CXXC-type zinc finger protein isoform 1

Overview
NameCXXC-type zinc finger protein isoform 1
Smed IDSMED30026693
Length (bp)2616
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CXXC-type zinc finger protein isoform 1 (SMED30026693) t-SNE clustered cells

Violin plots show distribution of expression levels for CXXC-type zinc finger protein isoform 1 (SMED30026693) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CXXC-type zinc finger protein isoform 1 (SMED30026693) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CXXC-type zinc finger protein isoform 1 (SMED30026693) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026693

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026693SMESG000074165.1 SmedASXL_015379SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026693SMESG000074165.1 SmedASXL_015379SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymaSMED30026693SMESG000004103.1 SMESG000074165.1 Contig22337uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026693SMESG000004103.1 SMESG000074165.1 Contig22337newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30026693SMESG000074165.1 HO005298ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30026693SMESG000074165.1 HO005298ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026693SMESG000074165.1 HO005298ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30026693SMESG000074165.1 DN310044ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30026693SMESG000074165.1 DN310044ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026693SMESG000074165.1 DN310044ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Human
Match: CXXC1 (CXXC finger protein 1 [Source:HGNC Symbol;Acc:HGNC:24343])

HSP 1 Score: 181.03 bits (458), Expect = 3.087e-47
Identity = 100/292 (34.25%), Postives = 158/292 (54.11%), Query Frame = 2
Query: 1640 QPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
             P+  D+       +C   GC +PA+ SSKYCSD+CG+KLA  R+ + LP RI  W  S  I  +  ++    I+ E ++    L  +++  H+L   I R     +      +D+    G +DD+   + CV+CG  +    AL HME CY K E  T   + +  +  G ++LFCD Y+   + YCKRL  LC +H++D KV    +C  PL   V E +   C   K +CNRH  WE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H PL
Sbjct:  364 HPERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILR-----AKQQAVREDEESNEGDSDDTDLQIFCVSCGHPINPRVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVPADEVCGCPLVRDVFELTGDFCRLPKRQCNRHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPL 650          

HSP 2 Score: 76.2554 bits (186), Expect = 1.548e-13
Identity = 28/64 (43.75%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            G+   ++CICR  D   FMI CD+C EW+HGDC+ IT K ++ I +++C +C++++P L+I+Y+
Sbjct:   22 GENAPIYCICRKPDINCFMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREKDPKLEIRYR 85          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Human
Match: CXXC1 (CXXC finger protein 1 [Source:HGNC Symbol;Acc:HGNC:24343])

HSP 1 Score: 180.644 bits (457), Expect = 3.963e-47
Identity = 100/292 (34.25%), Postives = 158/292 (54.11%), Query Frame = 2
Query: 1640 QPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
             P+  D+       +C   GC +PA+ SSKYCSD+CG+KLA  R+ + LP RI  W  S  I  +  ++    I+ E ++    L  +++  H+L   I R     +      +D+    G +DD+   + CV+CG  +    AL HME CY K E  T   + +  +  G ++LFCD Y+   + YCKRL  LC +H++D KV    +C  PL   V E +   C   K +CNRH  WE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H PL
Sbjct:  360 HPERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILR-----AKQQAVREDEESNEGDSDDTDLQIFCVSCGHPINPRVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVPADEVCGCPLVRDVFELTGDFCRLPKRQCNRHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPL 646          

HSP 2 Score: 76.2554 bits (186), Expect = 1.678e-13
Identity = 28/64 (43.75%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            G+   ++CICR  D   FMI CD+C EW+HGDC+ IT K ++ I +++C +C++++P L+I+Y+
Sbjct:   22 GENAPIYCICRKPDINCFMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREKDPKLEIRYR 85          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Human
Match: CXXC1 (CXXC finger protein 1 [Source:HGNC Symbol;Acc:HGNC:24343])

HSP 1 Score: 180.259 bits (456), Expect = 4.183e-47
Identity = 100/292 (34.25%), Postives = 158/292 (54.11%), Query Frame = 2
Query: 1640 QPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
             P+  D+       +C   GC +PA+ SSKYCSD+CG+KLA  R+ + LP RI  W  S  I  +  ++    I+ E ++    L  +++  H+L   I R     +      +D+    G +DD+   + CV+CG  +    AL HME CY K E  T   + +  +  G ++LFCD Y+   + YCKRL  LC +H++D KV    +C  PL   V E +   C   K +CNRH  WE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H PL
Sbjct:  351 HPERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILR-----AKQQAVREDEESNEGDSDDTDLQIFCVSCGHPINPRVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVPADEVCGCPLVRDVFELTGDFCRLPKRQCNRHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPL 637          

HSP 2 Score: 76.2554 bits (186), Expect = 1.601e-13
Identity = 28/64 (43.75%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            G+   ++CICR  D   FMI CD+C EW+HGDC+ IT K ++ I +++C +C++++P L+I+Y+
Sbjct:   22 GENAPIYCICRKPDINCFMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREKDPKLEIRYR 85          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Human
Match: CXXC1 (CXXC finger protein 1 [Source:HGNC Symbol;Acc:HGNC:24343])

HSP 1 Score: 88.5817 bits (218), Expect = 1.702e-17
Identity = 54/173 (31.21%), Postives = 85/173 (49.13%), Query Frame = 2
Query: 1640 QPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSK 2149
             P+  D+       +C   GC +PA+ SSKYCSD+CG+KLA  R+ + LP RI  W  S  I  +  ++    I+ E ++    L  +++  H+L   I R     +      +D+    G +DD+   + CV+CG  +    AL HME CY K E  T   + +  +  G+K
Sbjct:  360 HPERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILR-----AKQQAVREDEESNEGDSDDTDLQIFCVSCGHPINPRVALRHMERCYAKYESQTSFGSMYPTRIEGAK 527          

HSP 2 Score: 75.8702 bits (185), Expect = 1.933e-13
Identity = 28/64 (43.75%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            G+   ++CICR  D   FMI CD+C EW+HGDC+ IT K ++ I +++C +C++++P L+I+Y+
Sbjct:   22 GENAPIYCICRKPDINCFMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREKDPKLEIRYR 85          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Human
Match: CXXC1 (CXXC finger protein 1 [Source:HGNC Symbol;Acc:HGNC:24343])

HSP 1 Score: 88.5817 bits (218), Expect = 1.895e-17
Identity = 54/173 (31.21%), Postives = 85/173 (49.13%), Query Frame = 2
Query: 1640 QPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSK 2149
             P+  D+       +C   GC +PA+ SSKYCSD+CG+KLA  R+ + LP RI  W  S  I  +  ++    I+ E ++    L  +++  H+L   I R     +      +D+    G +DD+   + CV+CG  +    AL HME CY K E  T   + +  +  G+K
Sbjct:  351 HPERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILR-----AKQQAVREDEESNEGDSDDTDLQIFCVSCGHPINPRVALRHMERCYAKYESQTSFGSMYPTRIEGAK 518          

HSP 2 Score: 75.8702 bits (185), Expect = 1.822e-13
Identity = 28/64 (43.75%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            G+   ++CICR  D   FMI CD+C EW+HGDC+ IT K ++ I +++C +C++++P L+I+Y+
Sbjct:   22 GENAPIYCICRKPDINCFMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREKDPKLEIRYR 85          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Celegans
Match: cfp-1 (CFP1 (CpG-binding protein, CXXC Finger Protein 1) homolog [Source:UniProtKB/TrEMBL;Acc:E3W755])

HSP 1 Score: 80.1073 bits (196), Expect = 2.087e-15
Identity = 75/294 (25.51%), Postives = 123/294 (41.84%), Query Frame = 2
Query: 1676 PTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINW------NNSVSICNQ---KDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIM-VGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFP-----------LSVNEK-------SDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLH 2470
            P +C N  C   +R+ SKYCSDECG +LA  RL + LP+R   +          S+ ++   K  +   E+Q+  E+    +  L+K    L+EFI          +    DD    G       C+ CG+  +   K   H+E C+ + E   + F   E+       +C+ YD+    +CKRL +LC +H K        +C +P            +V+E         ++ C T K  C++H  W    R  I++ +  L  +  EL  E  K           +S+++H
Sbjct:   90 PRQCLNPNCIYESRIDSKYCSDECGKELARMRLTEILPNRCKQYFFEGPSGGPRSLEDEIKPKRAKINREVQKLTESEKNMMAFLNK----LVEFIKTQLKLQPLGTEERYDDNLYEG-------CIVCGLPDIPLLKYTKHIELCWARSEKA-ISFGAPEKN--NDMFYCEKYDSRTNSFCKRLKSLCPEHRKLGDEQHLKVCGYPKKWEDGMIETAKTVSELIEMEDPFGEEGCRTKKDACHKHHKWIPSLRGTIELEQACLFQKMYELCHEMHKLNAHAEWTTNALSIMMH 369          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Celegans
Match: cfp-1 (CFP1 (CpG-binding protein, CXXC Finger Protein 1) homolog [Source:UniProtKB/TrEMBL;Acc:E3W755])

HSP 1 Score: 80.1073 bits (196), Expect = 2.087e-15
Identity = 75/294 (25.51%), Postives = 123/294 (41.84%), Query Frame = 2
Query: 1676 PTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINW------NNSVSICNQ---KDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIM-VGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFP-----------LSVNEK-------SDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLH 2470
            P +C N  C   +R+ SKYCSDECG +LA  RL + LP+R   +          S+ ++   K  +   E+Q+  E+    +  L+K    L+EFI          +    DD    G       C+ CG+  +   K   H+E C+ + E   + F   E+       +C+ YD+    +CKRL +LC +H K        +C +P            +V+E         ++ C T K  C++H  W    R  I++ +  L  +  EL  E  K           +S+++H
Sbjct:   90 PRQCLNPNCIYESRIDSKYCSDECGKELARMRLTEILPNRCKQYFFEGPSGGPRSLEDEIKPKRAKINREVQKLTESEKNMMAFLNK----LVEFIKTQLKLQPLGTEERYDDNLYEG-------CIVCGLPDIPLLKYTKHIELCWARSEKA-ISFGAPEKN--NDMFYCEKYDSRTNSFCKRLKSLCPEHRKLGDEQHLKVCGYPKKWEDGMIETAKTVSELIEMEDPFGEEGCRTKKDACHKHHKWIPSLRGTIELEQACLFQKMYELCHEMHKLNAHAEWTTNALSIMMH 369          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Celegans
Match: cfp-1 (CFP1 (CpG-binding protein, CXXC Finger Protein 1) homolog [Source:UniProtKB/TrEMBL;Acc:E3W755])

HSP 1 Score: 78.5666 bits (192), Expect = 3.728e-15
Identity = 74/294 (25.17%), Postives = 122/294 (41.50%), Query Frame = 2
Query: 1676 PTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINW------NNSVSICNQ---KDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIM-VGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFP-----------LSVNEK-------SDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLH 2470
            P +C N  C   +R+ SKYCSDECG +LA  RL + LP+R   +          S+ ++   K  +   E+Q+  E+    +  L+K    L+EFI          +    DD    G       C+ CG+  +   K   H+E C+ + E      A  +   +    +C+ YD+    +CKRL +LC +H K        +C +P            +V+E         ++ C T K  C++H  W    R  I++ +  L  +  EL  E  K           +S+++H
Sbjct:   39 PRQCLNPNCIYESRIDSKYCSDECGKELARMRLTEILPNRCKQYFFEGPSGGPRSLEDEIKPKRAKINREVQKLTESEKNMMAFLNK----LVEFIKTQLKLQPLGTEERYDDNLYEG-------CIVCGLPDIPLLKYTKHIELCWARSEKAISFGAPEKNNDM---FYCEKYDSRTNSFCKRLKSLCPEHRKLGDEQHLKVCGYPKKWEDGMIETAKTVSELIEMEDPFGEEGCRTKKDACHKHHKWIPSLRGTIELEQACLFQKMYELCHEMHKLNAHAEWTTNALSIMMH 318          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Celegans
Match: cfp-1 (CFP1 (CpG-binding protein, CXXC Finger Protein 1) homolog [Source:UniProtKB/TrEMBL;Acc:E3W755])

