + ++ +
Sbjct:  148 KDIDECLTGRHNCGPGQVCLNTDGSFDC--KPRCGTGYVLTAENH-CEDIDECAFESHNCEANFVCLNTAGSFRCERKNVCRDGYIQDSTGSCVDINECLTHTDACQPDQFCINSEGSYTCRSTTDDCKQGYQLTADGLRCEDVNECLTSSHNC---AHGEICLNTEGSFYCQAACAPGFHFTPENKCRDIDECALWTHNCEANFVCVNTAGSYRCQ--------------PKTGCEEGYIQD-SAGNCIDMDECLKG-NVCGSRA-CVNTEGSYHCECQTGFMYSRVSKKCEDIDECALWTSTCGANFVCVNTDGSFQCHPDKACGDGYILDPAGKCVDVNECVTHSHPCRPGQA-------CINTVGSFYCRSIVASCARGYHLNADGT 508          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Medaka
Match: FBLN2 (fibulin-2 [Source:NCBI gene;Acc:101172410])

HSP 1 Score: 143.665 bits (361), Expect = 3.119e-35
Identity = 137/501 (27.35%), Postives = 213/501 (42.51%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECV-SLKDICGHLKCENTPGFFKCVCKS-GYKM-SNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEI-PIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFV 1856
            +TC  G Q       C+DI+EC+Q++  C ++  C N  GS++C  K  C  G+  + +   C+D++EC    + C+    C N +GS+ C      N+          C  GY  +P  + C D++EC      QC    ++CV  PG   CE Q          +C DV+EC          Q C N  G Y                  EC C SGF+ +  +  CEDV+EC  L   C  +  C N  G Y C C  GY  +    TC DIDEC  S+  +C + KC N PG ++C C   GY M SN   C DI+EC      C +          C+N+ GSY+CL   CP  YR +S++   +    +Y  C         Q  P  + Y  +  +++  +P +I  I P    + D+  V +      N  S ++++                 VF+   +    + ++ + +KL  Q     +    +++F+
Sbjct:  750 ITCLPGQQI--NNDVCEDIDECAQRSHNCAVDSECVNTQGSFRCSPKARCAGGFIKDTQG-NCVDIDECGTLTQTCNPRSSCINTVGSYIC------NRRII-------CSRGYHASPNGSRCVDVNECESSLH-QCGE-GQLCVNLPGSYRCECQAGYQYDSFRRMCTDVNECWRYPGRLC-AQTCVNTPGSY------------------ECSCTSGFRLSGDSKNCEDVNEC--LANPCSQE--CANIYGSYQCYCRQGYYLREDGKTCDDIDECSRSIGPLCTY-KCVNVPGSYRCACPEYGYTMSSNGRSCIDIDECAAGVHNCSLADT-------CYNIQGSYRCLSLSCPQNYRKVSDTRCERISCPNYLEC---------QNSPLRITYYYLSFQSNIVIPAQIFRIGPSPAYSGDNVIVTITQGNEENYFSTRKLNAYTG------------AVFLQRQVQGPRDFLITVEMKLWRQGAFTTFQA-RIYVFI 1179          

HSP 2 Score: 106.686 bits (265), Expect = 1.724e-23
Identity = 94/312 (30.13%), Postives = 132/312 (42.31%), Query Frame = 3
Query:  519 CGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTC--ETQCSGGTIK-IANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN--ATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENV-CEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            C  G+    + ++C D+NEC  S   C     C N  GS+ C+                 C  G + N   ++CEDIDEC    R         CV   G   C  + +C+GG IK     C D+DEC      C     C N  G Y C+              +   C  G+  +    +C DV+EC+S +  CG    C N  G Y C+C  GY++ +    C D++EC           C NTPG ++C C SG+++S ++  CED+NEC   P              EC N+ GSY+C    C  GY
Sbjct:  706 CSLGFSLKADGRSCEDVNECLSS-NACLLNERCMNTQGSYVCQRLI-------------TCLPGQQINN--DVCEDIDECA--QRSHNCAVDSECVNTQGSFRCSPKARCAGGFIKDTQGNCVDIDECGTLTQTCNPRSSCINTVGSYICN--------------RRIICSRGYHASPNGSRCVDVNECESSLHQCGEGQLCVNLPGSYRCECQAGYQYDSFRRMCTDVNECWRYPGRLCAQTCVNTPGSYECSCTSGFRLSGDSKNCEDVNECLANP-----------CSQECANIYGSYQCY---CRQGY 971          

HSP 3 Score: 69.707 bits (169), Expect = 6.062e-12
Identity = 59/166 (35.54%), Postives = 68/166 (40.96%), Query Frame = 3
Query:  990 LNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQ----CNPGYEFKNATCLDIDECVSLKDICG-HLKCENTPGFFKCV----CKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLES-ICPSGYRVLSESS 1457
            L     +C C  GF        CEDV+EC S      N+ RC N  G Y CQ    C PG +  N  C DIDEC      C    +C NT G F+C     C  G+    +  C DI+EC      C       N R  C N VGSY C    IC  GY      S
Sbjct:  697 LVAGRPQCSCSLGFSLKADGRSCEDVNECLSSNACLLNE-RCMNTQGSYVCQRLITCLPGQQINNDVCEDIDECAQRSHNCAVDSECVNTQGSFRCSPKARCAGGFIKDTQGNCVDIDECGTLTQTC-------NPRSSCINTVGSYICNRRIICSRGYHASPNGS 854          
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Medaka
Match: FBLN2 (fibulin-2 [Source:NCBI gene;Acc:101172410])

HSP 1 Score: 143.665 bits (361), Expect = 3.119e-35
Identity = 137/501 (27.35%), Postives = 213/501 (42.51%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECV-SLKDICGHLKCENTPGFFKCVCKS-GYKM-SNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEI-PIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFV 1856
            +TC  G Q       C+DI+EC+Q++  C ++  C N  GS++C  K  C  G+  + +   C+D++EC    + C+    C N +GS+ C      N+          C  GY  +P  + C D++EC      QC    ++CV  PG   CE Q          +C DV+EC          Q C N  G Y                  EC C SGF+ +  +  CEDV+EC  L   C  +  C N  G Y C C  GY  +    TC DIDEC  S+  +C + KC N PG ++C C   GY M SN   C DI+EC      C +          C+N+ GSY+CL   CP  YR +S++   +    +Y  C         Q  P  + Y  +  +++  +P +I  I P    + D+  V +      N  S ++++                 VF+   +    + ++ + +KL  Q     +    +++F+
Sbjct:  750 ITCLPGQQI--NNDVCEDIDECAQRSHNCAVDSECVNTQGSFRCSPKARCAGGFIKDTQG-NCVDIDECGTLTQTCNPRSSCINTVGSYIC------NRRII-------CSRGYHASPNGSRCVDVNECESSLH-QCGE-GQLCVNLPGSYRCECQAGYQYDSFRRMCTDVNECWRYPGRLC-AQTCVNTPGSY------------------ECSCTSGFRLSGDSKNCEDVNEC--LANPCSQE--CANIYGSYQCYCRQGYYLREDGKTCDDIDECSRSIGPLCTY-KCVNVPGSYRCACPEYGYTMSSNGRSCIDIDECAAGVHNCSLADT-------CYNIQGSYRCLSLSCPQNYRKVSDTRCERISCPNYLEC---------QNSPLRITYYYLSFQSNIVIPAQIFRIGPSPAYSGDNVIVTITQGNEENYFSTRKLNAYTG------------AVFLQRQVQGPRDFLITVEMKLWRQGAFTTFQA-RIYVFI 1179          

