Glutamate synthase

Overview
NameGlutamate synthase
Smed IDSMED30026686
Length (bp)6461
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate synthase (SMED30026686) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate synthase (SMED30026686) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate synthase (SMED30026686) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate synthase (SMED30026686) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026686

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30026686SMESG000077776.1 dd_Smed_v4_5074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026686SMESG000077776.1 dd_Smed_v4_5074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30026686SMESG000077776.1 dd_Smed_v4_5074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30026686SMESG000077776.1 dd_Smed_v4_5074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30026686SMESG000077776.1 dd_Smed_v4_5074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30026686SMESG000077776.1 dd_Smed_v4_5074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30026686SMESG000077776.1 dd_Smed_v4_5074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026686SMESG000077776.1 SMESG000028417.1 Contig46127uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026686SMESG000077776.1 SMESG000028417.1 Contig46127newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026686SMESG000077776.1 Contig39334uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026686SMESG000077776.1 Contig39334newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026686SMESG000077776.1 Contig19237uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026686SMESG000077776.1 Contig19237newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30026686SMESG000077776.1 dd_Smed_v6_5074_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30026686SMESG000077776.1 SMESG000074194.1 OX_Smed_1.0.12944ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate synthase vs. Ensembl Human
Match: DPYD (dihydropyrimidine dehydrogenase [Source:HGNC Symbol;Acc:HGNC:3012])

HSP 1 Score: 98.2117 bits (243), Expect = 1.241e-19
Identity = 127/517 (24.56%), Postives = 210/517 (40.62%), Query Frame = 2
Query: 4748 TSNTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKT-------------GKRIVVVGSGPSGLAAAAQLNKAGHA-VLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLND-YDAIVLCVGASWP-RDINIPGRNL-SGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPE---KEIINQLKL------EVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQ 6220
            TS   LDK K + + P  KN + N E+  N++ +I       +G  R+A RC++C    CQ    CP    I  +   +   N+  A   +   N      G  CP      CV G N  A     I    + +   E +   S P+++                +I + G+GP+ ++ A+ L + G++ + + E+ + +GGL    IP  ++  DVV   I  M + G++   G  +  ++     L    Y A  + +G   P +D    G     G + +  FL    +  +      +  + +    VI+LG GDT  DC  ++LR GAR V  F +     K   +    PE      ++   EE K  +             FLS     V G R V +++ R  Q E     E  +       ++V+ A G +  +   KE ++ +K       EVD  T         QTS   V+A GD     +  V ++N+G+QA+  I K + +Q
Sbjct:   31 TSAKKLDK-KHWKRNP-DKNCF-NCEKLENNFDDIKHTTLGERGALREAMRCLKCADAPCQ--KSCPTNLDIKSFITSIANKNYYGAAKMIFSDNPLGLTCGMVCPT--SDLCVGGCNLYATEEGPINIGGLQQFATEVFKAMSIPQIRNPSLPPPEKMSEAYSAKIALFGAGPASISCASFLARLGYSDITIFEKQEYVGGLSTSEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSVNEMTLSTLKEKGYKAAFIGIGLPEPNKDAIFQGLTQDQGFYTSKDFLPLVAKGSKAGMCACHSPLPSIRGVVIVLGAGDTAFDCATSALRCGARRV--FIVF---RKGFVNIRAVPE-----EMELAKEE-KCEF-----------LPFLSPRKVIVKGGRIVAMQFVRTEQDETGKWNEDEDQMVHLKADVVISAFGSVLSDPKVKEALSPIKFNRWGLPEVDPET--------MQTSEAWVFAGGDVVGLANTTVESVNDGKQASWYIHKYVQSQ 510          
BLAST of Glutamate synthase vs. Ensembl Celegans
Match: W07E11.1 (pep chromosome:WBcel235:X:10084627:10104252:1 gene:WBGene00012326.1 transcript:W07E11.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07E11.1)