HSP 1 Score: 78.5666 bits (192), Expect = 3.728e-15
Identity = 74/294 (25.17%), Postives = 122/294 (41.50%), Query Frame = 2
Query: 1676 PTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINW------NNSVSICNQ---KDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIM-VGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFP-----------LSVNEK-------SDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLH 2470
            P +C N  C   +R+ SKYCSDECG +LA  RL + LP+R   +          S+ ++   K  +   E+Q+  E+    +  L+K    L+EFI          +    DD    G       C+ CG+  +   K   H+E C+ + E      A  +   +    +C+ YD+    +CKRL +LC +H K        +C +P            +V+E         ++ C T K  C++H  W    R  I++ +  L  +  EL  E  K           +S+++H
Sbjct:   39 PRQCLNPNCIYESRIDSKYCSDECGKELARMRLTEILPNRCKQYFFEGPSGGPRSLEDEIKPKRAKINREVQKLTESEKNMMAFLNK----LVEFIKTQLKLQPLGTEERYDDNLYEG-------CIVCGLPDIPLLKYTKHIELCWARSEKAISFGAPEKNNDM---FYCEKYDSRTNSFCKRLKSLCPEHRKLGDEQHLKVCGYPKKWEDGMIETAKTVSELIEMEDPFGEEGCRTKKDACHKHHKWIPSLRGTIELEQACLFQKMYELCHEMHKLNAHAEWTTNALSIMMH 318          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Celegans
Match: cfp-1 (CFP1 (CpG-binding protein, CXXC Finger Protein 1) homolog [Source:UniProtKB/TrEMBL;Acc:E3W755])

HSP 1 Score: 78.5666 bits (192), Expect = 8.254e-15
Identity = 74/294 (25.17%), Postives = 122/294 (41.50%), Query Frame = 2
Query: 1676 PTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINW------NNSVSICNQ---KDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIM-VGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFP-----------LSVNEK-------SDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLH 2470
            P +C N  C   +R+ SKYCSDECG +LA  RL + LP+R   +          S+ ++   K  +   E+Q+  E+    +  L+K    L+EFI          +    DD    G       C+ CG+  +   K   H+E C+ + E      A  +   +    +C+ YD+    +CKRL +LC +H K        +C +P            +V+E         ++ C T K  C++H  W    R  I++ +  L  +  EL  E  K           +S+++H
Sbjct:  158 PRQCLNPNCIYESRIDSKYCSDECGKELARMRLTEILPNRCKQYFFEGPSGGPRSLEDEIKPKRAKINREVQKLTESEKNMMAFLNK----LVEFIKTQLKLQPLGTEERYDDNLYEG-------CIVCGLPDIPLLKYTKHIELCWARSEKAISFGAPEKNNDM---FYCEKYDSRTNSFCKRLKSLCPEHRKLGDEQHLKVCGYPKKWEDGMIETAKTVSELIEMEDPFGEEGCRTKKDACHKHHKWIPSLRGTIELEQACLFQKMYELCHEMHKLNAHAEWTTNALSIMMH 437          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Fly
Match: Cfp1 (gene:FBgn0030121 transcript:FBtr0071327)

HSP 1 Score: 168.703 bits (426), Expect = 2.063e-43
Identity = 88/278 (31.65%), Postives = 151/278 (54.32%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPLKPLL 2506
            +C+   C   AR  SKYCSD+CG  LA +R+ + LP R+  WN + S   ++ R+    I+ +   + + L  L+K   +L   ++R + S   +  ++D        ++ S+ C+TCG  + S  A+ HME C+ K E      + F+ +  G+ +FCDFY+   + YCKRL  LC +H+KD KV+   +C  PL  +V   + + C   K  C +H  WE+I+RA ID+ R R  ++ ++L  ++R  +  +  R  ++ L+LH T +H+ +  L+
Sbjct:  272 QCYGPNCCSHARPQSKYCSDKCGFNLATKRIFQVLPQRLQEWNLTPSRAAEETRKHLDNIRHKQSLVRFALAELEKRSEELNMVVERAKRSSIDTLGSQDT---ADMEDEQSMYCITCGHEIHSRTAIKHMEKCFNKYESQASFGSIFKTRMEGNNMFCDFYNPASKTYCKRLRVLCPEHSKDPKVNDTDVCGSPLVNNVFNPTGEFCRAPKKNCFKHYAWEKIRRAEIDLERVRQWLKMDDLMEQERVMRQQLTSRANLLGLMLHSTYNHEVMDELV 546          

HSP 2 Score: 85.8853 bits (211), Expect = 7.498e-17
Identity = 34/63 (53.97%), Postives = 46/63 (73.02%), Query Frame = 2
Query:  296 QTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            Q  Q +CICRS D  RFMI CD CEEWYHGDC+ IT K+++ I +Y+C +C+K NP L+  ++
Sbjct:   57 QEDQAYCICRSSDCSRFMIGCDGCEEWYHGDCIGITEKEAKHIKQYYCRRCKKENPELQTIFR 119          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Fly
Match: Cfp1 (gene:FBgn0030121 transcript:FBtr0302964)

HSP 1 Score: 168.318 bits (425), Expect = 2.203e-43
Identity = 88/278 (31.65%), Postives = 151/278 (54.32%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPLKPLL 2506
            +C+   C   AR  SKYCSD+CG  LA +R+ + LP R+  WN + S   ++ R+    I+ +   + + L  L+K   +L   ++R + S   +  ++D        ++ S+ C+TCG  + S  A+ HME C+ K E      + F+ +  G+ +FCDFY+   + YCKRL  LC +H+KD KV+   +C  PL  +V   + + C   K  C +H  WE+I+RA ID+ R R  ++ ++L  ++R  +  +  R  ++ L+LH T +H+ +  L+
Sbjct:  252 QCYGPNCCSHARPQSKYCSDKCGFNLATKRIFQVLPQRLQEWNLTPSRAAEETRKHLDNIRHKQSLVRFALAELEKRSEELNMVVERAKRSSIDTLGSQDT---ADMEDEQSMYCITCGHEIHSRTAIKHMEKCFNKYESQASFGSIFKTRMEGNNMFCDFYNPASKTYCKRLRVLCPEHSKDPKVNDTDVCGSPLVNNVFNPTGEFCRAPKKNCFKHYAWEKIRRAEIDLERVRQWLKMDDLMEQERVMRQQLTSRANLLGLMLHSTYNHEVMDELV 526          

HSP 2 Score: 85.5001 bits (210), Expect = 8.227e-17
Identity = 34/63 (53.97%), Postives = 46/63 (73.02%), Query Frame = 2
Query:  296 QTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            Q  Q +CICRS D  RFMI CD CEEWYHGDC+ IT K+++ I +Y+C +C+K NP L+  ++
Sbjct:   37 QEDQAYCICRSSDCSRFMIGCDGCEEWYHGDCIGITEKEAKHIKQYYCRRCKKENPELQTIFR 99          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Fly
Match: CG17440 (gene:FBgn0030120 transcript:FBtr0071328)

HSP 1 Score: 83.5741 bits (205), Expect = 1.115e-16
Identity = 33/58 (56.90%), Postives = 42/58 (72.41%), Query Frame = 2
Query:  311 WCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            +CICRS D  RFMI CD CEEWYHGDC+ IT K +E I  Y+C +C+K NP L+  ++
Sbjct:   40 YCICRSSDCSRFMIGCDGCEEWYHGDCIEITEKDAEHIKNYYCRRCKKENPELQTIFR 97          

HSP 2 Score: 52.373 bits (124), Expect = 1.234e-6
Identity = 24/55 (43.64%), Postives = 33/55 (60.00%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRR 1846
            +CH   C   AR  SKYCSDECG  LA +RL + LP ++  WN + S   ++ R+
Sbjct:  202 QCHGPNCCSHARPQSKYCSDECGSNLAIERLFQILPQQMQEWNITPSRAAEETRK 256          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Fly
Match: CG3347 (gene:FBgn0031513 transcript:FBtr0340587)

HSP 1 Score: 74.7146 bits (182), Expect = 1.811e-13
Identity = 28/62 (45.16%), Postives = 39/62 (62.90%), Query Frame = 2
Query:  299 TKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            +K ++CICR      FMICCD+C EW+HGDC+ +     E    Y+C +C ++NP LK  YK
Sbjct:   19 SKDVYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCTYK 80          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Fly
Match: CG3347 (gene:FBgn0031513 transcript:FBtr0301033)

HSP 1 Score: 74.7146 bits (182), Expect = 1.811e-13
Identity = 28/62 (45.16%), Postives = 39/62 (62.90%), Query Frame = 2
Query:  299 TKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            +K ++CICR      FMICCD+C EW+HGDC+ +     E    Y+C +C ++NP LK  YK
Sbjct:   19 SKDVYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCTYK 80          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Zebrafish
Match: cxxc1a (CXXC finger protein 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1142])

HSP 1 Score: 177.178 bits (448), Expect = 9.873e-47
Identity = 104/300 (34.67%), Postives = 161/300 (53.67%), Query Frame = 2
Query: 1616 RKFVRKPIQPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
            R  VR   + +V+DS       +C   GC + AR +SKYCSD+CG+KLA  R+ + LP RI  W  S  I  ++ ++    I+ E +     L  ++K  H+L   I +      A       D  V   +DD+   + CV+C   V    AL HME CY K E  T   + +  +  G ++LFCD Y+   + YCKRL  LC +H++D K+    +C  PL   V E + + C  +K KCN+H  WE+++RA +D+ R R+  + +EL  ++R  K ++  R G+M+L+LH+TI H P+
Sbjct:  270 RDRVRHSERAEVRDS---GGARQCLGPGCVEAARANSKYCSDDCGMKLAANRICEILPQRIQQWQQSPCIAEEQGKKFLERIRREQQLARMRLTEMEKRFHELEGIIAK------AKQQVVQYDEEVNEGDDDTDLQIFCVSCSHSVNPKVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKIPADEVCGCPLVRDVFEPTGEYCRVSKRKCNKHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVKTAMTNRAGLMALMLHQTIQHDPI 560          

HSP 2 Score: 66.6254 bits (161), Expect = 7.183e-11
Identity = 24/59 (40.68%), Postives = 43/59 (72.88%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            ++C+CR  D   FMI CDSC EW+HGDC+ I+ K ++ I  ++C +C+ ++ +L+++Y+
Sbjct:   25 VYCVCRRPDINCFMIGCDSCSEWFHGDCIKISEKTAKTIRVWYCEKCRSKDETLEVKYR 83          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Zebrafish
Match: cxxc1b (CXXC finger protein 1b [Source:ZFIN;Acc:ZDB-GENE-030728-4])

HSP 1 Score: 170.244 bits (430), Expect = 2.175e-44
Identity = 95/277 (34.30%), Postives = 153/277 (55.23%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQ--CVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
            +C    C +PAR +SKYCS++CG+KLA  R+ + LP RI  W  S  I  ++ ++    I+ E +     L  +++  H+L   I + +         +D+D     + D  +Q  CV+C   V    AL HME CY K E  T   + F  +  G ++LFCD Y+   + YCKRL  LC +H++D KV    +C  PL  +V + +   C  +K KCN+H  WE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H PL
Sbjct:  281 QCLGPNCIEPARPNSKYCSEDCGMKLAANRIYEILPQRIQQWQQSPCIAEEQGKKQLERIRREQQAARMRLAEMERRFHELEGIIAKAKQQLVL----QDEDVNETDSEDTDLQIFCVSCSHPVNPKVALRHMERCYAKYESQTSFGSIFPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVTSDEVCGCPLVRNVFDPTGDYCRVSKRKCNKHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPL 553          

HSP 2 Score: 82.8037 bits (203), Expect = 7.551e-16
Identity = 35/76 (46.05%), Postives = 52/76 (68.42%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKAGIIKKPKDVQP 520
            G+   L+CICR  D   FMI CD+C EW+HG C+N+T K ++ I +++C QC+ R+PSL I+Y+     + KDV+P
Sbjct:   21 GENAPLYCICRKSDINCFMIGCDNCNEWFHGHCINVTEKMAKAIREWYCQQCRARDPSLSIRYRKK--NRDKDVEP 94          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Zebrafish
Match: cxxc1b (CXXC finger protein 1b [Source:ZFIN;Acc:ZDB-GENE-030728-4])

HSP 1 Score: 133.65 bits (335), Expect = 2.679e-32
Identity = 84/279 (30.11%), Postives = 137/279 (49.10%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQ--CVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALCDHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPLKPLL 2506
            +C    C +PAR +SKYCS++CG+KLA  R+ + LP RI  W  S  I  ++ ++    I+ E +     L  +++  H+L   I + +         +D+D     + D  +Q  CV+C   V    AL HME CY K E  T   + F  +  G   F               +A       S+V    +C  PL  +V + +   C  +K KCN+H  WE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H PL   L
Sbjct:  282 QCLGPNCIEPARPNSKYCSEDCGMKLAANRIYEILPQRIQQWQQSPCIAEEQGKKQLERIRREQQAARMRLAEMERRFHELEGIIAKAKQQLVL----QDEDVNETDSEDTDLQIFCVSCSHPVNPKVALRHMERCYAKYESQTSFGSIFPTRIEGKFFF--------------FSA-------SQVTSDEVCGCPLVRNVFDPTGDYCRVSKRKCNKHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPLTTDL 535          