HSP 2 Score: 106.686 bits (265), Expect = 1.724e-23
Identity = 94/312 (30.13%), Postives = 132/312 (42.31%), Query Frame = 3
Query:  519 CGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTC--ETQCSGGTIK-IANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKN--ATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENV-CEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            C  G+    + ++C D+NEC  S   C     C N  GS+ C+                 C  G + N   ++CEDIDEC    R         CV   G   C  + +C+GG IK     C D+DEC      C     C N  G Y C+              +   C  G+  +    +C DV+EC+S +  CG    C N  G Y C+C  GY++ +    C D++EC           C NTPG ++C C SG+++S ++  CED+NEC   P              EC N+ GSY+C    C  GY
Sbjct:  706 CSLGFSLKADGRSCEDVNECLSS-NACLLNERCMNTQGSYVCQRLI-------------TCLPGQQINN--DVCEDIDECA--QRSHNCAVDSECVNTQGSFRCSPKARCAGGFIKDTQGNCVDIDECGTLTQTCNPRSSCINTVGSYICN--------------RRIICSRGYHASPNGSRCVDVNECESSLHQCGEGQLCVNLPGSYRCECQAGYQYDSFRRMCTDVNECWRYPGRLCAQTCVNTPGSYECSCTSGFRLSGDSKNCEDVNECLANP-----------CSQECANIYGSYQCY---CRQGY 971          

HSP 3 Score: 69.707 bits (169), Expect = 6.062e-12
Identity = 59/166 (35.54%), Postives = 68/166 (40.96%), Query Frame = 3
Query:  990 LNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQ----CNPGYEFKNATCLDIDECVSLKDICG-HLKCENTPGFFKCV----CKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLES-ICPSGYRVLSESS 1457
            L     +C C  GF        CEDV+EC S      N+ RC N  G Y CQ    C PG +  N  C DIDEC      C    +C NT G F+C     C  G+    +  C DI+EC      C       N R  C N VGSY C    IC  GY      S
Sbjct:  697 LVAGRPQCSCSLGFSLKADGRSCEDVNECLSSNACLLNE-RCMNTQGSYVCQRLITCLPGQQINNDVCEDIDECAQRSHNCAVDSECVNTQGSFRCSPKARCAGGFIKDTQGNCVDIDECGTLTQTC-------NPRSSCINTVGSYICNRRIICSRGYHASPNGS 854          
BLAST of Latent-transforming growth factor beta-binding protein vs. Planmine SMEST
Match: SMESG000032551.1 (SMESG000032551.1)

HSP 1 Score: 1113.21 bits (2878), Expect = 0.000e+0
Identity = 548/549 (99.82%), Postives = 549/549 (100.00%), Query Frame = 3
Query:  222 RIVASNVILPNNECAKYTEWDPVLKKCQDCQFNKVYNETLRRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVNDGF 1868
            RIVASNVILPNNECAKYTEWDPVLKKCQDCQFNKVYNETLRRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECT+TPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVNDGF
Sbjct:   11 RIVASNVILPNNECAKYTEWDPVLKKCQDCQFNKVYNETLRRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTDTPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVNDGF 559          
BLAST of Latent-transforming growth factor beta-binding protein vs. Planmine SMEST
Match: SMESG000032551.1 (SMESG000032551.1)

HSP 1 Score: 1021.54 bits (2640), Expect = 0.000e+0
Identity = 503/504 (99.80%), Postives = 504/504 (100.00%), Query Frame = 3
Query:  357 MDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVNDGF 1868
            MDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECT+TPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVNDGF
Sbjct:    1 MDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTDTPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFVNDGF 504          

HSP 2 Score: 60.4622 bits (145), Expect = 2.604e-9
Identity = 72/295 (24.41%), Postives = 114/295 (38.64%), Query Frame = 3
Query:  255 NECAKYTEWDPVLKKCQDCQ--------FNKVYNETLRRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKC-------------IVKD-YCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNC-------TDTQRCNNYFGYYTCSEIKC-EGYEELNNATKECHCKSGFKRNLYT 1049
            ++C +   W+P++  C+D            + + E   R   +      C  G   +     C D++EC++  + C   + C N  G Y C               K+ +C  G++ N+ T  C D++EC   +  C +   C+N IG +NC                 QC  GY +      C DIDEC     + C   K  C   PG   C  + SG  +   N+C D++EC +    C        +   C N  G Y C E  C  GY  L+ ++    C+  +    YT
Sbjct:  113 HQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKI--ANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNC-----------------QCNPGYEFKNA--TCLDIDECVSLKDI-CGHLK--CENTPGFFKCVCK-SGYKMSNENVCEDINECTDTPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYT 382          
BLAST of Latent-transforming growth factor beta-binding protein vs. Planmine SMEST
Match: SMESG000032548.1 (SMESG000032548.1)

HSP 1 Score: 191.815 bits (486), Expect = 1.695e-51
Identity = 151/533 (28.33%), Postives = 239/533 (44.84%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADI----CHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNC-RPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTC--ETQCSGGTIK--IANICYDVDECAENKNNCTDTQRCNNYFGYYTC------------------------SEIKCEGYEE--LNNA-TKECHCKSGFKRNLY-TGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENLIYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDITDSIIL-RPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNELHIFV 1856
            C+ G+ F  E + C+DI+EC+         C   + C NLPGSY CI K  C  G         C D++EC Q    C+   +C N   S++C   PC  ++   ++ G   C++GYR N   +IC D+DEC             IC+  PG   C    +C  G  +  + + C DVDEC   +  C     C N  G Y C                         E  C   E   +N A + +C C  GF+ + Y   KC D++EC +  P CG K +C N +G Y C+C  GY       TC DIDEC+     C +  C N PG ++C C  G+    + +C+DI+EC+ + G+C  E    N R+ C NL+G YKC+ S CP GY    E+ +   C+L   +   +    C+   P  + Y  I+I +       I+   +  +      + + VK A N+ + + + + +   L +   D   I V +   +    E++L +++K   Q     +S + +++++
Sbjct:  454 CKDGFYFKKETRSCEDIDECTMNVGWYNGRCKETDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQNQ-DSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGMFRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECLLFRPEESCPDLEARCVNTAGSYKCQCPKGFEWSDYPIKKCTDINECLAANP-CGKKHQCVNTVGSYKCKCFQGYRLSISGDTCEDIDECLLEPRKCLNGICVNVPGRYECKCPPGFAADRKEICQDIDECSTSEGVCSRESDFQNGRL-CINLLGYYKCVNSSCPVGY-TKKETGNGFICELKSESLCESNDADCLNEKPYKISYEFIEISSDIKFRRTISRFNMSHMPMGSSRINLKVKYALNSNTNQSVYVKNVFHLDKDRYDPGNIEVIMKKMINPPVEVLLYLDVKKYHQEMFLGHSESFINLYL 982          

HSP 2 Score: 167.933 bits (424), Expect = 1.661e-43
Identity = 139/466 (29.83%), Postives = 208/466 (44.64%), Query Frame = 3
Query:  228 VASNVILPNNECAKYTEWDPVLKKCQ----DCQFNKVYNETLRRCVDMDDTNVTCESGYQFVFEEKKCKDINECS-----------------------QKA------------------DICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCR-PPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECT---GPYRLQCEPFKEICVRKPGLSTC--ETQCSGGTIKIAN--ICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDEC--DSLIPVCGNKGRCKNEIGRYNC----QCNPGYEFKNAT---CLDIDECVSLKDICGH-LKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            ++     P   C +  +W+P+L  C      C  N + +    +CV +    V C  G+ F    + C DINEC                        QK                   +IC  ++ C+N  GSYKCI    CG G++ + +T  C+D++EC    + C  GM C N+ GS  C    CP N        C +CK+G+ +      CEDIDECT   G Y  +C+   ++C   PG   C  + +C  GT+   N   C D+DEC + K  C   + C N +  Y C    C   ++ + +  +C C+ G+++N     C DVDEC  +    +CG+   C N  G Y C    +C PG  F+++    C D+DEC + +  C   + C N  G +KC+C  GY +++ N C D+NEC     + R E    +    C N  GSYKC    CP G+
Sbjct:  251 ISQTTSSPTVLCDQGKKWEPLLHVCVQLIISCPKNFILHPNTSKCVPVVKPKVPCSKGFLFNQFLEICGDINECETANACANKWEICVNTVGSFRCDCQKGFKHSKLGICEDIDECMNVNICSDDKKCKNNVGSYKCIRSIPCGFGWKEDPDTNDCVDVDECEAFPEICGPGMKCVNIRGSHRCEDDECPINMKRNNKGICSRCKDGFYFKKETRSCEDIDECTMNVGWYNGRCKE-TDVCFNLPGSYDCIPKKKCRPGTVLAQNGIACNDIDECKQMKFRCEPDEICVNTYSSYHCVASPCAPSQQFDYSVGKCMCRDGYRQN-QDSICTDVDECAENGGDNLCGSLYICINHPGSYACIQRAECPPGM-FRSSMYSNCQDVDECETGEGKCPQNMHCVNVVGSYKCMCDRGYILTSNNTCADVNECL----LFRPEESCPDLEARCVNTAGSYKCQ---CPKGF 706          
BLAST of Latent-transforming growth factor beta-binding protein vs. Planmine SMEST
Match: SMESG000021248.1 (SMESG000021248.1)

HSP 1 Score: 133.65 bits (335), Expect = 5.197e-32
Identity = 118/377 (31.30%), Postives = 160/377 (42.44%), Query Frame = 3
Query:  378 CESGYQFVFEEKKCKDINECSQKADIC-HINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNP--------------------GYEF-KNATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNENV-CEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGY 1436
            C SG+    + K C+DINECS+    C   N  C N PGSY C  K  C  G   + +  TC D+NEC +    CDS  +C N  GS+ C                  C+ GY+   + N C DIDEC+    +      + C   PG   CE  C  G   I   CYD+DEC+    NC+ +  C N  G Y                   C C  GF  +  T  C DV+EC +    C     CKN  G Y C C P                    G+ +  +  C+DIDEC S  +      +C NT G + C+C  G+ ++ + + C D++EC    GIC  ++L       C N  G+Y C+E  CP  Y
Sbjct: 3681 CRSGFMLSSDGKSCQDINECSKNISPCSEPNHECINTPGSYMC--KPKCAPGLRRSFDKLTCGDINECVEKPNICDS-QLCINTHGSYYCL-----------------CRHGYK--KMKNSCIDIDECS--LGIAKCGLHQKCRNTPGSFFCENLCYDGYQLINEQCYDLDECSSGTANCSKSSTCTNLPGSY------------------RCECNDGFYTSGST--CIDVNECQTNSSQCIYG--CKNTYGSYECICPPNFIQSRDKKSCLKKHEICKTGFTWTSDRGCIDIDECTSYTNPHSCQYQCINTYGSYHCLCPPGFSLNPKTMKCLDVDECRTNLGICSEKKL-------CINTPGNYSCIEPKCPKSY 4004          

HSP 2 Score: 124.02 bits (310), Expect = 6.828e-29
Identity = 105/392 (26.79%), Postives = 175/392 (44.64%), Query Frame = 3
Query:  336 TLRRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYC-DSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENTPGFFKC--------------------VCKSGYKMSNENVCEDINECTE--TPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRV 1442
            ++   +  DD + +C  G+  +  ++ C+D+NEC + A +   ++ C N    +KC     C  G+  + + ++C D+NEC++++  C +    C N  GS+ C+P               +C  G R +     C DI+EC     + C+   ++C+   G   C   C  G  K+ N C D+DEC+     C   Q+C N  G + C  +  +GY+ +N                   +C D+DEC S    C     C N  G Y C+CN G+    +TC+D++EC +    C +  C+NT G ++C                    +CK+G+  +++  C DI+ECT    P  C         + +C N  GSY CL   CP G+ +
Sbjct: 3625 SVSSLIAEDDDSKSCPPGFTLIKSQRFCEDVNEC-KNAKLHKCDQICENTVPRFKC----NCRSGFMLSSDGKSCQDINECSKNISPCSEPNHECINTPGSYMCKP---------------KCAPGLRRSFDKLTCGDINECVEKPNI-CD--SQLCINTHGSYYC--LCRHGYKKMKNSCIDIDECSLGIAKCGLHQKCRNTPGSFFCENLCYDGYQLINE------------------QCYDLDECSSGTANCSKSSTCTNLPGSYRCECNDGFYTSGSTCIDVNECQTNSSQCIY-GCKNTYGSYECICPPNFIQSRDKKSCLKKHEICKTGFTWTSDRGCIDIDECTSYTNPHSC---------QYQCINTYGSYHCL---CPPGFSL 3960          
BLAST of Latent-transforming growth factor beta-binding protein vs. Planmine SMEST
Match: SMESG000076582.1 (SMESG000076582.1)

HSP 1 Score: 128.257 bits (321), Expect = 2.998e-30
Identity = 124/422 (29.38%), Postives = 171/422 (40.52%), Query Frame = 3
Query:  354 DMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKD-------------------------------------YCGQGYEFNIETQTCIDLNECAQSLKYCDS-GMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLIN-ICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTC----SEIKCEGYEELNNAT----------KECHCKSGFKRNLYTGKCEDVDECDSLIPVC-GNKGRCKNEIGRYNCQCNPGYEFK--NATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNN----RVECFNLVGSYKCLESICPSGY 1436
            D  D +  C     F+ +   CKDI+ECS    +C  N +C+N  GS+ C  K+                                      C +G+  N  T  C D NECA +   CD     C N  GS+ C                  CK G+R +P+ + +C D++EC   +  +C+     C   PG   C   C  G       C D+DEC+ NK        C N  G Y C        C+G    N              +C CK GF+ N+ T  CED+DECD+    C G K +C N  G Y C+C  GY     N  C +I+EC+     CG + +C +T G + C CK+G+   + + C DI+EC            SLNN    R  C N +GS+ C    C  GY
Sbjct: 3184 DFKDDDYGCHCKNGFMGDGIMCKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTCTNINECYPLSPCDNATEECFDKVPGYECRCQKGFMKNTTTGNCDDRNECADTGNLCDRVSTNCNNTFGSYRC-----------------DCKYGFRPSPIDSFVCTDVNECNLVH--ECDKNYAKCTNTPGSYYC--TCDSGYQGDGRNCTDIDECSSNKVCQRPDATCVNLPGSYECRCLDGTPGCDGDNPCNTVQCTKPNEICYLGQCFCKHGFQNNVTTNICEDIDECDTAANDCAGRKAKCANLDGSYECECLYGYRMSSINKICENINECIDNLHQCGENAECIDTDGGYYCQCKTGF-TGHCDECRDIDECA----------FSLNNCDSDRATCENSIGSFTCR---CNEGY 3570          