HSP 2 Score: 82.8037 bits (203), Expect = 6.430e-16
Identity = 35/76 (46.05%), Postives = 52/76 (68.42%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKAGIIKKPKDVQP 520
            G+   L+CICR  D   FMI CD+C EW+HG C+N+T K ++ I +++C QC+ R+PSL I+Y+     + KDV+P
Sbjct:   22 GENAPLYCICRKSDINCFMIGCDNCNEWFHGHCINVTEKMAKAIREWYCQQCRARDPSLSIRYRKK--NRDKDVEP 95          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Zebrafish
Match: dido1 (death inducer-obliterator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6117])

HSP 1 Score: 67.0106 bits (162), Expect = 6.524e-11
Identity = 26/51 (50.98%), Postives = 34/51 (66.67%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISK----YFCLQC 448
            L+CICR + ++RFMICCD CEEW+HGDCV I   +  L+ +    Y C  C
Sbjct:  240 LYCICRQKHNKRFMICCDRCEEWFHGDCVGIPEARGRLMERNGEDYVCPNC 290          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Zebrafish
Match: dido1 (death inducer-obliterator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6117])

HSP 1 Score: 67.3958 bits (163), Expect = 8.582e-11
Identity = 26/51 (50.98%), Postives = 34/51 (66.67%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISK----YFCLQC 448
            L+CICR + ++RFMICCD CEEW+HGDCV I   +  L+ +    Y C  C
Sbjct:  240 LYCICRQKHNKRFMICCDRCEEWFHGDCVGIPEARGRLMERNGEDYVCPNC 290          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Xenopus
Match: CXXC1 (CXXC finger protein 1 [Source:NCBI gene;Acc:613066])

HSP 1 Score: 179.489 bits (454), Expect = 1.726e-47
Identity = 97/278 (34.89%), Postives = 153/278 (55.04%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
            +C    C QPAR SSKYCSD+CG+KLA  R+ + LP RI  W  S  +  ++ ++    I+ E +     L  ++   H+L   I +     +      +D+    G +DD+   + CV+CG  +    AL HME CY K E  T   + +  +  G ++LFCD Y+ + + YCKRL  LC +H++D KV    +C  P+   V E +   C   K KCNRH  WE+++RA +D+ R RL  + +EL  ++R  + ++  R G+++L+LH+TI H P+
Sbjct:  261 QCLGPSCVQPARSSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCVAEEQGKKLLERIRREQQQARTKLQNMESRFHELEALISK-----AKQQQIREDEETNEGDSDDTDLQIFCVSCGHPINPKVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPHSKTYCKRLQVLCPEHSRDPKVPADEVCGCPMVKDVFELTGDFCRVPKRKCNRHYCWEKLRRAEVDLERVRLWYKLDELFEQERNVRMAMTNRAGLLALMLHQTIQHDPV 533          

HSP 2 Score: 62.7734 bits (151), Expect = 1.664e-9
Identity = 22/46 (47.83%), Postives = 37/46 (80.43%), Query Frame = 2
Query:  347 MICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            MI CD+C EW+HG C+NIT K ++ I +++C+QC+ ++P L+I+Y+
Sbjct:    1 MIGCDNCNEWFHGHCINITEKMAKAIREWYCVQCRDKHPHLEIKYR 46          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Xenopus
Match: CXXC1 (CXXC finger protein 1 [Source:NCBI gene;Acc:613066])

HSP 1 Score: 179.104 bits (453), Expect = 3.191e-47
Identity = 97/278 (34.89%), Postives = 153/278 (55.04%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
            +C    C QPAR SSKYCSD+CG+KLA  R+ + LP RI  W  S  +  ++ ++    I+ E +     L  ++   H+L   I +     +      +D+    G +DD+   + CV+CG  +    AL HME CY K E  T   + +  +  G ++LFCD Y+ + + YCKRL  LC +H++D KV    +C  P+   V E +   C   K KCNRH  WE+++RA +D+ R RL  + +EL  ++R  + ++  R G+++L+LH+TI H P+
Sbjct:  283 QCLGPSCVQPARSSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCVAEEQGKKLLERIRREQQQARTKLQNMESRFHELEALISK-----AKQQQIREDEETNEGDSDDTDLQIFCVSCGHPINPKVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPHSKTYCKRLQVLCPEHSRDPKVPADEVCGCPMVKDVFELTGDFCRVPKRKCNRHYCWEKLRRAEVDLERVRLWYKLDELFEQERNVRMAMTNRAGLLALMLHQTIQHDPV 555          

HSP 2 Score: 76.6406 bits (187), Expect = 7.986e-14
Identity = 29/64 (45.31%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            G+   ++CICR  D   FMI CD+C EW+HG C+NIT K ++ I +++C+QC+ ++P L+I+Y+
Sbjct:   17 GENAPVYCICRKPDINCFMIGCDNCNEWFHGHCINITEKMAKAIREWYCVQCRDKHPHLEIKYR 80          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Xenopus
Match: CXXC1 (CXXC finger protein 1 [Source:NCBI gene;Acc:613066])

HSP 1 Score: 179.489 bits (454), Expect = 5.359e-47
Identity = 97/278 (34.89%), Postives = 153/278 (55.04%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
            +C    C QPAR SSKYCSD+CG+KLA  R+ + LP RI  W  S  +  ++ ++    I+ E +     L  ++   H+L   I +     +      +D+    G +DD+   + CV+CG  +    AL HME CY K E  T   + +  +  G ++LFCD Y+ + + YCKRL  LC +H++D KV    +C  P+   V E +   C   K KCNRH  WE+++RA +D+ R RL  + +EL  ++R  + ++  R G+++L+LH+TI H P+
Sbjct:  343 QCLGPSCVQPARSSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCVAEEQGKKLLERIRREQQQARTKLQNMESRFHELEALISK-----AKQQQIREDEETNEGDSDDTDLQIFCVSCGHPINPKVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPHSKTYCKRLQVLCPEHSRDPKVPADEVCGCPMVKDVFELTGDFCRVPKRKCNRHYCWEKLRRAEVDLERVRLWYKLDELFEQERNVRMAMTNRAGLLALMLHQTIQHDPV 615          

HSP 2 Score: 77.0258 bits (188), Expect = 7.536e-14
Identity = 29/64 (45.31%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            G+   ++CICR  D   FMI CD+C EW+HG C+NIT K ++ I +++C+QC+ ++P L+I+Y+
Sbjct:    7 GENAPVYCICRKPDINCFMIGCDNCNEWFHGHCINITEKMAKAIREWYCVQCRDKHPHLEIKYR 70          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Xenopus
Match: CXXC1 (CXXC finger protein 1 [Source:NCBI gene;Acc:613066])

HSP 1 Score: 179.104 bits (453), Expect = 6.884e-47
Identity = 97/278 (34.89%), Postives = 153/278 (55.04%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
            +C    C QPAR SSKYCSD+CG+KLA  R+ + LP RI  W  S  +  ++ ++    I+ E +     L  ++   H+L   I +     +      +D+    G +DD+   + CV+CG  +    AL HME CY K E  T   + +  +  G ++LFCD Y+ + + YCKRL  LC +H++D KV    +C  P+   V E +   C   K KCNRH  WE+++RA +D+ R RL  + +EL  ++R  + ++  R G+++L+LH+TI H P+
Sbjct:  340 QCLGPSCVQPARSSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCVAEEQGKKLLERIRREQQQARTKLQNMESRFHELEALISK-----AKQQQIREDEETNEGDSDDTDLQIFCVSCGHPINPKVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPHSKTYCKRLQVLCPEHSRDPKVPADEVCGCPMVKDVFELTGDFCRVPKRKCNRHYCWEKLRRAEVDLERVRLWYKLDELFEQERNVRMAMTNRAGLLALMLHQTIQHDPV 612          

HSP 2 Score: 77.0258 bits (188), Expect = 7.120e-14
Identity = 29/64 (45.31%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            G+   ++CICR  D   FMI CD+C EW+HG C+NIT K ++ I +++C+QC+ ++P L+I+Y+
Sbjct:   17 GENAPVYCICRKPDINCFMIGCDNCNEWFHGHCINITEKMAKAIREWYCVQCRDKHPHLEIKYR 80          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Xenopus
Match: upf3a (UPF3A, regulator of nonsense mediated mRNA decay [Source:Xenbase;Acc:XB-GENE-1005810])

HSP 1 Score: 68.5514 bits (166), Expect = 5.299e-11
Identity = 26/51 (50.98%), Postives = 32/51 (62.75%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISK----YFCLQC 448
            L+CICR   + RFMICCD CEEW+HGDCV I   +  L+ +    Y C  C
Sbjct:  203 LYCICRQRHNNRFMICCDRCEEWFHGDCVGIPEARGRLLERNGEDYICPNC 253          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Mouse
Match: Cxxc1 (CXXC finger 1 (PHD domain) [Source:MGI Symbol;Acc:MGI:1921572])

HSP 1 Score: 174.481 bits (441), Expect = 3.035e-45
Identity = 97/289 (33.56%), Postives = 154/289 (53.29%), Query Frame = 2
Query: 1640 QPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
             P+  D+       +C   GC + A+  SKYCSD+CG+KLA  R+ + LP RI  W  S  I  +  ++    I+ E ++    L  +++  H+L   I   R+   A    E+++       D  + CV+CG  +    AL HME CY K E  T   + +  +  G ++LFCD Y+   + YCKRL  LC +H++D KV    +C  PL   V E +   C   K +CNRH  WE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H PL
Sbjct:  364 HPERADAKDPASLPQCLGPGCVRAAQPGSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAII--LRAKQQAVREDEENNENDSDDTDLQIFCVSCGHPINPRVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVPADEVCGCPLVRDVFELTGDFCRLPKRQCNRHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPL 650          

HSP 2 Score: 75.8702 bits (185), Expect = 1.230e-13
Identity = 28/64 (43.75%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            G+   ++CICR  D   FMI CD+C EW+HGDC+ IT K ++ I +++C +C++++P L+I+Y+
Sbjct:   22 GENAPIYCICRKPDINCFMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREKDPKLEIRYR 85          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Mouse
Match: Dido1 (death inducer-obliterator 1 [Source:MGI Symbol;Acc:MGI:1344352])

HSP 1 Score: 67.781 bits (164), Expect = 5.375e-11
Identity = 26/51 (50.98%), Postives = 33/51 (64.71%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISK----YFCLQC 448
            L+CICR   + RFMICCD CEEW+HGDCV I+  +  L+ +    Y C  C
Sbjct:  266 LYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNC 316          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Mouse
Match: Dido1 (death inducer-obliterator 1 [Source:MGI Symbol;Acc:MGI:1344352])

HSP 1 Score: 67.781 bits (164), Expect = 5.375e-11
Identity = 26/51 (50.98%), Postives = 33/51 (64.71%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISK----YFCLQC 448
            L+CICR   + RFMICCD CEEW+HGDCV I+  +  L+ +    Y C  C
Sbjct:  266 LYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNC 316          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Mouse
Match: Dido1 (death inducer-obliterator 1 [Source:MGI Symbol;Acc:MGI:1344352])

HSP 1 Score: 66.6254 bits (161), Expect = 8.840e-11
Identity = 26/51 (50.98%), Postives = 33/51 (64.71%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISK----YFCLQC 448
            L+CICR   + RFMICCD CEEW+HGDCV I+  +  L+ +    Y C  C
Sbjct:  266 LYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNC 316          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Mouse
Match: Dido1 (death inducer-obliterator 1 [Source:MGI Symbol;Acc:MGI:1344352])

HSP 1 Score: 66.6254 bits (161), Expect = 8.840e-11
Identity = 26/51 (50.98%), Postives = 33/51 (64.71%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISK----YFCLQC 448
            L+CICR   + RFMICCD CEEW+HGDCV I+  +  L+ +    Y C  C
Sbjct:  266 LYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNC 316          
BLAST of CXXC-type zinc finger protein isoform 1 vs. UniProt/SwissProt
Match: sp|Q9P0U4|CXXC1_HUMAN (CXXC-type zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CXXC1 PE=1 SV=2)

HSP 1 Score: 180.644 bits (457), Expect = 1.903e-46
Identity = 100/292 (34.25%), Postives = 158/292 (54.11%), Query Frame = 2
Query: 1640 QPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
             P+  D+       +C   GC +PA+ SSKYCSD+CG+KLA  R+ + LP RI  W  S  I  +  ++    I+ E ++    L  +++  H+L   I R     +      +D+    G +DD+   + CV+CG  +    AL HME CY K E  T   + +  +  G ++LFCD Y+   + YCKRL  LC +H++D KV    +C  PL   V E +   C   K +CNRH  WE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H PL
Sbjct:  360 HPERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILR-----AKQQAVREDEESNEGDSDDTDLQIFCVSCGHPINPRVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVPADEVCGCPLVRDVFELTGDFCRLPKRQCNRHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPL 646          

HSP 2 Score: 76.2554 bits (186), Expect = 8.058e-13
Identity = 28/64 (43.75%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            G+   ++CICR  D   FMI CD+C EW+HGDC+ IT K ++ I +++C +C++++P L+I+Y+
Sbjct:   22 GENAPIYCICRKPDINCFMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREKDPKLEIRYR 85          
BLAST of CXXC-type zinc finger protein isoform 1 vs. UniProt/SwissProt
Match: sp|Q5EA28|CXXC1_BOVIN (CXXC-type zinc finger protein 1 OS=Bos taurus OX=9913 GN=CXXC1 PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 5.429e-45
Identity = 98/292 (33.56%), Postives = 156/292 (53.42%), Query Frame = 2
Query: 1640 QPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
             P+  D+       +C   GC + A+  SKYCSD+CG+KLA  R+ + LP RI  W  S  I  +  ++    I+ E ++    L  +++  H+L   I R     +      +D+    G +DD+   + CV+CG  +    AL HME CY K E  T   + +  +  G ++LFCD Y+   + YCKRL  LC +H++D KV    +C  PL   V E +   C   K +CNRH  WE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H PL
Sbjct:  362 HPERADAKDPASLPQCLGPGCVRAAQPGSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILR-----AKQQAVREDEESNEGDSDDTDLQIFCVSCGHPINPRVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVPADEVCGCPLVRDVFELTGDFCRLPKRQCNRHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPL 648          

HSP 2 Score: 76.2554 bits (186), Expect = 8.011e-13
Identity = 28/64 (43.75%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            G+   ++CICR  D   FMI CD+C EW+HGDC+ IT K ++ I +++C +C++++P L+I+Y+
Sbjct:   22 GENAPIYCICRKPDINCFMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREKDPKLEIRYR 85          
BLAST of CXXC-type zinc finger protein isoform 1 vs. UniProt/SwissProt
Match: sp|Q9CWW7|CXXC1_MOUSE (CXXC-type zinc finger protein 1 OS=Mus musculus OX=10090 GN=Cxxc1 PE=1 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 2.123e-44
Identity = 97/289 (33.56%), Postives = 154/289 (53.29%), Query Frame = 2
Query: 1640 QPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
             P+  D+       +C   GC + A+  SKYCSD+CG+KLA  R+ + LP RI  W  S  I  +  ++    I+ E ++    L  +++  H+L   I   R+   A    E+++       D  + CV+CG  +    AL HME CY K E  T   + +  +  G ++LFCD Y+   + YCKRL  LC +H++D KV    +C  PL   V E +   C   K +CNRH  WE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H PL
Sbjct:  364 HPERADAKDPASLPQCLGPGCVRAAQPGSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAII--LRAKQQAVREDEENNENDSDDTDLQIFCVSCGHPINPRVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVPADEVCGCPLVRDVFELTGDFCRLPKRQCNRHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPL 650          

HSP 2 Score: 75.8702 bits (185), Expect = 8.606e-13
Identity = 28/64 (43.75%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            G+   ++CICR  D   FMI CD+C EW+HGDC+ IT K ++ I +++C +C++++P L+I+Y+
Sbjct:   22 GENAPIYCICRKPDINCFMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREKDPKLEIRYR 85          
BLAST of CXXC-type zinc finger protein isoform 1 vs. UniProt/SwissProt
Match: sp|Q9W352|CXXC1_DROME (CXXC-type zinc finger protein 1 OS=Drosophila melanogaster OX=7227 GN=Cfp1 PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.068e-42
Identity = 88/278 (31.65%), Postives = 151/278 (54.32%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPLKPLL 2506
            +C+   C   AR  SKYCSD+CG  LA +R+ + LP R+  WN + S   ++ R+    I+ +   + + L  L+K   +L   ++R + S   +  ++D        ++ S+ C+TCG  + S  A+ HME C+ K E      + F+ +  G+ +FCDFY+   + YCKRL  LC +H+KD KV+   +C  PL  +V   + + C   K  C +H  WE+I+RA ID+ R R  ++ ++L  ++R  +  +  R  ++ L+LH T +H+ +  L+
Sbjct:  272 QCYGPNCCSHARPQSKYCSDKCGFNLATKRIFQVLPQRLQEWNLTPSRAAEETRKHLDNIRHKQSLVRFALAELEKRSEELNMVVERAKRSSIDTLGSQDT---ADMEDEQSMYCITCGHEIHSRTAIKHMEKCFNKYESQASFGSIFKTRMEGNNMFCDFYNPASKTYCKRLRVLCPEHSKDPKVNDTDVCGSPLVNNVFNPTGEFCRAPKKNCFKHYAWEKIRRAEIDLERVRQWLKMDDLMEQERVMRQQLTSRANLLGLMLHSTYNHEVMDELV 546          

HSP 2 Score: 85.8853 bits (211), Expect = 7.516e-16
Identity = 34/63 (53.97%), Postives = 46/63 (73.02%), Query Frame = 2
Query:  296 QTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            Q  Q +CICRS D  RFMI CD CEEWYHGDC+ IT K+++ I +Y+C +C+K NP L+  ++
Sbjct:   57 QEDQAYCICRSSDCSRFMIGCDGCEEWYHGDCIGITEKEAKHIKQYYCRRCKKENPELQTIFR 119          
BLAST of CXXC-type zinc finger protein isoform 1 vs. UniProt/SwissProt
Match: sp|Q9W0T1|NU301_DROME (Nucleosome-remodeling factor subunit NURF301 OS=Drosophila melanogaster OX=7227 GN=E(bx) PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 1.982e-10
Identity = 47/145 (32.41%), Postives = 75/145 (51.72%), Query Frame = 2
Query:  296 QTKQLWCICRSE-DSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKAGIIKK--PKDVQPISKVDKAFKI-KSEERIIEQIQSKYEKS-NKIRSEEKSLDQLQSKLDKTYKSKFDEKFPDDYQSKFD 715
            +T+QL+C CR   D  +F ICCD C++W+HG CV I   ++E I +Y C +CQ++N +      A  +KK    DV+ +  + K  ++ KS    +E +  K      K+  E   L +++ KL+    +K  E F  D    FD
Sbjct: 2492 ETQQLYCSCRQPYDESQFYICCDKCQDWFHGRCVGILQSEAEFIDEYVCPECQRKNDA-----NAANMKKLTSNDVEELKNLIKQMQLHKSAWPFMEPVDPKEAPDYYKVIKEPMDLKRMEIKLESNTYTKLSE-FIGDMTKIFD 2630          

HSP 2 Score: 60.4622 bits (145), Expect = 8.150e-8
Identity = 22/52 (42.31%), Postives = 38/52 (73.08%), Query Frame = 2
Query:  302 KQLWCICRSE-DSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQK 454
            ++L+CICR+  D  +F + CD C  W+HGDCV+IT + S+ +S++ C+ C++
Sbjct: 2438 EKLYCICRTPYDDTKFYVGCDLCSNWFHGDCVSITEEASKKLSEFICIDCKR 2489          
BLAST of CXXC-type zinc finger protein isoform 1 vs. TrEMBL
Match: A0A0X9ELX4 (CXXC1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 731.865 bits (1888), Expect = 0.000e+0
Identity = 350/351 (99.72%), Postives = 351/351 (100.00%), Query Frame = 2
Query: 1514 FVRKASKISSKVVGAKKKIISSNFNDRCESPYRKRKFVRKPIQPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALCDHNKDSKVDPKTICAFPLSVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPLKPLLPIKIKDRNNKMKKFTKAMCI 2566
            FVRKASKISSKVVGAKKKIISSNFNDRCESPYRKRKFVRKPIQPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALCDHNKDSKVDPKTICAFPLSVNEKSDKVCMTAK+KCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPLKPLLPIKIKDRNNKMKKFTKAMCI
Sbjct:   34 FVRKASKISSKVVGAKKKIISSNFNDRCESPYRKRKFVRKPIQPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALCDHNKDSKVDPKTICAFPLSVNEKSDKVCMTAKIKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPLKPLLPIKIKDRNNKMKKFTKAMCI 384          
BLAST of CXXC-type zinc finger protein isoform 1 vs. TrEMBL
Match: A0A0X3PYA7 (zf-CpG_bind_C domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR102628 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 9.005e-57
Identity = 112/283 (39.58%), Postives = 163/283 (57.60%), Query Frame = 2
Query: 1676 PTECHNIGCSQPA-RLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSV-----SICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWR------SSCSASSNAEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALCDHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETID 2482
            P +C  IGC++PA    +KYCS +CG+ LA +RL  +LP R   W         S  ++ DR    E+++E  TIH+ L  L+  H  L   I R R      +   A ++   D+  V  A  + V CVTC   +    AL HME C+QK+EG T + ++ +EQ  G+ LFCDFYD + + YCKRL A+C+H K+ K  P +IC FPL  +V   +++ C T + KC RH  WER +RA ID+ RYR L R +EL  E+ + + S+ QR G++ +LLH T++
Sbjct:  151 PRQCFGIGCTRPAANPMTKYCSRKCGLALALRRLEHFLPERRSAWYPEQLPVMDSAADRADRARVKEVRKEQYTIHHRLIELENEHQQLNALIARGRDYKFQITDADAMASTAADEAEVDQA--EPVVCVTCSSEINMRHALRHMERCFQKMEGSTFLLSNQKEQSRGTPLFCDFYDTHAKAYCKRLRAVCEHTKEPKYPPDSICGFPLVENVFTSTERFCCTPRNKCTRHFGWERKKRAKIDVERYRQLSRMDELLQEEARLQRSLAQRAGILGMLLHRTVE 431          
BLAST of CXXC-type zinc finger protein isoform 1 vs. TrEMBL
Match: A0A4Z2DGC1 (CXXC-type zinc finger protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_001264 PE=4 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.209e-56
Identity = 116/311 (37.30%), Postives = 172/311 (55.31%), Query Frame = 2
Query: 1673 KPTECHNIGCSQPA-RLSSKYCSDECGIKLAEQRLLKYLPSRIINW------NNSVSICNQK----------DRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQ--------CVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALCDHNKDSKVDPKTICAFPLSVN--EKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPLKPL-LPIKIK 2521
            KP +C   GC++PA R  +KYCS+ECG+KLA +RL   LP     W          S+   K          D+    EI +E   +H  L  L+  H  L   I R +   +  +N    ++ +     D+ Q        CVTC   +    AL HME C+QK+EG T+  A+ +EQ +G+ LFCD YD+  R YCKRL  +C+H K+ K+   T+C  PL  N  E++ + C   + KC +H  WER++RA ID+ RYR L++ +EL  E+++ + +I QRGG++ +LLH+TIDH P KP+ +P K+K
Sbjct:  102 KPRQCFGPGCTRPAARPDTKYCSNECGLKLAMKRLETLLPESFNAWYPELLTKTGKSLSESKKLPDCMATVIDKTRLEEINKEQCVVHNRLVELELEHQKLTTLISRAQERKTGRNN----EQMLAAVAQDAEQVEQMEPIICVTCSAEISMRHALKHMEKCFQKMEGNTVFCANQKEQIMGTPLFCDAYDSQARAYCKRLRVVCEHYKEPKLPADTVCGSPLVQNVFEETGEFCCVPRNKCTKHFGWERLRRAKIDLERYRCLIQMDELMQEEQRLQRAISQRGGILGILLHQTIDHNPQKPVPIPAKLK 408          
BLAST of CXXC-type zinc finger protein isoform 1 vs. TrEMBL
Match: A0A504YPB0 (CpG-binding protein OS=Fasciola gigantica OX=46835 GN=FGIG_02751 PE=4 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.774e-56
Identity = 124/332 (37.35%), Postives = 177/332 (53.31%), Query Frame = 2
Query: 1634 PIQPQ-VQDSIKQFKPTECHNIGCSQPA-RLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQ---------------------EECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSN----------AEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALCDHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPLKPL-LPIKIK 2521
            PI P+ VQ   +  +P +C   GC++ A R  +KYCSDECGIKLA +R+   LP  +   N    +   K   T AEI+                     E+C  +   L  L+  H  L   + R R   + SSN          AE  ++  P      V CVTC   V    AL HME C+QK+EG T+  A+ +EQ +G+ LFCD YD   + YCKRL  +C+H K+ K+ P T+C FP    V  ++   C   + +CNRH+ WER++RA ID+ RYR  +R +EL  E+++ +HSI QRGG++ +LLH T+DH P  P+ +P  +K
Sbjct:  174 PITPRAVQLPDELTRPRQCFGPGCTRAAARPDTKYCSDECGIKLALRRIEILLPESLAAMNCPSKVGKTKQEDTNAEIELERPNFVAEQLDRARLDEIQVEKC-AVRDRLIQLETEHQQLDALVARAREHATPSSNQVTLAEVAKDAEQIEQMEP------VVCVTCASEVSMRHALRHMEKCFQKMEGNTVFCANQKEQIMGTPLFCDAYDTQAKAYCKRLKVVCEHFKEPKLPPDTVCGFPFVHDVFVETGDFCCVPRSRCNRHLGWERLRRAQIDLERYRHFIRMDELLQEEQRVQHSIAQRGGLLGMLLHRTVDHNPSVPVPIPAGLK 498          
BLAST of CXXC-type zinc finger protein isoform 1 vs. TrEMBL
Match: A0A074Z7B9 (zf-CpG_bind_C domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_09037 PE=4 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 7.088e-56
Identity = 116/311 (37.30%), Postives = 173/311 (55.63%), Query Frame = 2
Query: 1673 KPTECHNIGCSQ-PARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQK---------------DRRTQAEIQEECETIHYNLNILDKSHHDLIEFI----DRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALCDHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPLKPL-LPIKIKDRNNK 2536
            +P +C   GC++  AR  +KYCS+ECGI+LA +RL   LP R+    +     N+                DR    EIQ E   +H  L  L+  H  L   I    +R     + ++N  D   ++     + V CVTC   V    AL HME C+QK+EG T+  A+ +EQ +G+ LFCD YD   + YCKRL  +C+H K+ K+ P T+C FPL   V  +S   C   + KC RH+ WER++RA ID+ RYR  ++ ++L  E+++ + +I QRGG++ +LLH+T+DH P KP+ LP +++ R  K
Sbjct:  197 EPRQCFGPGCTRTAARPDTKYCSEECGIRLAFRRLEVLLPERLQRMKSGDPETNETESQKLPEVDYLATRLDRARLEEIQIEKSAVHDKLVQLEMDHQHLTNLIACARERKPDLLAEATNEADQAEQM-----EPVVCVTCASEVSMRHALRHMEKCFQKMEGNTVFCANQKEQVVGTPLFCDAYDTQAKAYCKRLRVVCEHFKEPKLPPDTVCGFPLVRDVFVESGSFCCVPRNKCTRHLGWERLRRASIDIERYRYFIKMDDLLQEEQRIRQAISQRGGLLGVLLHQTVDHNPSKPVPLPPELRARGTK 502          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Cavefish
Match: cxxc1a (CXXC-type zinc finger protein 1 [Source:NCBI gene;Acc:103028330])