HSP 2 Score: 102.449 bits (254), Expect = 4.769e-22
Identity = 125/455 (27.47%), Postives = 180/455 (39.56%), Query Frame = 3
Query:  339 LRRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECT----------------GPYRLQCEPF-----------KEIC-----VRKPGLSTCET-------QCSGGTIK------IANICY----DVDECAENKNNCTDTQRCNNYFGYYTCS---------EIKCEGY-----------------EELNN-----ATKECHCKSGFKRNLYTGKCEDVDECDSLIPV---CGNKGRCKNEIGRYNCQCNPGY-EFKNATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNEN--VCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRV 1442
            +  C+   D++ TC+    F      C D++EC+ K D C  N  C N+ GSY C     C    + ++  + C D NEC ++   C     C N  GS+ C                 QC  GY+WN     CEDIDEC                 G  + +C+P             + C     V+ P  S C          C+ G         I ++CY    D+DEC   K+ C     C N  G Y C+         +  CE                   E L+N     A  +CHC +G+ +   T  C + +EC  L PV   C     C +  G Y C+C  G+ +  +  C +I+EC    D C  +  C++    F C CK G+K S+E    CEDI+ECT  P  C     S+     C N  GS++C   +CP G+ +
Sbjct: 4637 VEDCISSKDSSYTCQCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVC----KCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYEC-----------------QCVTGYKWNGT--NCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSCPARDDVKCPTGSYCNMIGNFIYCNCTNGYEDSNQMECIGDVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNEC--LNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECT-NPTSCSSMPHSI-----CMNNPGSFEC---VCPHGFSL 5057          

HSP 3 Score: 102.064 bits (253), Expect = 4.981e-22
Identity = 123/419 (29.36%), Postives = 179/419 (42.72%), Query Frame = 3
Query:  246 LPNNECAKYTEWDPVLKKCQDCQFNKVYNETLRRCVDMDDTNVTCESGYQFVFEE---KKCKDINECSQKADICHI-NEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQS----LKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECT----GPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANI--CYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNK--GRCKNEIGRYNCQCNPGYEFKNA----TCLDIDECVSLKDIC-GHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            LPN +C    E    + +CQ      V N     C D+      C     FV +E   + C++ NEC      C   N  C +  GS+KC+    C  G+  N +   C+D +EC  S    +K+C++G  C N  G F C                  C EG+ +N     C D+DEC+          C+     C+   G   C   C+ G + I N   C D+DEC +  N+C D   CNN  G +                  EC C  G+  +L  GKC D++EC +   +CG +  G C N  G + C+CN GYE         C  ++ECV L   C  + +C +    ++C+CK GY+     +C +INE       C+IE  S +   +C +  GSYKC    C  GY+
Sbjct: 5098 LPNGDCELINECLENIDRCQ------VLNGADSVCYDLP-IGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCV----CKPGFSKNSDGD-CVDYDECEISEQSNMKFCNNGK-CINTAGGFTC-----------------DCPEGFIYNNYD--CIDVDECSLDQVSSLADNCDQVNGHCINTVGGFQC--YCNRGFVMIENSTKCVDIDEC-QFPNSCLDG-LCNNLPGSF------------------ECLCNIGY--DLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKLNITCPSNAQCVDRSNGYECICKDGYQEDQIGICRNINE-------CQIED-SCHYLADCLDTDGSYKC---TCKYGYK 5449          

HSP 4 Score: 101.679 bits (252), Expect = 7.619e-22
Identity = 109/353 (30.88%), Postives = 148/353 (41.93%), Query Frame = 3
Query:  411 KKCKDINECSQKADICHINEYCRNLPGSYKCIVKDY-CGQGYEFNIETQTCIDLNECAQSLKYCD-SGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTG-KCEDVDECD-----SLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLK-CENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVE--CFNLVGSYKCLESICPSGY 1436
            KKC DI+EC  +   CH    C N  G+Y C    Y  G G        TC D NECA     C+ +   CEN+  + N   P            CH C  GY   P   IC + +EC  P    C     IC+   G   C  + SG     +  C +++EC E  +NC+    C +          K +G+         C CK GFK +  T   CED+DEC      S +P       C N  G + C C  G+  +   C DI+EC+ + + CG    C NT   F C C +G +      CE INEC E      I+R  + N  +  C++L   Y C   +CP G+
Sbjct: 4839 KKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDG------KTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAP----------FQCH-CFNGYVKIPGTQICLNKNECLNPVENDCVE-NAICIDTEGSYECRCK-SGFKQLPSGKCENINECEEKSDNCSINSVCQD----------KADGFS--------CQCKPGFKWSDETNLNCEDIDECTNPTSCSSMP----HSICMNNPGSFECVCPHGFSLQGGYCNDINECL-IPNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLE-----NIDRCQVLNGADSVCYDLPIGYAC---VCPDGF 5141          

HSP 5 Score: 98.5969 bits (244), Expect = 6.822e-21
Identity = 129/463 (27.86%), Postives = 190/463 (41.04%), Query Frame = 3
Query:  282 DPVLKKCQD---CQFNKVYNETLRRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHIN-EYCRNLPGSYKCIV--KDYCGQGYEFNIETQTCIDLNECAQSLKY-CDSGMVCENVIGSFNCR-----PPCPTNKPH------------YWNSGCH--------QCKEGYRWNPLINI-CEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCS---------EIKCEGYEE----------LNNATKECH---------CKSGFKRN-LYTGKCEDVDECDSLIPVC-GNKGRCKNEIGRYNCQCNPGY-EFKNATCLDIDEC----VSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLN-NRV--ECFNLVGSYKCLESICPSGYRVLSESS 1457
            D   KKC D   C   K        C + D   V     Y     +  C+D NEC+ +   C++N  YC NL  +   +   + +C  GY     TQ C++ NEC   ++  C    +C +  GS+ CR        P+ K                NS C         QCK G++W+   N+ CEDIDECT P      P   IC+  PG   C   C  G       C D++EC    N+C     C N    + CS            CE   E          LN A   C+         C  GF  + ++   CE+ +EC+  I  C  +   C +  G + C C PG+ +  +  C+D DEC     S    C + KC NT G F C C  G+  +N + C D++EC+    + ++  L+ N ++V   C N VG ++C    C  G+ ++  S+
Sbjct: 4835 DVCYKKCSDIDECVTRKSACHKFAECTNNDGAYVCTCPSYLTGDGKTTCEDQNECALETHTCNLNTSYCENLDNTVNVLAPFQCHCFNGYVKIPGTQICLNKNECLNPVENDCVENAICIDTEGSYECRCKSGFKQLPSGKCENINECEEKSDNCSINSVCQDKADGFSCQCKPGFKWSDETNLNCEDIDECTNPTSCSSMP-HSICMNNPGSFEC--VCPHGFSLQGGYCNDINECLI-PNSCGQNSVCANTVSGFNCSCANGARQLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPDGFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCVCKPGFSKNSDGDCVDYDECEISEQSNMKFCNNGKCINTAGGFTCDCPEGFIYNNYD-CIDVDECS----LDQVSSLADNCDQVNGHCINTVGGFQCY---CNRGFVMIENST 5285          

HSP 6 Score: 94.3597 bits (233), Expect = 1.558e-19
Identity = 99/326 (30.37%), Postives = 125/326 (38.34%), Query Frame = 3
Query:  372 VTCESGYQFVFEEKKCKDINECSQKADIC-HINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECA------QSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLS-TCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHL-KCENTPGFFKCVCKSGYKMSNENVCEDINEC 1322
              CE    F  E   C    EC  K D C      C  L   +KC  K        FN+   TC D NEC        + K   SG  C N  GSF C               C+Q     + N   + C+ ID C       C+   E C+     S TC  QC  G  +I   C DVDECA+  ++C +   CNN  G Y C                   C    K +L    C D +EC     +CG+  +C N  G Y CQC  GY++    C DIDEC      C  L +C N PG  KC C+ G+       C + + C
Sbjct: 4515 AICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKP------GFNMVGNTCQDKNECDPTSPDFAAQKCLASGGGCLNTKGSFVCT--------------CNQ----EQMNENNSSCKPIDSCAMGLD-NCDRKVEDCISSKDSSYTC--QCIEGFQRINGSCVDVDECADKIDSCKNNATCNNMIGSYVC------------------KCPDNLKLDLSKKACTDRNECQENPMICGDLSKCLNTDGSYECQCVTGYKWNGTNCEDIDECAIKTHPCHDLARCSNVPGSCKCKCQPGFTGDGIYSCIETDSC 4795          

HSP 7 Score: 87.4261 bits (215), Expect = 1.953e-17
Identity = 103/353 (29.18%), Postives = 144/353 (40.79%), Query Frame = 3
Query:  387 GYQFVFEEKKCKDINECSQ-KADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQS-LKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNN-----CTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIP-VCGNKGRC--KNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGH--LKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKC 1409
            GY F      C DI+EC+      C   E C N  G Y C+    CG G  +      C+D++EC+ +    C S  +C+N  G+++C                 QC EG+  + L+  C DIDEC   + +       +C+ KPG   CE  C  GT+     C D DEC + K +     C +   C N    YTC                   C+SG+K   +   C     CD  +P  C     C   NE     C+C P ++ +N TC+   EC +  D C      C      FKC CK G+ M   N C+D NEC  T      ++  L +   C N  GS+ C
Sbjct: 4313 GYNF------CNDIDECANDNTHNCSSLEKCVNSNGQYNCV----CGDGAVY--VDDICVDIDECSSNQTNKCSSNAICQNKEGTYSC-----------------QCAEGFYGDGLL--CHDIDECK--FGVANCSENALCINKPGTFACE--CQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPGYTC------------------ECQSGYKGTGWF--CIKQTPCD--VPNACKANQTCTPSNENSLAICECKPDFKLENDTCIPKTECENKTDNCDRETSNCVQLDPGFKCECKPGFNMVG-NTCQDKNECDPTSPDFAAQKC-LASGGGCLNTKGSFVC 4606          

HSP 8 Score: 87.0409 bits (214), Expect = 2.802e-17
Identity = 108/378 (28.57%), Postives = 154/378 (40.74%), Query Frame = 3
Query:  369 NVTCESGYQFVFEEKKCKDINECSQKADICHI----NEYCRNLPGSYKCIVKDYCGQGYEFN-IETQTCIDLNECAQSLKYCD-SGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQ---CEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENK-----NNCTDTQ-RCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLK---CENTPGFFKCVCKSGYKMSNE---NVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            N +C +G +       C+ INEC +  D C +    +  C +LP  Y C+  D    G+  + +  Q C + NEC  ++  C  S   C +  GSF C                  CK G+  N   + C D DEC    +     C   K  C+   G  TC+  C  G I     C DVDEC+ ++     +NC      C N  G +                  +C+C  GF     + KC D+DEC    P     G C N  G + C CN GY+  N  C DI+EC +   ICG      C N  G F+C C  GY+ S     N C+ +NEC +         ++  +  +C +    Y+C   IC  GY+
Sbjct: 5088 NCSCANGAR-QLPNGDCELINECLENIDRCQVLNGADSVCYDLPIGYACVCPD----GFVNDEVFPQVCENQNECEINIHSCQASNSECVDTYGSFKCV-----------------CKPGFSKNSDGD-CVDYDECEISEQSNMKFCNNGK--CINTAGGFTCD--CPEGFIYNNYDCIDVDECSLDQVSSLADNCDQVNGHCINTVGGF------------------QCYCNRGFVMIENSTKCVDIDECQ--FPNSCLDGLCNNLPGSFECLCNIGYDLVNGKCTDINECSNNSQICGPQAAGICINAAGSFQCKCNVGYENSGGKSYNPCQSVNECVKL-------NITCPSNAQCVDRSNGYEC---ICKDGYQ 5408          

HSP 9 Score: 82.0333 bits (201), Expect = 9.373e-16
Identity = 62/182 (34.07%), Postives = 92/182 (50.55%), Query Frame = 3
Query:  909 NCTDTQRCNNYFGYYTCSEIKC--EGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLK--DICGHLKCENTPGFFKCVCKSGY-KMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            NC+   RC    G   C+ I C  + + +  +    CHCK+GF  +     C+D+DEC +   VC +   CKN IG ++C C  G+E    TC +I+EC  L   D       +  PG ++C C+ G+ K +    C+D NEC +T  +C  +R+S N    C N  GSY+C    C  G+R
Sbjct: 3156 NCSVKCRCKGETGQLECTNITCSNDAFCDFKDDDYGCHCKNGFMGDGIM--CKDIDECSNNTSVCDSNAFCKNTIGSFSCSCKEGFEGNGVTCTNINECYPLSPCDNATEECFDKVPG-YECRCQKGFMKNTTTGNCDDRNECADTGNLC--DRVSTN----CNNTFGSYRC---DCKYGFR 3325          

HSP 10 Score: 81.6481 bits (200), Expect = 1.265e-15
Identity = 96/342 (28.07%), Postives = 140/342 (40.94%), Query Frame = 3
Query:  375 TCESGYQFV---FEEKKCKDINECSQKADICHINEYCRNLPGSYKCIVKD-YCGQG-YEFNIETQ-----------TCI-----DLNECAQSLKYCDSGMVC--ENVIGSFNCRPPCPTNKPHYWNSGCHQ--------CKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNN-CTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCENT-------PGFFKCVCKSGYK 1283
             C  G+Q +        C DI+EC   ++ C  N  C+N  GS+KC  KD + G G Y+  I+++           +CI      + EC    ++   G+    +N +   N +  C      + N+ C Q        C +G++ +   N C DIDEC       C    E CV   G   C   C  G + + +IC D+DEC+ N+ N C+    C N  G Y+C                   C  GF  +     C D+DEC   +  C     C N+ G + C+C  G      TC D DEC   K   G  +C+         PG + C C+SGYK
Sbjct: 4173 ACNVGFQRLENALVTDSCTDIDEC-LLSESCATNGECQNTIGSFKCECKDGFIGDGKYDCRIDSKCEKYGGCHEDASCIVNVESSIYECQCHTEFSGDGITSCIKNNLCFVNGKSSC------HENAICEQVNATYRCICPDGFQGDGY-NFCNDIDECANDNTHNCSSL-EKCVNSNGQYNC--VCGDGAVYVDDICVDIDECSSNQTNKCSSNAICQNKEGTYSC------------------QCAEGFYGDGLL--CHDIDECKFGVANCSENALCINKPGTFACECQAGTLGNGTTCGDEDECKKPKGSPGAPECDENAVCKNKDPG-YTCECQSGYK 4482          