HSP 1 Score: 172.17 bits (435), Expect = 4.890e-45
Identity = 95/277 (34.30%), Postives = 151/277 (54.51%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQP 2491
            +C   GC + +R +SKYCSD+CG+KLA  R+ + LP RI  W  S  I  ++ ++    I+ E ++    L  ++K  H+L   I +      A       D  V   +DD+   + CV+C   V    AL HME CY K E  T   + +  +  G ++LFCD Y+   + YCKRL  LC +H++D K+    +C  PL   V E +   C  +K KCN+H  WE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H P
Sbjct:  292 QCLGPGCVESSRPNSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCIAEEQGKKLLERIRREQQSARLRLTEMEKRFHELEGIIAK------AKQQVVQHDEEVNEGDDDTDLQIFCVSCSHPVNPKVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKIPADEVCGCPLVRDVFEPTGDYCRVSKRKCNKHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDP 562          

HSP 2 Score: 68.9366 bits (167), Expect = 1.282e-11
Identity = 28/63 (44.44%), Postives = 44/63 (69.84%), Query Frame = 2
Query:  296 QTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            Q   ++CICR  D   FMI CDSC EW+HGDC+ I+ K ++ I  ++C +C+ ++ SL+I+Y+
Sbjct:   19 QNAPVYCICRKPDINCFMIGCDSCNEWFHGDCIFISEKMAKTIRVWYCERCRSKDGSLEIKYR 81          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Cavefish
Match: cxxc1b (CXXC-type zinc finger protein 1-like [Source:NCBI gene;Acc:103045901])

HSP 1 Score: 170.244 bits (430), Expect = 5.901e-45
Identity = 93/278 (33.45%), Postives = 154/278 (55.40%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
            +C    C + AR +SKYCS++CG+KLA  R+ + LP RI  W  S  +  ++ R+    I+ E +     L  +++  H+L   I +     +   + + D+       +D+   + CV+C   +    AL HME CY K E  T   + F  +  G ++LFCD Y+   + YCKRL  LC +H++D KV    +C  PL  +V E+S + C  +K KCN+H  WE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H PL
Sbjct:  211 QCLGPNCIEAARPNSKYCSEDCGMKLAANRIYEILPQRIQQWQQSPCVAEEQGRKQLERIRREQQAARLRLAEMERRFHELEGIIAK-----AKQQDVQQDEEVSETEGEDTDLQIFCVSCSHPINPKVALRHMERCYAKYESQTSFGSIFPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVPVDEVCGCPLVRNVFEESGEFCRVSKRKCNKHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPL 483          

HSP 2 Score: 77.411 bits (189), Expect = 2.355e-14
Identity = 30/60 (50.00%), Postives = 46/60 (76.67%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKA 487
            L+CICR  D   FMI CDSC EW+HG C+N+T K ++ I +++C +CQ ++PSL+I+Y++
Sbjct:   19 LYCICRKPDINCFMIGCDSCNEWFHGHCINVTEKMAKAIREWYCKRCQDKDPSLEIKYRS 78          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Cavefish
Match: cxxc1b (CXXC-type zinc finger protein 1-like [Source:NCBI gene;Acc:103045901])

HSP 1 Score: 170.244 bits (430), Expect = 1.732e-44
Identity = 105/329 (31.91%), Postives = 173/329 (52.58%), Query Frame = 2
Query: 1559 KKKIISSNFNDRCESPYRKRKFVRKPIQPQV-QDSIKQFKPTECHNIG---------CSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
            +KK I      R E  + K+K  R+  Q Q  +D I+     +   +G         C + AR +SKYCS++CG+KLA  R+ + LP RI  W  S  +  ++ R+    I+ E +     L  +++  H+L   I +     +   + + D+       +D+   + CV+C   +    AL HME CY K E  T   + F  +  G ++LFCD Y+   + YCKRL  LC +H++D KV    +C  PL  +V E+S + C  +K KCN+H  WE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H PL
Sbjct:  229 RKKAIKVKHVKRREKKFDKKKESRRHKQKQKHKDRIRHNSRVDGRQVGDLHQCLGPNCIEAARPNSKYCSEDCGMKLAANRIYEILPQRIQQWQQSPCVAEEQGRKQLERIRREQQAARLRLAEMERRFHELEGIIAK-----AKQQDVQQDEEVSETEGEDTDLQIFCVSCSHPINPKVALRHMERCYAKYESQTSFGSIFPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVPVDEVCGCPLVRNVFEESGEFCRVSKRKCNKHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPL 552          

HSP 2 Score: 77.7962 bits (190), Expect = 2.141e-14
Identity = 30/60 (50.00%), Postives = 46/60 (76.67%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKA 487
            L+CICR  D   FMI CDSC EW+HG C+N+T K ++ I +++C +CQ ++PSL+I+Y++
Sbjct:   26 LYCICRKPDINCFMIGCDSCNEWFHGHCINVTEKMAKAIREWYCKRCQDKDPSLEIKYRS 85          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Cavefish
Match: ENSAMXT00000051089.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:28556024:28566243:-1 gene:ENSAMXG00000029646.1 transcript:ENSAMXT00000051089.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 9.862e-12
Identity = 27/51 (52.94%), Postives = 35/51 (68.63%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISK----YFCLQC 448
            L+CICR + ++RFMICCD CEEW+HGDCV IT  +  L+ +    Y C  C
Sbjct:  322 LYCICRQKHNKRFMICCDRCEEWFHGDCVGITEARGRLMERNGEDYVCPNC 372          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Cavefish
Match: bptf (nucleosome-remodeling factor subunit BPTF-like [Source:NCBI gene;Acc:103026062])

HSP 1 Score: 64.3142 bits (155), Expect = 5.685e-10
Identity = 25/62 (40.32%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  293 GQTKQLWCICRSE-DSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKI 475
            G +++L+CICR+  D  +F I CD C+ WYHG CV I   ++  I +Y C QCQ    ++ +
Sbjct: 2910 GSSEELYCICRTPYDESQFYIGCDRCQNWYHGRCVGILQSEATHIDEYVCPQCQSTEEAMTV 2971          

HSP 2 Score: 58.9214 bits (141), Expect = 2.856e-8
Identity = 21/50 (42.00%), Postives = 34/50 (68.00%), Query Frame = 2
Query:  308 LWCICRSE-DSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQK 454
            L+C+C++  D  +F I CD C  WYHG+CV IT K+++ +  Y C +C++
Sbjct: 2857 LYCVCKTPYDESKFYIGCDLCSNWYHGECVGITEKEAKKMDDYICAECKR 2906          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010200.1 (pep scaffold:Pmarinus_7.0:GL476882:35727:95577:1 gene:ENSPMAG00000009229.1 transcript:ENSPMAT00000010200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 1.714e-8
Identity = 24/57 (42.11%), Postives = 36/57 (63.16%), Query Frame = 2
Query:  293 GQTK---QLWCICRSE-DSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQ 451
            G TK   +L+C+C++  DS +F I CD C+ W+HG CV +   ++E I +Y C  CQ
Sbjct: 2684 GDTKRDTKLYCVCKTPYDSSKFYIGCDRCQNWFHGRCVGVLQSEAEFIDEYVCPNCQ 2740          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010169.1 (pep scaffold:Pmarinus_7.0:GL480870:6363:17942:-1 gene:ENSPMAG00000009200.1 transcript:ENSPMAT00000010169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 4.509e-7
Identity = 29/86 (33.72%), Postives = 42/86 (48.84%), Query Frame = 2
Query:  308 LWCICR-SEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQC----------QKRNPSLKIQYKAGIIKKPKDVQPISKV 532
            ++C+CR   D  RFMI CD C++W+HG CV++    +  I  Y C  C          ++RN S K Q     +   K VQ  S +
Sbjct:    6 VYCVCRLPYDVTRFMIECDVCKDWFHGSCVDVEESAAASIDLYHCPNCVKHHGPSVMRRRRNQSSKQQEAGAGLGGSKPVQTGSSI 91          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010170.1 (pep scaffold:Pmarinus_7.0:GL480870:8586:17942:-1 gene:ENSPMAG00000009200.1 transcript:ENSPMAT00000010170.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 7.245e-7
Identity = 23/58 (39.66%), Postives = 35/58 (60.34%), Query Frame = 2
Query:  308 LWCICR-SEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRN-PSLKI 475
            ++C+CR   D  RFMI CD C++W+HG CV++    +  I  Y C  C K + PS+ +
Sbjct:    6 VYCVCRLPYDVTRFMIECDVCKDWFHGSCVDVEESAAASIDLYHCPNCVKHHGPSVSL 63          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003514.1 (pep scaffold:Pmarinus_7.0:GL476382:909500:922223:-1 gene:ENSPMAG00000003206.1 transcript:ENSPMAT00000003514.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 9.095e-6
Identity = 22/62 (35.48%), Postives = 31/62 (50.00%), Query Frame = 2
Query:  347 MICCDSCEEWYHGDCVNITPKQSELISK----YFCLQCQKRNPSLKIQYKAGIIKKPKDVQP 520
            MICCD CE+W+HGDCV IT  +   + +    Y C  C  +    K   +  + +K   V P
Sbjct:    1 MICCDRCEDWFHGDCVGITVSRGRQMERNGEDYICPNCSSKEDESKQVTEYNLFEKAAVVPP 62          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Yeast
Match: SPP1 (Subunit of COMPASS (Set1C); a complex which methylates histone H3 on lysine 4 and is required in telomeric transcriptional silencing; promotes meiotic DSB formation by interacting with H3K4me3 and Rec107p, a protein required for Spo11p-catalyzed DSB formation located on chromosome axes; interacts with Orc2p; PHD finger domain protein similar to human CGBP, an unmethylated CpG binding protein; relocalizes to cytosol in response to hypoxia [Source:SGD;Acc:S000006059])