HSP 11 Score: 80.1073 bits (196), Expect = 3.887e-15
Identity = 105/357 (29.41%), Postives = 143/357 (40.06%), Query Frame = 3
Query:  429 NECSQKADICHINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFNCRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNA-------TKECHCKSGF--KRNLYTGKCEDVDECDSL--------IPV--------CGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLK-CENTPGFFKCVCKSGY-KMSNENV---CEDINECTETPGICRIERLSLNNRVECFNLVGSYKC 1409
            N  S    IC +N  C      Y C     C  GYE  +  ++C D++EC   +  C     C N  GSF C                  CK GY  N    +CE  + C       C P   IC  K          SG  I  + +C DV+EC + ++ C    +C N  G Y C +     Y +  N        TK   C++G   K +LY   CE +  C+S         +PV        CGN   CK E GR +C C+ GY      C+D+DEC +    C +   C+N  G F C C  G+ ++ N  V   C DI+EC        +   S     EC N +GS+KC
Sbjct: 3905 NSASCLPGICPLNANCEERLFGYIC----KCKPGYE-GVGIKSCRDIDECGGKINNCTINEDCSNTEGSFTC-----------------SCKRGYSRNSSSGLCETNNVCNCGSHGICGP-NYICQCK----------SGYEINPSGMCQDVNEC-QTQSPCHILAQCINTPGSYKC-QCPENFYGDPQNKCFEDKCKTKALQCQAGEVCKLSLYGSVCEKI-SCNSSEILINNECLPVNQVCQNINCGNHAFCKIENGRADCFCDSGYYGDGELCVDVDECSNGDVSCPNNSFCQNKDGSFHCACNVGFQRLENALVTDSCTDIDEC--------LLSESCATNGECQNTIGSFKC 4217          

HSP 12 Score: 71.633 bits (174), Expect = 1.444e-12
Identity = 47/139 (33.81%), Postives = 68/139 (48.92%), Query Frame = 3
Query:  912 CTDTQRCNNYFGYYTCSEIKCEGYEELNNAT----KECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDIC-GHLKCENTPGFFKCVCKSGYKMSNENVCEDI 1313
            C+   RC+          ++C  Y E  N+T     EC CK G++       C D+DEC     VC + G C N++G YNC C  G+      C D +EC S    C  +  C NT G +KC+C++GY+  N ++C  I
Sbjct:  479 CSTKNRCSGTNSVVKDPNVQCHEYGECFNSTASGESECRCKKGYEGR--ADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLNCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYE-GNGSICSQI 614          

HSP 13 Score: 55.8398 bits (133), Expect = 1.143e-7
Identity = 42/118 (35.59%), Postives = 53/118 (44.92%), Query Frame = 3
Query: 1095 CGNKGRCKNEI--GRYNCQCNPGYEFKNATCLDIDECVSLKDICG-HLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            C   G C N    G   C+C  GYE +   C DIDEC     +C  +  C N  G + C+CK+G+  +  N C D NEC      C            C+N  GSYKC   IC +GY 
Sbjct:  499 CHEYGECFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTYNCLCKTGFVGNGLN-CTDFNECESKTANCSA-------YATCYNTFGSYKC---ICQNGYE 605          

HSP 14 Score: 54.6842 bits (130), Expect = 2.314e-7
Identity = 44/134 (32.84%), Postives = 58/134 (43.28%), Query Frame = 3
Query: 1062 DVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYE-------FKNA-TCLDIDECVSLKDICGHLKCENTPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYR 1439
            D +EC +    C     C N    + C C  G++       + N  +C+D DEC  LK       C NTPG F C C  G+  +   VC DINEC+    IC       +   +C N  GSY C    C  G+R
Sbjct: 2651 DFNECSTNFHDCDLHANCTNLDSGFRCDCIKGWQGLGGNEMYSNGRSCIDDDECALLK-CPSTSDCTNTPGSFICNCHVGFVKAAPTVCNDINECSLNSSIC-------DANADCINTYGSYIC---NCKPGFR 2773          

HSP 15 Score: 54.299 bits (129), Expect = 3.724e-7
Identity = 116/455 (25.49%), Postives = 168/455 (36.92%), Query Frame = 3
Query:  369 NVTCESGYQFVFEEKKCKDINECSQKADIC-HINEYCRNLPGSYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSF-------------NCRPP----------CPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICY----DVDECAENKNNCTDTQ------RCNNYFGYYT--CSEIKCE------GYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGY--EFK------------------------NATCLDIDECVSLKDICGHLKCENT-----PGF-------------FKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNLVGSYKCLESICPSGYRVLSESSSTKACQ 1475
            + TC     +  +   C +I+EC      C   +++C N+ G ++C     C  GY+ +    +C+D NEC      CD    C N  GSF             NC P           CP N     NS C  CK GY  +   N C + DEC    +  C+     C+   G   C   C+ G I     C+    D D C + +N CTD         C + F + +  C + +CE          +++ +  C C  G   +  + +C D+DEC+  +  C     C N  G Y+C+C P Y   FK                        N +C  +    S  D  G+L C        PG              + C CK GY+      C DI+EC      C I         +C N  GS+ C    C  GY   S +SS+  C+
Sbjct: 3561 SFTCRCNEGYSGDGSVCSEIDECLLGLHNCSRSHQFCFNVNGGFEC----RCLSGYKSDTNG-SCVDENECRFFDNGCDDNADCINTDGSFLCICRAGYIGSGRNCDPQEGLEECGKLLCPLNA-LCVNSTC-LCKSGYENS--TNQCINTDECES--QTSCD-VNANCIDTHGSFIC--YCNEGYIGDGINCFKKDTDTDAC-QIENYCTDGDCYDGICHCPSGFVFKSNKCFDERCENVCPKNAICSISSGSPVCSCSVGTSLSSDSSQCIDIDECNENVDDCQENSICFNRFGSYDCKCPPNYLDVFKDGKVCMAVPLSQCNQSCPTGQYCNNGSCSCLMGLNSQTDDDGNLNCSKNSASCLPGICPLNANCEERLFGYICKCKPGYEGVGIKSCRDIDECGGKINNCTINE-------DCSNTEGSFTCS---CKRGY---SRNSSSGLCE 3987          

HSP 16 Score: 53.9138 bits (128), Expect = 4.930e-7
Identity = 44/153 (28.76%), Postives = 56/153 (36.60%), Query Frame = 3
Query:  732 NICEDIDECTGPYRLQCEPFKEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNYFGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIPVCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDI 1190
            N C   +       +QC  + E C         E +C  G    A+ C D+DEC+     C+D   C N  G Y                   C CK+GF  N     C D +EC+S    C     C N  G Y C C  GYE   + C  I
Sbjct:  483 NRCSGTNSVVKDPNVQCHEYGE-CFNSTASGESECRCKKGYEGRADNCTDIDECSRGSYVCSDNGDCVNQLGTY------------------NCLCKTGFVGNGL--NCTDFNECESKTANCSAYATCYNTFGSYKCICQNGYEGNGSICSQI 614          
The following BLAST results are available for this feature:
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FBLN14.965e-4127.41fibulin 1 [Source:HGNC Symbol;Acc:HGNC:3600][more]
FBLN15.170e-4127.41fibulin 1 [Source:HGNC Symbol;Acc:HGNC:3600][more]
FBLN11.221e-3930.61fibulin 1 [Source:HGNC Symbol;Acc:HGNC:3600][more]
FBLN11.223e-3927.86fibulin 1 [Source:HGNC Symbol;Acc:HGNC:3600][more]
FBLN19.355e-3931.46fibulin 1 [Source:HGNC Symbol;Acc:HGNC:3600][more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbl-11.849e-3527.89Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
fbl-13.778e-3531.17Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
fbl-15.414e-3426.58Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
fbl-14.368e-3127.18Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
fbl-15.589e-2826.47Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG319999.014e-3326.64gene:FBgn0051999 transcript:FBtr0344870[more]
CG319999.014e-3326.64gene:FBgn0051999 transcript:FBtr0089144[more]
frac5.152e-2826.11gene:FBgn0035798 transcript:FBtr0290277[more]
frac5.152e-2826.11gene:FBgn0035798 transcript:FBtr0301222[more]
frac5.152e-2826.11gene:FBgn0035798 transcript:FBtr0301221[more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX663503.38.330e-4031.11latent-transforming growth factor beta-binding pro... [more]
hmcn23.874e-3928.64hemicentin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9765... [more]
BX663503.36.805e-3931.11latent-transforming growth factor beta-binding pro... [more]
fbln27.650e-3727.72fibulin 2 [Source:ZFIN;Acc:ZDB-GENE-060711-1][more]
hmcn11.145e-3528.39hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322][more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000044417.18.994e-4132.03pep primary_assembly:Xenopus_tropicalis_v9.1:5:166... [more]
ENSXETT00000044357.18.177e-3833.69pep primary_assembly:Xenopus_tropicalis_v9.1:5:166... [more]
ENSXETT00000024069.13.668e-3728.37hemicentin 2 [Source:NCBI gene;Acc:100490941][more]
ENSXETT00000044344.14.702e-3432.38pep primary_assembly:Xenopus_tropicalis_v9.1:5:166... [more]
FBLN26.106e-3227.69fibulin 2 [Source:NCBI gene;Acc:100487324][more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hmcn16.837e-4231.22hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Fbln12.256e-4028.52fibulin 1 [Source:MGI Symbol;Acc:MGI:95487][more]
Hmcn17.115e-3929.84hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Fbln12.530e-3832.60fibulin 1 [Source:MGI Symbol;Acc:MGI:95487][more]
Hmcn23.946e-3727.78hemicentin 2 [Source:MGI Symbol;Acc:MGI:2677838][more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23142|FBLN1_HUMAN5.874e-3927.86Fibulin-1 OS=Homo sapiens OX=9606 GN=FBLN1 PE=1 SV... [more]
sp|Q8MJJ9|FBLN1_CHLAE6.244e-3927.22Fibulin-1 (Fragment) OS=Chlorocebus aethiops OX=95... [more]
sp|D3YXG0|HMCN1_MOUSE4.977e-3829.84Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=... [more]
sp|Q08879|FBLN1_MOUSE1.770e-3732.60Fibulin-1 OS=Mus musculus OX=10090 GN=Fbln1 PE=1 S... [more]
sp|Q14766|LTBP1_HUMAN5.724e-3734.90Latent-transforming growth factor beta-binding pro... [more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NK286.182e-5233.89Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A564Z3237.727e-5228.91Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564Z2L54.830e-5037.14Uncharacterized protein (Fragment) OS=Hymenolepis ... [more]
A0A0X3PA736.382e-5029.54Fibrillin-3 (Fragment) OS=Schistocephalus solidus ... [more]
A0A0V0J9316.442e-5029.10Uncharacterized protein (Fragment) OS=Schistocepha... [more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbln12.301e-3726.65fibulin 1 [Source:NCBI gene;Acc:30240][more]
fbln13.151e-3726.65fibulin 1 [Source:NCBI gene;Acc:30240][more]
fbln14.523e-3726.65fibulin 1 [Source:NCBI gene;Acc:30240][more]
fbln22.033e-3526.94fibulin 2 [Source:ZFIN;Acc:ZDB-GENE-060711-1][more]
ltbp12.428e-3532.11latent transforming growth factor beta binding pro... [more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006555.18.359e-3733.24pep scaffold:Pmarinus_7.0:GL476370:200676:210822:-... [more]
ENSPMAT00000010139.11.202e-3133.17pep scaffold:Pmarinus_7.0:GL476784:79088:131893:1 ... [more]
ENSPMAT00000008854.11.399e-3132.02pep scaffold:Pmarinus_7.0:GL476328:1008604:1022137... [more]
ENSPMAT00000000017.13.078e-3029.72pep scaffold:Pmarinus_7.0:GL477746:39241:65692:1 g... [more]
ENSPMAT00000000328.14.369e-3025.99pep scaffold:Pmarinus_7.0:GL477118:5217:33136:-1 g... [more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO444173.252e-3727.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332955.244e-3532.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387871.111e-3230.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494102.129e-3232.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277422.558e-3232.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FBLN15.967e-3632.28fibulin 1 [Source:NCBI gene;Acc:101160948][more]
FBLN11.045e-3532.28fibulin 1 [Source:NCBI gene;Acc:101160948][more]
FBLN11.123e-3532.02fibulin 1 [Source:NCBI gene;Acc:101160948][more]
FBLN23.119e-3527.35fibulin-2 [Source:NCBI gene;Acc:101172410][more]
FBLN23.119e-3527.35fibulin-2 [Source:NCBI gene;Acc:101172410][more]
back to top
BLAST of Latent-transforming growth factor beta-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032551.10.000e+099.82SMESG000032551.1[more]
SMESG000032551.12.604e-999.80SMESG000032551.1[more]
SMESG000032548.11.695e-5128.33SMESG000032548.1[more]
SMESG000021248.15.197e-3231.30SMESG000021248.1[more]
SMESG000076582.12.998e-3029.38SMESG000076582.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026698 ID=SMED30026698|Name=Latent-transforming growth factor beta-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1878bp
CCGATCTCATAAACTACGGCACCAAGTGATGAATCACACACATGCATGCA
TGCATACACACATACACGTCGACTGGCATTGGAATCTGTGAGTCGCTGTG
TGCCATCCATTGTGACGCTGATTGTGTTGTCAAGTTGTCATTTCATTTAT
GCTCGTTTATTTTCTCAGATTTTTATTTTTTATTTTTACTTATGGATTTT
TTATTTTTCTTGGTCTTTCTACGGATTGTAGCTTCAAATGTAATCTTACC
AAATAATGAATGCGCAAAATACACAGAATGGGACCCAGTACTCAAGAAGT
GTCAAGATTGCCAGTTCAATAAGGTATATAATGAAACCCTGAGAAGGTGC
GTTGACATGGATGACACCAACGTAACTTGCGAATCTGGCTATCAGTTTGT
TTTCGAGGAGAAAAAATGCAAAGATATTAATGAATGTAGCCAGAAGGCCG
ATATCTGCCATATTAATGAGTACTGCCGTAACTTACCAGGTTCATACAAA
TGCATCGTTAAGGACTACTGCGGACAAGGATACGAGTTTAACATTGAAAC
CCAAACTTGCATTGATCTTAATGAATGTGCACAAAGCTTGAAATATTGCG
ATTCCGGAATGGTATGTGAAAATGTAATTGGCAGCTTCAATTGCCGGCCT
CCCTGCCCCACAAACAAGCCACACTATTGGAACTCCGGTTGCCATCAATG
CAAGGAAGGGTACAGGTGGAACCCCCTGATAAATATATGCGAAGATATTG
ACGAATGCACTGGTCCATATAGACTACAATGTGAACCATTCAAGGAAATC
TGCGTCAGGAAGCCCGGATTATCAACCTGTGAAACTCAATGCAGTGGAGG
AACAATTAAAATCGCCAACATTTGCTACGATGTTGATGAATGCGCAGAGA
ACAAAAACAATTGCACCGACACGCAAAGGTGCAATAATTACTTTGGATAC
TATACTTGCTCTGAGATCAAGTGTGAGGGTTATGAGGAATTGAACAACGC
AACCAAAGAATGTCACTGCAAATCTGGTTTCAAACGTAACTTATACACCG
GAAAATGTGAAGACGTTGATGAATGTGACAGCCTGATCCCGGTTTGTGGA
AACAAAGGCAGATGTAAGAATGAGATTGGAAGATATAACTGCCAGTGTAA
TCCAGGATATGAATTCAAAAATGCGACATGCTTGGACATTGATGAATGCG
TTTCATTGAAAGACATTTGCGGCCACTTGAAGTGCGAGAACACTCCTGGA
TTCTTCAAATGCGTTTGCAAGTCTGGATATAAAATGTCTAATGAAAATGT
TTGTGAAGACATCAACGAATGCACTGAGACACCTGGGATATGCAGGATAG
AGAGGCTATCACTGAATAATAGAGTCGAATGTTTCAATCTGGTCGGGTCA
TACAAATGTTTAGAATCCATCTGTCCATCCGGGTATCGGGTACTATCAGA
ATCGTCTAGCACCAAAGCCTGCCAGTTGAGTTATCCGACCTGCAGCTACA
CTAAGAGCGAAAGATGCGTCCAAATCCTGCCAGAAAACCTCATTTATAGA
ATAATTCAGATCAGGAATTCAGAAACATTGCCTTACAAGATCACCGAAAT
CCCGATTGAAGTTCTTAATTACGATCATTACCATGTCAAGGTCAACGTCA
AAAAAGCATTTAATACCAAATCCAAGAAGCAAATGGACATAACCGATTCG
ATAATACTCAGACCAACCGAGGACGAAAAAGCCATAATGGTCTTTATAAT
GACTGATTTGCCGGATTCCGCGGAGATTGTGCTCGACATCAACCTGAAGC
TGAGCTTCCAATCGACGGAACAGATTTATTCATTGAACGAGCTACATATT
TTTGTTAACGACGGCTTTTAAGATGCTC
back to top