HSP 1 Score: 48.9062 bits (115), Expect = 1.992e-6
Identity = 22/69 (31.88%), Postives = 36/69 (52.17%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKAGIIKKPKDV 514
            ++CIC+  D    M+ CD C++W+H  C++I  +  +L+  ++C  CQ           AGI  K KD 
Sbjct:   23 VYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYCQ-----------AGITGKNKDA 80          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Nematostella
Match: EDO32761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU49])

HSP 1 Score: 174.866 bits (442), Expect = 1.005e-46
Identity = 96/276 (34.78%), Postives = 150/276 (54.35%), Query Frame = 2
Query: 1676 PTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQA-----EIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPLSVN--EKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETI 2479
            P  C+  GC   AR  SKYCSDECGI+LA +R+ + LP R+  WN     C   +R  +A     + ++E + +   L+ + ++   +I+  ++  +    S  A+ D        D  + CVTCG+++    AL HME CY K E  TM  + ++       LFCD+++     YCKRL  LC +H K+ K+    +C  PL  N  E++DK+C   K  C +H  W++++RA ID+ R +  ++ EE   ++R   H+  QRGGV+ LLLH+TI
Sbjct:  251 PRHCYGPGCQHAARFGSKYCSDECGIQLAVRRIQEILPKRMKQWNREP--CEADERANEALQKVLKKKQEAQDMLLELDRMSQALESIIQKGEKLTAIPEESQEADMDT-----DTDLQIHCVTCGLLLAPRVALRHMEKCYMKNESLTMFGSAYKS---AGTLFCDYFNAQQGIYCKRLRVLCPEHTKEPKIPQTAVCGCPLVTNVFEETDKICSAPKRTCMKHYRWDKLRRAEIDLQRVQQWIKLEEAFEQERAITHTSAQRGGVLGLLLHQTI 516          

HSP 2 Score: 69.3218 bits (168), Expect = 3.669e-12
Identity = 25/54 (46.30%), Postives = 39/54 (72.22%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSL 469
            ++CICR  +++RFMI CD C+EW+HGDC+ I    +++I K++C  C + NP L
Sbjct:   13 VYCICRQSNTDRFMIGCDDCDEWFHGDCIGILQGDAQMIRKFYCKPCLECNPEL 66          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Nematostella
Match: EDO28835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5C8])

HSP 1 Score: 100.523 bits (249), Expect = 4.129e-25
Identity = 47/116 (40.52%), Postives = 70/116 (60.34%), Query Frame = 2
Query: 2141 GSKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPLSVN--EKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETI 2479
             S LFCD+++     YCKRL  LC +H K+ K+    +C  PL  N  E++DK+C   K  C +H  W++++RA ID+ R +  ++ EE    +R   H+  QRGGV+ LLLH+TI
Sbjct:    1 ASTLFCDYFNAQQGIYCKRLRVLCPEHTKEPKIPQTAVCGCPLVTNVFEETDKICSAPKRTCMKHYRWDKLRRAEIDLQRVQQWIKLEEAFERERAITHTSAQRGGVLGLLLHQTI 116          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Nematostella
Match: EDO47062 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN25])

HSP 1 Score: 61.2326 bits (147), Expect = 3.573e-12
Identity = 24/43 (55.81%), Postives = 30/43 (69.77%), Query Frame = 2
Query:  302 KQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISK 430
            ++LWCICR     RFMICCD C+EW+HGDC+ IT  Q   + K
Sbjct:    3 ERLWCICRKPHGNRFMICCDRCDEWFHGDCIGITMSQGRQMEK 45          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Nematostella
Match: EDO44903 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUH2])

HSP 1 Score: 57.3806 bits (137), Expect = 1.360e-8
Identity = 21/50 (42.00%), Postives = 33/50 (66.00%), Query Frame = 2
Query:  308 LWCICRSE-DSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQK 454
            L+CIC+   D+ RF + CD C  W+HG CVNITP+++  +  + C  C++
Sbjct:  315 LYCICKKPYDATRFYVGCDLCANWFHGACVNITPEEAAAMDHWSCKDCKR 364          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Nematostella
Match: EDO26759 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TB58])

HSP 1 Score: 47.3654 bits (111), Expect = 2.577e-7
Identity = 22/47 (46.81%), Postives = 31/47 (65.96%), Query Frame = 2
Query:  302 KQLWCICRSE-DSERFMICCDSCEEWYHGDCVNITPKQSELISKYFC 439
            ++ +CICR   + E FMI CDSC++W+HG CV I   Q+  I +Y C
Sbjct:    5 QEQYCICRRPYEPEEFMIQCDSCQDWFHGSCVGIEEYQASDIERYHC 51          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Medaka
Match: cxxc1a (CXXC-type zinc finger protein 1 [Source:NCBI gene;Acc:101175046])

HSP 1 Score: 179.489 bits (454), Expect = 2.297e-47
Identity = 96/278 (34.53%), Postives = 153/278 (55.04%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
            +C   GC++ AR  SKYCS++CG+KLA  R+ + LP RI  W  S  +  +  RR    I+ E +     L  ++K  HDL   I     + +     ++ +    G  DD+   + CV+C   V    AL HME CY K E  T   + +  +  G ++LFCD Y+   + YCKRL  LC +H++D K+    +C FPL   V E + + C  +K KCN+H  WE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H P+
Sbjct:  321 QCLGPGCTELARSMSKYCSEDCGMKLAANRIYEILPQRIQQWQQSPCVAEEMGRRQLERIRREQQAARLRLTQMEKRFHDLEGII-----ATAKLQQVQEHEEVTEGDGDDTDLQIFCVSCSHPVNPKVALRHMERCYTKFESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKIQLDEVCGFPLVKDVFEPTGEFCRVSKRKCNKHYCWEKLRRAEVDLERVRVWYKLDELFEQERNLRTAMTNRAGLLALMLHQTIQHDPI 593          

HSP 2 Score: 70.4774 bits (171), Expect = 4.203e-12
Identity = 25/59 (42.37%), Postives = 44/59 (74.58%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            ++C+CR  D   FMI CDSC EW+HGDC+ ++ + ++ I  +FCL C++++ SL+++Y+
Sbjct:   40 VYCVCRRPDINCFMIGCDSCSEWFHGDCIGVSERAAKSIRVWFCLSCREKDSSLELKYR 98          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Medaka
Match: cxxc1b (CXXC finger protein 1 [Source:NCBI gene;Acc:101158437])

HSP 1 Score: 170.629 bits (431), Expect = 1.436e-44
Identity = 93/278 (33.45%), Postives = 153/278 (55.04%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
            +C    C + AR +SKYCS+ECG+KLA  R+ + LP RI  W  S  I  +  ++    I++E +     L  +++  H+L   I +     +     + D+    G  +D+   + CV+C   V    AL HME CY K E  T   + +  +  G ++LFCD Y+   + YCKRL  LC +H++D K+    +C  PL  +V E +   C  +K KCN+H NWE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H P+
Sbjct:  278 QCLGPNCVKGARQNSKYCSEECGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKQLERIRKEQQNARLRLTEMERRFHELEGIIAK-----AKQQAVQQDEEVNEGDGEDTDLQIFCVSCSHPVNPKVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKIPVDEVCGCPLVKNVFELTGDYCRVSKRKCNKHYNWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPV 550          

HSP 2 Score: 79.7221 bits (195), Expect = 5.555e-15
Identity = 29/65 (44.62%), Postives = 49/65 (75.38%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKA 487
            G+   L+CICR  D   FMI CD+C EW+HG C++IT K ++ I +++C++C+ RNP+L+++Y++
Sbjct:   19 GENAPLYCICRKPDINCFMIGCDNCNEWFHGHCISITEKMAKAIQEWYCMRCRDRNPTLEVKYRS 83          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Medaka
Match: cxxc1b (CXXC finger protein 1 [Source:NCBI gene;Acc:101158437])

HSP 1 Score: 170.629 bits (431), Expect = 1.738e-44
Identity = 93/278 (33.45%), Postives = 153/278 (55.04%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
            +C    C + AR +SKYCS+ECG+KLA  R+ + LP RI  W  S  I  +  ++    I++E +     L  +++  H+L   I +     +     + D+    G  +D+   + CV+C   V    AL HME CY K E  T   + +  +  G ++LFCD Y+   + YCKRL  LC +H++D K+    +C  PL  +V E +   C  +K KCN+H NWE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H P+
Sbjct:  285 QCLGPNCVKGARQNSKYCSEECGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKQLERIRKEQQNARLRLTEMERRFHELEGIIAK-----AKQQAVQQDEEVNEGDGEDTDLQIFCVSCSHPVNPKVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKIPVDEVCGCPLVKNVFELTGDYCRVSKRKCNKHYNWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPV 557          

HSP 2 Score: 79.7221 bits (195), Expect = 5.752e-15
Identity = 29/65 (44.62%), Postives = 49/65 (75.38%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKA 487
            G+   L+CICR  D   FMI CD+C EW+HG C++IT K ++ I +++C++C+ RNP+L+++Y++
Sbjct:   21 GENAPLYCICRKPDINCFMIGCDNCNEWFHGHCISITEKMAKAIQEWYCMRCRDRNPTLEVKYRS 85          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Medaka
Match: cxxc1b (CXXC finger protein 1 [Source:NCBI gene;Acc:101158437])

HSP 1 Score: 170.629 bits (431), Expect = 1.934e-44
Identity = 93/278 (33.45%), Postives = 153/278 (55.04%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIG-SKLFCDFYDNNIRGYCKRLAALC-DHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
            +C    C + AR +SKYCS+ECG+KLA  R+ + LP RI  W  S  I  +  ++    I++E +     L  +++  H+L   I +     +     + D+    G  +D+   + CV+C   V    AL HME CY K E  T   + +  +  G ++LFCD Y+   + YCKRL  LC +H++D K+    +C  PL  +V E +   C  +K KCN+H NWE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H P+
Sbjct:  300 QCLGPNCVKGARQNSKYCSEECGMKLAANRIYEILPQRIQQWQQSPCIAEEHGKKQLERIRKEQQNARLRLTEMERRFHELEGIIAK-----AKQQAVQQDEEVNEGDGEDTDLQIFCVSCSHPVNPKVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKIPVDEVCGCPLVKNVFELTGDYCRVSKRKCNKHYNWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPV 572          

HSP 2 Score: 79.7221 bits (195), Expect = 5.854e-15
Identity = 29/65 (44.62%), Postives = 49/65 (75.38%), Query Frame = 2
Query:  293 GQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKA 487
            G+   L+CICR  D   FMI CD+C EW+HG C++IT K ++ I +++C++C+ RNP+L+++Y++
Sbjct:   36 GENAPLYCICRKPDINCFMIGCDNCNEWFHGHCISITEKMAKAIQEWYCMRCRDRNPTLEVKYRS 100          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Medaka
Match: cxxc1a (CXXC-type zinc finger protein 1 [Source:NCBI gene;Acc:101175046])

HSP 1 Score: 145.976 bits (367), Expect = 1.256e-36
Identity = 86/276 (31.16%), Postives = 138/276 (50.00%), Query Frame = 2
Query: 1682 ECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDS---VQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALCDHNKDSKVDPKTICAFPL--SVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPL 2494
            +C   GC++ AR  SKYCS++CG+KLA  R+ + LP RI  W  S  +  +  RR    I+ E +     L  ++K  HDL   I     + +     ++ +    G  DD+   + CV+C   V    AL HME CY K E  T   + +   P  S + CD               LC  ++  +     +C FPL   V E + + C  +K KCN+H  WE+++RA +D+ R R+  + +EL  ++R  + ++  R G+++L+LH+TI H P+
Sbjct:  236 QCLGPGCTELARSMSKYCSEDCGMKLAANRIYEILPQRIQQWQQSPCVAEEMGRRQLERIRREQQAARLRLTQMEKRFHDLEGII-----ATAKLQQVQEHEEVTEGDGDDTDLQIFCVSCSHPVNPKVALRHMERCYTKFESQTSFGSMY---PTLS-ILCD---------------LCPLSRTFQRSKDEVCGFPLVKDVFEPTGEFCRVSKRKCNKHYCWEKLRRAEVDLERVRVWYKLDELFEQERNLRTAMTNRAGLLALMLHQTIQHDPI 487          

HSP 2 Score: 70.4774 bits (171), Expect = 3.508e-12
Identity = 25/59 (42.37%), Postives = 44/59 (74.58%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYK 484
            ++C+CR  D   FMI CDSC EW+HGDC+ ++ + ++ I  +FCL C++++ SL+++Y+
Sbjct:   30 VYCVCRRPDINCFMIGCDSCSEWFHGDCIGVSERAAKSIRVWFCLSCREKDSSLELKYR 88          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Planmine SMEST
Match: SMESG000074165.1 (SMESG000074165.1)