protein sequence of SMED30026698-orf-1

>SMED30026698-orf-1 ID=SMED30026698-orf-1|Name=SMED30026698-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=610bp
MHACIHTYTSTGIGICESLCAIHCDADCVVKLSFHLCSFIFSDFYFLFLL
MDFLFFLVFLRIVASNVILPNNECAKYTEWDPVLKKCQDCQFNKVYNETL
RRCVDMDDTNVTCESGYQFVFEEKKCKDINECSQKADICHINEYCRNLPG
SYKCIVKDYCGQGYEFNIETQTCIDLNECAQSLKYCDSGMVCENVIGSFN
CRPPCPTNKPHYWNSGCHQCKEGYRWNPLINICEDIDECTGPYRLQCEPF
KEICVRKPGLSTCETQCSGGTIKIANICYDVDECAENKNNCTDTQRCNNY
FGYYTCSEIKCEGYEELNNATKECHCKSGFKRNLYTGKCEDVDECDSLIP
VCGNKGRCKNEIGRYNCQCNPGYEFKNATCLDIDECVSLKDICGHLKCEN
TPGFFKCVCKSGYKMSNENVCEDINECTETPGICRIERLSLNNRVECFNL
VGSYKCLESICPSGYRVLSESSSTKACQLSYPTCSYTKSERCVQILPENL
IYRIIQIRNSETLPYKITEIPIEVLNYDHYHVKVNVKKAFNTKSKKQMDI
TDSIILRPTEDEKAIMVFIMTDLPDSAEIVLDINLKLSFQSTEQIYSLNE
LHIFVNDGF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0030198extracellular matrix organization
Vocabulary: INTERPRO
TermDefinition
IPR000742EGF-like_dom
IPR001881EGF-like_Ca-bd_dom
IPR013032EGF-like_CS
IPR018097EGF_Ca-bd_CS
IPR000152EGF-type_Asp/Asn_hydroxyl_site
IPR009030Growth_fac_rcpt_cys_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000742EGF-like domainSMARTSM00181egf_5coord: 385..422
e-value: 0.056
score: 22.6
coord: 131..174
e-value: 20.0
score: 12.6
coord: 344..381
e-value: 0.011
score: 24.9
coord: 178..218
e-value: 110.0
score: 4.2
coord: 426..478
e-value: 150.0
score: 2.6
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 341..379
score: 14.964
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 382..422
score: 8.34
IPR001881EGF-like calcium-binding domainSMARTSM00179egfca_6coord: 341..381
e-value: 2.5E-10
score: 50.3
coord: 280..325
e-value: 0.18
score: 7.9
coord: 128..174
e-value: 2.3E-5
score: 33.8
coord: 382..422
e-value: 6.9E-9
score: 45.5
coord: 235..279
e-value: 0.64
score: 3.4
coord: 423..478
e-value: 4.6E-4
score: 28.7
coord: 175..221
e-value: 0.0056
score: 20.0
IPR001881EGF-like calcium-binding domainPFAMPF07645EGF_CAcoord: 128..173
e-value: 3.4E-8
score: 33.6
coord: 280..324
e-value: 0.0011
score: 19.2
coord: 175..208
e-value: 1.4E-6
score: 28.4
coord: 382..421
e-value: 5.1E-8
score: 33.0
coord: 423..475
e-value: 1.6E-7
score: 31.4
coord: 341..378
e-value: 8.4E-8
score: 32.3
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 234..322
e-value: 2.6E-5
score: 26.4
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 332..384
e-value: 1.1E-11
score: 46.6
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 127..175
e-value: 1.3E-9
score: 40.0
coord: 176..233
e-value: 5.1E-6
score: 28.4
coord: 385..423
e-value: 1.0E-10
score: 43.4
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 424..479
e-value: 4.0E-8
score: 35.3
NoneNo IPR availablePANTHERPTHR24039:SF33EGF-CONTAINING FIBULIN-LIKE EXTRACELLULAR MATRIX PROTEIN 1coord: 323..584
NoneNo IPR availablePANTHERPTHR24039FAMILY NOT NAMEDcoord: 323..584
NoneNo IPR availablePANTHERPTHR24039FAMILY NOT NAMEDcoord: 103..309
NoneNo IPR availablePANTHERPTHR24039:SF33EGF-CONTAINING FIBULIN-LIKE EXTRACELLULAR MATRIX PROTEIN 1coord: 103..309
NoneNo IPR availableCDDcd00054EGF_CAcoord: 341..377
e-value: 5.83078E-6
score: 41.4682
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 128..186
NoneNo IPR availableTMHMMTMhelixcoord: 38..60
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 398..409
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 358..369
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 341..367
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 128..154
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 407..421
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 319..430