HSP 1 Score: 1345.1 bits (3480), Expect = 0.000e+0
Identity = 780/786 (99.24%), Postives = 781/786 (99.36%), Query Frame = 2
Query:  209 MNKYKYKKPIYAIREXXXXXXXXXXXXGGQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKAGIIKKPKDVQPISKVDKAFKIKSEERIIEQIQSKYEKSNKIRSEEKSLDQLQSKLDKTYKSKFDEKFPDDYQSKFDKAYKTKHDEKIFDTSHSKFEKSYKIKSEEKQAXXXXXXXXXXXXXXXXXXXXXXXPVIKFSQKPVKPGSCGECINCLRKVDCNVCPNCKSKSDKGCLKRVCVMITANVDKAIKAEKLMLTKLPGEFIPTKAPIERKKQILIRDLPFNKTNLXXXXXXXXNENQSKVQKRPHXXXXXXXXXXXXXIKQKAPANSQNFNXXXXXXXXXXXXVNFQKPAKTKCVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVRKASKISSKVVGAKKKIISSNFNDRCESPYRKRKFVRKPIQPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALCDHNKDSKVDPKTICAFPLSVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPLKPLLPIKIKDRNNKMKKFTKAMCI 2566
            MNKYKYKKPIYAIREDSDDSNSNNSNNGGQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKAGIIKKPKDVQPISKVDKAFKIKSEERIIEQ QSKYEKSNKIRSEEKSLDQLQSK DKTYKSKFDEKFPDDYQSKFDKAYKTKHDEKIFDTSHSKFEKSYKIKSEEKQADSTFSSSRSDKSIKIKSEEKITE VIKFSQKPVKPGSCGECINCLRKVDCNVCPNCKSKSDKGCLKRVCVMITANVDKAIKAEKLMLTKLPGEFIPTKAPIERKKQILIRDLPFNKTNLPSSSSPSSNENQSKVQKRPHSPSYSSESNSVASIKQKAPANSQN NKLPLKKIKLDPDVNFQKPAKTKCVESSES ESSEDNMDENEEIEDGDMDNDESDDSDDSNDDDEESSDNFVRKASKISSKVVGAKKKIISSNFNDRCESPYRKRKFVRKPIQPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALCDHNKDSKVDPKTICAFPLSVNEKSDKVCMTAK+KCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPLKPLLPIKIKDRNNKMKKFTKAMCI
Sbjct:    1 MNKYKYKKPIYAIREDSDDSNSNNSNNGGQTKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKAGIIKKPKDVQPISKVDKAFKIKSEERIIEQTQSKYEKSNKIRSEEKSLDQLQSKFDKTYKSKFDEKFPDDYQSKFDKAYKTKHDEKIFDTSHSKFEKSYKIKSEEKQADSTFSSSRSDKSIKIKSEEKITESVIKFSQKPVKPGSCGECINCLRKVDCNVCPNCKSKSDKGCLKRVCVMITANVDKAIKAEKLMLTKLPGEFIPTKAPIERKKQILIRDLPFNKTNLPSSSSPSSNENQSKVQKRPHSPSYSSESNSVASIKQKAPANSQNLNKLPLKKIKLDPDVNFQKPAKTKCVESSESSESSEDNMDENEEIEDGDMDNDESDDSDDSNDDDEESSDNFVRKASKISSKVVGAKKKIISSNFNDRCESPYRKRKFVRKPIQPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALCDHNKDSKVDPKTICAFPLSVNEKSDKVCMTAKIKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPLKPLLPIKIKDRNNKMKKFTKAMCI 786          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Planmine SMEST
Match: SMESG000004468.1 (SMESG000004468.1)

HSP 1 Score: 300.827 bits (769), Expect = 6.931e-89
Identity = 149/302 (49.34%), Postives = 203/302 (67.22%), Query Frame = 2
Query: 1610 RKRKFVRKPIQPQVQDSIKQFKPTECHNIGCSQPARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAEIQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGANDDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFCDFYDNNIRGYCKRLAALCDHNKDS---KVDPKTICAFPLSVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPLKPLL 2506
            R RK  + P+Q +  +  K+F    C NIGC       SKYCS+ECGI+ A++ L K LP RI  W+ + S  ++KD + + EI +EC  I   L + D+ +  L     ++R S S +S+ ++D+ R    N   V+CVTCG      KA++HM+ C+QKIE  TM+FAD++EQ +GSKLFCDFYD ++ GYCKRL ALCDHNKD    KVDP+ IC +PL+ N +S+K+C+TAKV+C  HVNWERIQRAVIDM RYRLLV+ EEL+ E+   + ++  R  VM+LLLH TIDHQP +P+L
Sbjct:  530 RGRKPRKLPLQSEQINRQKEFTLEPCRNIGCEYLRDFGSKYCSNECGIQFAQRILEKILPERIKEWDRTESYADRKDLQRKTEINKECLRIQEKLILHDRENAKLARLT-QYRRSISNASDYQNDEGRRTTNNSAEVRCVTCGDFAAVGKAMSHMQICFQKIENRTMIFADYKEQLMGSKLFCDFYDPSVEGYCKRLDALCDHNKDDCAIKVDPEIICGYPLTENNESNKICLTAKVECVTHVNWERIQRAVIDMKRYRLLVQMEELRNEEMIIERNLFHRRNVMNLLLHRTIDHQPNRPML 830          

HSP 2 Score: 177.178 bits (448), Expect = 1.146e-45
Identity = 116/292 (39.73%), Postives = 166/292 (56.85%), Query Frame = 2
Query:  299 TKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKAGIIKKPKDVQP--ISK-----------VDKAFKIKSEERIIEQIQSKY--EKSNKIRSEEKSLD----QLQSKLDKTYKSKFDEKFPDDYQS------KFDKAYKTKHDEKIFDTSHSKFEKSYKIKSEEKQAXXXXXXXXXXXXXXXXXXXXXXXPVIKFSQKPVKPGSCGECINCLRKVDCNVCPNCKSK-SDKGCLKRVCVMITANVDKAIKAEKLMLTKLPGEFI 1096
            TKQLWCICRS D  RFMICCD CEEWYHGDC+NITPK++E I KY+C QC+KR P+LK  YK+G   +    Q   I+K                K++SE++  + I+ K+  E +N+  S EK  +    +++ K +     + D KF +  +       K +KA  TK D K  +   +K + + K+ + + +  +T  S++     KI + E   E  +K  + P K   C +C+NCLRK+DC  C NCK+K   +GCLKR+CV +    +  +K EKL LTKLPGEFI
Sbjct:   32 TKQLWCICRSSDGSRFMICCDKCEEWYHGDCINITPKEAEHILKYYCAQCEKREPTLKSVYKSGAGMRQTTAQSGQITKGQSETIFLKTGASDKTKLESEKKNHKSIEKKFKSEVTNRPNSIEKPQNPISKEVRIKTESVLSIRPDNKFIETLEMKSHKPVKSEKAQSTKPDNKFIEMLENKTKTTEKVLTAKDRQQATKDSTKLKIQTKINTHENPEETNVKLKKDPRK---CMDCVNCLRKLDCGTCINCKTKIISRGCLKRICVKLKKKPEITVKQEKLTLTKLPGEFI 320          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Planmine SMEST
Match: SMESG000004468.1 (SMESG000004468.1)

HSP 1 Score: 123.635 bits (309), Expect = 2.387e-30
Identity = 56/92 (60.87%), Postives = 73/92 (79.35%), Query Frame = 2
Query: 2231 KVDPKTICAFPLSVNEKSDKVCMTAKVKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMSLLLHETIDHQPLKPLL 2506
            KVDP+ IC +PL+ N +S+K+C+TAKV+C  HVNWERIQRAVIDM RYRLLV+ EEL+ E+   + ++  R  VM+LLLH TIDHQP +P+L
Sbjct:  257 KVDPEIICGYPLTENNESNKICLTAKVECVTHVNWERIQRAVIDMKRYRLLVQMEELRNEEMIIERNLFHRRNVMNLLLHRTIDHQPNRPML 348          

HSP 2 Score: 118.242 bits (295), Expect = 1.590e-28
Identity = 47/64 (73.44%), Postives = 54/64 (84.38%), Query Frame = 2
Query:  299 TKQLWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKAG 490
            TKQLWCICRS D  RFMICCD CEEWYHGDC+NITPK++E I KY+C QC+KR P+LK  YK+G
Sbjct:   32 TKQLWCICRSSDGSRFMICCDKCEEWYHGDCINITPKEAEHILKYYCAQCEKREPTLKSVYKSG 95          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Planmine SMEST
Match: SMESG000025408.1 (SMESG000025408.1)

HSP 1 Score: 101.679 bits (252), Expect = 7.152e-22
Identity = 40/67 (59.70%), Postives = 51/67 (76.12%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKAGIIKKPK 508
            L+CICRS D  RFMI CD+CEEWYHGDC+N+TPKQ+  I ++FC  C  RNPSL+I+YK     +P+
Sbjct:   25 LYCICRSSDGTRFMIACDNCEEWYHGDCINVTPKQANNIKRFFCHLCIGRNPSLEIEYKTIKENRPR 91          
BLAST of CXXC-type zinc finger protein isoform 1 vs. Planmine SMEST
Match: SMESG000025408.1 (SMESG000025408.1)

HSP 1 Score: 101.679 bits (252), Expect = 7.629e-22
Identity = 40/67 (59.70%), Postives = 51/67 (76.12%), Query Frame = 2
Query:  308 LWCICRSEDSERFMICCDSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKAGIIKKPK 508
            L+CICRS D  RFMI CD+CEEWYHGDC+N+TPKQ+  I ++FC  C  RNPSL+I+YK     +P+
Sbjct:   25 LYCICRSSDGTRFMIACDNCEEWYHGDCINVTPKQANNIKRFFCHLCIGRNPSLEIEYKTIKENRPR 91          
The following BLAST results are available for this feature:
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CXXC13.087e-4734.25CXXC finger protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
CXXC13.963e-4734.25CXXC finger protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
CXXC14.183e-4734.25CXXC finger protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
CXXC11.702e-1731.21CXXC finger protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
CXXC11.895e-1731.21CXXC finger protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cfp-12.087e-1525.51CFP1 (CpG-binding protein, CXXC Finger Protein 1) ... [more]
cfp-12.087e-1525.51CFP1 (CpG-binding protein, CXXC Finger Protein 1) ... [more]
cfp-13.728e-1525.17CFP1 (CpG-binding protein, CXXC Finger Protein 1) ... [more]
cfp-13.728e-1525.17CFP1 (CpG-binding protein, CXXC Finger Protein 1) ... [more]
cfp-18.254e-1525.17CFP1 (CpG-binding protein, CXXC Finger Protein 1) ... [more]
back to top
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cfp12.063e-4331.65gene:FBgn0030121 transcript:FBtr0071327[more]
Cfp12.203e-4331.65gene:FBgn0030121 transcript:FBtr0302964[more]
CG174401.115e-1656.90gene:FBgn0030120 transcript:FBtr0071328[more]
CG33471.811e-1345.16gene:FBgn0031513 transcript:FBtr0340587[more]
CG33471.811e-1345.16gene:FBgn0031513 transcript:FBtr0301033[more]
back to top
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cxxc1a9.873e-4734.67CXXC finger protein 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
cxxc1b2.175e-4434.30CXXC finger protein 1b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
cxxc1b2.679e-3230.11CXXC finger protein 1b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
dido16.524e-1150.98death inducer-obliterator 1 [Source:ZFIN;Acc:ZDB-G... [more]
dido18.582e-1150.98death inducer-obliterator 1 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CXXC11.726e-4734.89CXXC finger protein 1 [Source:NCBI gene;Acc:613066... [more]
CXXC13.191e-4734.89CXXC finger protein 1 [Source:NCBI gene;Acc:613066... [more]
CXXC15.359e-4734.89CXXC finger protein 1 [Source:NCBI gene;Acc:613066... [more]
CXXC16.884e-4734.89CXXC finger protein 1 [Source:NCBI gene;Acc:613066... [more]
upf3a5.299e-1150.98UPF3A, regulator of nonsense mediated mRNA decay [... [more]
back to top
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cxxc13.035e-4533.56CXXC finger 1 (PHD domain) [Source:MGI Symbol;Acc:... [more]
Dido15.375e-1150.98death inducer-obliterator 1 [Source:MGI Symbol;Acc... [more]
Dido15.375e-1150.98death inducer-obliterator 1 [Source:MGI Symbol;Acc... [more]
Dido18.840e-1150.98death inducer-obliterator 1 [Source:MGI Symbol;Acc... [more]
Dido18.840e-1150.98death inducer-obliterator 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of CXXC-type zinc finger protein isoform 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9P0U4|CXXC1_HUMAN1.903e-4634.25CXXC-type zinc finger protein 1 OS=Homo sapiens OX... [more]
sp|Q5EA28|CXXC1_BOVIN5.429e-4533.56CXXC-type zinc finger protein 1 OS=Bos taurus OX=9... [more]
sp|Q9CWW7|CXXC1_MOUSE2.123e-4433.56CXXC-type zinc finger protein 1 OS=Mus musculus OX... [more]
sp|Q9W352|CXXC1_DROME2.068e-4231.65CXXC-type zinc finger protein 1 OS=Drosophila mela... [more]
sp|Q9W0T1|NU301_DROME1.982e-1032.41Nucleosome-remodeling factor subunit NURF301 OS=Dr... [more]
back to top
BLAST of CXXC-type zinc finger protein isoform 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X9ELX40.000e+099.72CXXC1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A0X3PYA79.005e-5739.58zf-CpG_bind_C domain-containing protein OS=Schisto... [more]
A0A4Z2DGC11.209e-5637.30CXXC-type zinc finger protein isoform 2 OS=Schisto... [more]
A0A504YPB01.774e-5637.35CpG-binding protein OS=Fasciola gigantica OX=46835... [more]
A0A074Z7B97.088e-5637.30zf-CpG_bind_C domain-containing protein OS=Opistho... [more]
back to top
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cxxc1a4.890e-4534.30CXXC-type zinc finger protein 1 [Source:NCBI gene;... [more]
cxxc1b5.901e-4533.45CXXC-type zinc finger protein 1-like [Source:NCBI ... [more]
cxxc1b1.732e-4431.91CXXC-type zinc finger protein 1-like [Source:NCBI ... [more]
ENSAMXT00000051089.19.862e-1252.94pep primary_assembly:Astyanax_mexicanus-2.0:22:285... [more]
bptf5.685e-1040.32nucleosome-remodeling factor subunit BPTF-like [So... [more]
back to top
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000010200.11.714e-842.11pep scaffold:Pmarinus_7.0:GL476882:35727:95577:1 g... [more]
ENSPMAT00000010169.14.509e-733.72pep scaffold:Pmarinus_7.0:GL480870:6363:17942:-1 g... [more]
ENSPMAT00000010170.17.245e-739.66pep scaffold:Pmarinus_7.0:GL480870:8586:17942:-1 g... [more]
ENSPMAT00000003514.19.095e-635.48pep scaffold:Pmarinus_7.0:GL476382:909500:922223:-... [more]
back to top
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SPP11.992e-631.88Subunit of COMPASS (Set1C); a complex which methyl... [more]
back to top
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO327611.005e-4634.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288354.129e-2540.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470623.573e-1255.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449031.360e-842.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO267592.577e-746.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CXXC-type zinc finger protein isoform 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cxxc1a2.297e-4734.53CXXC-type zinc finger protein 1 [Source:NCBI gene;... [more]
cxxc1b1.436e-4433.45CXXC finger protein 1 [Source:NCBI gene;Acc:101158... [more]
cxxc1b1.738e-4433.45CXXC finger protein 1 [Source:NCBI gene;Acc:101158... [more]
cxxc1b1.934e-4433.45CXXC finger protein 1 [Source:NCBI gene;Acc:101158... [more]
cxxc1a1.256e-3631.16CXXC-type zinc finger protein 1 [Source:NCBI gene;... [more]
back to top
BLAST of CXXC-type zinc finger protein isoform 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074165.10.000e+099.24SMESG000074165.1[more]
SMESG000004468.16.931e-8949.34SMESG000004468.1[more]
SMESG000004468.12.387e-3060.87SMESG000004468.1[more]
SMESG000025408.17.152e-2259.70SMESG000025408.1[more]
SMESG000025408.17.629e-2259.70SMESG000025408.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026693 ID=SMED30026693|Name=CXXC-type zinc finger protein isoform 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2616bp
GGTTTGACCACCATTTTGGTGATAAAATTAATTTCATAAATTGTTTCATT
AGTATAGTCATATTATAATTATTTTAAAACCATTTCTATTTTAAATATTA
AATACATTGTTATGTATTTAATTAATTTTTGATACCTTTAATTTCATTAG
TTAATTATTTTATAATTGAATTATAATAAAATCCTTTCATTTGGTATATG
CATTAAAGATGAATAAATATAAATATAAGAAGCCTATTTACGCTATTAGA
GAAGATTCTGATGACTCTAATTCTAATAATTCCAATAATGGAGGTCAAAC
CAAACAGTTGTGGTGTATTTGCCGATCTGAAGATAGTGAAAGATTTATGA
TTTGTTGTGACAGTTGTGAAGAATGGTATCATGGTGACTGTGTTAATATA
ACTCCGAAACAGTCAGAATTAATTAGTAAATATTTTTGCCTTCAATGTCA
AAAAAGAAATCCTTCATTAAAAATCCAATATAAAGCTGGTATTATAAAAA
AGCCTAAAGACGTTCAACCGATATCAAAAGTTGATAAAGCTTTCAAAATA
AAATCTGAAGAAAGAATAATTGAACAGATCCAGTCAAAATATGAAAAATC
AAATAAAATCAGATCAGAAGAAAAATCACTTGATCAATTACAATCGAAAC
TTGACAAAACATATAAATCAAAGTTTGATGAAAAATTTCCCGATGATTAC
CAATCAAAATTCGATAAAGCATATAAAACGAAACACGATGAGAAAATATT
CGATACAAGTCATTCAAAATTTGAGAAATCTTACAAAATCAAATCGGAAG
AGAAACAAGCCGATTCGACCTTCTCTAGTTCCAGGAGTGATAAGTCTATT
AAAATCAAATCAGAAGAAAAGATCACTGAACCAGTTATTAAATTCTCTCA
AAAACCAGTGAAACCCGGAAGTTGTGGTGAGTGCATTAATTGCTTGCGCA
AAGTTGACTGTAATGTCTGCCCAAACTGCAAATCAAAATCCGACAAAGGC
TGTTTGAAACGGGTTTGTGTGATGATAACTGCTAATGTTGATAAAGCAAT
CAAAGCGGAAAAATTAATGTTGACAAAGCTACCGGGAGAGTTTATTCCAA
CTAAAGCACCAATTGAACGAAAGAAACAAATATTGATTCGTGATCTGCCT
TTCAACAAAACAAATTTGCCAAGCTCTTCATCACCGAGCAGTAATGAGAA
CCAATCTAAAGTCCAAAAACGTCCCCATTCACCAAGTTACAGTTCAGAAA
GTAACAGTGTCGCTTCTATCAAACAAAAAGCCCCAGCGAATTCGCAAAAT
TTTAATAAATTACCTCTAAAAAAAATAAAACTCGATCCAGATGTGAATTT
TCAAAAGCCGGCGAAAACCAAATGTGTCGAATCATCGGAATCGTTGGAAT
CGAGCGAAGATAATATGGATGAAAATGAAGAAATTGAAGATGGAGATATG
GATAATGATGAGTCAGATGACAGCGACGATTCAAATGACGACGACGAGGA
ATCAAGTGACAACTTTGTTCGTAAAGCTTCTAAGATATCTTCAAAAGTAG
TCGGAGCTAAAAAGAAGATTATTTCATCAAATTTCAATGATAGATGTGAA
TCGCCTTATAGAAAACGAAAGTTTGTTCGAAAACCAATCCAGCCTCAAGT
GCAGGATAGTATCAAACAGTTTAAACCAACAGAATGCCACAATATCGGAT
GCAGCCAACCGGCCCGATTAAGCAGTAAATATTGCAGTGATGAATGCGGA
ATCAAATTAGCAGAGCAAAGATTATTAAAATACTTGCCAAGTCGAATAAT
AAACTGGAATAATTCGGTTAGTATTTGCAATCAGAAAGACCGGCGAACTC
AAGCAGAAATCCAAGAAGAATGCGAAACAATTCATTACAATTTAAACATT
CTGGATAAGAGTCATCACGATCTCATTGAATTTATCGATAGATGGCGATC
ATCTTGTAGCGCCTCCAGCAATGCGGAAGATGATGATCGCCGAGTCCCGG
GTGCGAATGATGACAGCGTTCAGTGTGTCACCTGTGGAATTATGGTTGGC
AGTACCAAGGCGTTGGCGCACATGGAGAATTGTTATCAAAAAATCGAGGG
CGGTACAATGGTATTTGCAGACTTTGAAGAACAGCCGATTGGGTCAAAAT
TATTCTGCGATTTCTACGATAATAATATACGTGGCTATTGTAAGCGCTTA
GCGGCGTTGTGTGATCATAACAAAGATTCCAAGGTTGATCCAAAAACCAT
TTGTGCCTTTCCTCTTTCAGTCAATGAAAAGAGTGATAAAGTTTGCATGA
CTGCTAAAGTAAAATGCAACAGGCATGTAAACTGGGAAAGAATCCAAAGA
GCAGTTATTGATATGAATAGATATCGATTACTTGTAAGATATGAAGAATT
ACAGGTGGAAGATCGTAAGTTCAAGCATAGCATTGGTCAGAGAGGTGGAG
TCATGTCTCTGCTTCTGCACGAGACAATTGACCATCAACCATTGAAACCA
CTTTTGCCAATTAAAATTAAGGATAGAAATAACAAAATGAAAAAATTCAC
AAAAGCGATGTGCATTTAATGATTTTAGAGTTGTTATTTATAATAAAAAT
TTCTTGTTTTAAAACA
back to top

protein sequence of SMED30026693-orf-1

>SMED30026693-orf-1 ID=SMED30026693-orf-1|Name=SMED30026693-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=787bp
MNKYKYKKPIYAIREDSDDSNSNNSNNGGQTKQLWCICRSEDSERFMICC
DSCEEWYHGDCVNITPKQSELISKYFCLQCQKRNPSLKIQYKAGIIKKPK
DVQPISKVDKAFKIKSEERIIEQIQSKYEKSNKIRSEEKSLDQLQSKLDK
TYKSKFDEKFPDDYQSKFDKAYKTKHDEKIFDTSHSKFEKSYKIKSEEKQ
ADSTFSSSRSDKSIKIKSEEKITEPVIKFSQKPVKPGSCGECINCLRKVD
CNVCPNCKSKSDKGCLKRVCVMITANVDKAIKAEKLMLTKLPGEFIPTKA
PIERKKQILIRDLPFNKTNLPSSSSPSSNENQSKVQKRPHSPSYSSESNS
VASIKQKAPANSQNFNKLPLKKIKLDPDVNFQKPAKTKCVESSESLESSE
DNMDENEEIEDGDMDNDESDDSDDSNDDDEESSDNFVRKASKISSKVVGA
KKKIISSNFNDRCESPYRKRKFVRKPIQPQVQDSIKQFKPTECHNIGCSQ
PARLSSKYCSDECGIKLAEQRLLKYLPSRIINWNNSVSICNQKDRRTQAE
IQEECETIHYNLNILDKSHHDLIEFIDRWRSSCSASSNAEDDDRRVPGAN
DDSVQCVTCGIMVGSTKALAHMENCYQKIEGGTMVFADFEEQPIGSKLFC
DFYDNNIRGYCKRLAALCDHNKDSKVDPKTICAFPLSVNEKSDKVCMTAK
VKCNRHVNWERIQRAVIDMNRYRLLVRYEELQVEDRKFKHSIGQRGGVMS
LLLHETIDHQPLKPLLPIKIKDRNNKMKKFTKAMCI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0048188Set1C/COMPASS complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR037869Spp1/CFP1
IPR001965Znf_PHD
IPR019787Znf_PHD-finger
IPR022056CpG-bd_C
IPR013083Znf_RING/FYVE/PHD
IPR019786Zinc_finger_PHD-type_CS
IPR002857Znf_CXXC
IPR011011Znf_FYVE_PHD
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0003677DNA binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 35..81
e-value: 1.8E-9
score: 47.5
IPR022056CpG binding protein, C-terminalPFAMPF12269zf-CpG_bind_Ccoord: 518..752
e-value: 3.2E-57
score: 194.0
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 22..96
e-value: 4.8E-21
score: 75.9
IPR019787Zinc finger, PHD-fingerPFAMPF00628PHDcoord: 36..82
e-value: 1.0E-10
score: 41.3
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 33..83
score: 8.831
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 316..368
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 384..438
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 316..369
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 397..431
IPR037869Spp1/CFP1PANTHERPTHR46174FAMILY NOT NAMEDcoord: 26..761
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 36..80
IPR002857Zinc finger, CXXC-typePROSITEPS51058ZF_CXXCcoord: 232..271
score: 9.168
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 32..89