HSP 1 Score: 1733 bits (4487), Expect = 0.000e+0
Identity = 881/1545 (57.02%), Postives = 1116/1545 (72.23%), Query Frame = 2
Query:  140 ANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKE-NGTELPERGKFAVGMLFVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAE---MSLTLKD-----------------LHQIIPDDQSFQHEEDPLLANYDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARH----IYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSE-PIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSN-DPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREM----KNQPKLIDATQE 4681
            ANTGL+ P +E+D+CGVGFV  I G  + KI+ +AR ML  M HRGA   DND+GDGAGV+T IP +LY+   KE +G++LP  G++A G+LF++ E+ +++ E F  + + C L  + W++   +   IG  AK TEP I Q+F+  +  +  P   +R V++LRK     M ++    Y+CSLS  T+VYKGQF   QL++FY DL +P Y+TH+A++H+RFSTNTFPSW RA P R+LAHNGEINTLRGNINLMRAREGVMK+  +   L +LFPI+E  ++DSGCLDN +EFL  A  RSLPE  +TM+PEAW  D  M   KK FY WAA S+EPWDGPAL+ FSDGRY+GAILDRNGLRP+RYY++D D +Y+SSE+GV  I  E ++ K RLK GR+LLVDT +KKI  DE LK  I   RP +Q  A    + L  KD                 L Q+ P       ++D  L + D+RL+L+ YT++   +L++PMIK+KKEALGSMGNDA LACLS Y+PLLF YF+QLFAQVTNPPIDPFRE+IVM+L CPIGPE+N+LEP  E   RL L QP+LS+ D++V+ +  Y+GW  K IDITYP+       +  +D +C  A  A   GY+I+VLSDR    +++ +PSL+ VGA+H  LI  +LR+K A++++TGEAR VH FC LLG+GADAICPY V+E + RLR+ G+L+K   D+ +++ +   VE G++KVMAKMGISTLHSYK AQIFE VGLA++V+D CF  T SR+GG TFE LA E+L RH      T +   GD+  L   G +HWR GGE HINEP A++ LQ++ + NN  TF ++  +SN++ R+C +RGQLE   + +  IPL EVEPA EIVK+F TGAMSFGSIS+E HT LAIAMNRIG KSNTGEGGE PER+  + DP +NLRSAIKQVASARFGVTS+YLA+ADELQIKMAQGAKPGEGGELPGHKV+ +IA TR + AGVGLISPPPHHDIYSIEDLAQLIYDLK ANP AR+SVKLVSE G+G+VA+GV KG A+HIT+SGHDGGTGASSWTGIKHAGLPWELGVAETHQ L +NNLRSRVVLQADGQIRTGRDV+IAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVG+ATQDP+LR KF+GKPEHVVNY+F++AE+VR  ++KLG R L + +G ++ L A+++ +N KA++L+F  +L N     PN+ I+ G VKQ   LG+     L +         E ++  N  I N DR F + +SY ISK +G+  L   +SI I   G+ GQSFCAFL +G+SV LEGDANDYV K LSGG++VI PPK +   + SE N ++GNV LYGA SG  +FRG A ERF VRNSGA  +VE +GDHGCEYMTGGRVIVLG  GRNFAA MSGGIAY++  ++ F    N   VDL   +  + D  F+   + EF   T S + ++IL+NW +  +  +KVFP++Y++VL E     K Q +L  A Q+
Sbjct:   13 ANTGLWLPQLERDACGVGFVCSIKGTTSSKIMSDARTMLERMAHRGACGCDNDSGDGAGVLTAIPDDLYRKSVKEQDGSDLPPLGQYATGILFLEAESYKQAKEAFQDLARACGLRVVAWRKLGTNRECIGEEAKKTEPLIRQVFVSADYAESDPAKFERSVYLLRKQAVNSMTKQEIECYVCSLSTSTIVYKGQFNTHQLFKFYDDLTNPEYQTHLALVHSRFSTNTFPSWNRAQPNRILAHNGEINTLRGNINLMRAREGVMKSKYYRDDLQKLFPIVEEGLTDSGCLDNVMEFLVRAGGRSLPEAAMTMVPEAWEKDDDMSTEKKHFYRWAAMSMEPWDGPALLAFSDGRYIGAILDRNGLRPARYYLTDDDHLYLSSEVGVNDIPIEKVVKKDRLKPGRMLLVDTHLKKIELDEDLKTRIALSRPHKQLSASRIYLDLIRKDDVLSHGAVTNEYLNRLHLEQVNP---GLMKKKDVHL-DSDRRLALYAYTHDTFSLLLVPMIKEKKEALGSMGNDAALACLSDYSPLLFSYFQQLFAQVTNPPIDPFREQIVMSLRCPIGPESNMLEPDTELASRLILEQPVLSMVDMEVIKRTMYKGWKAKEIDITYPVKYGVKGLVPGLDAMCCVACTAALDGYQILVLSDRNASSERVPIPSLLAVGAIHQCLIRHRLRMKVAIVVETGEARVVHDFCVLLGFGADAICPYMVYETMHRLRNLGLLDKELNDDQVYQGYRQGVERGIFKVMAKMGISTLHSYKHAQIFEIVGLAKDVVDMCFKNTVSRLGGATFEILAAEALKRHRSAFPTTSDASFGDSKTLVASGTFHWRAGGEKHINEPLAIAKLQAAARLNNSKTFQEYSLASNMAQRWCTLRGQLEIKTSKKIQIPLSEVEPASEIVKKFVTGAMSFGSISWETHTALAIAMNRIGGKSNTGEGGEKPERYRKDQDPNQNLRSAIKQVASARFGVTSSYLANADELQIKMAQGAKPGEGGELPGHKVTQDIADTRKSTAGVGLISPPPHHDIYSIEDLAQLIYDLKCANPVARVSVKLVSEAGVGIVAAGVAKGNADHITVSGHDGGTGASSWTGIKHAGLPWELGVAETHQVLTMNNLRSRVVLQADGQIRTGRDVMIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGVATQDPVLRAKFDGKPEHVVNYMFMVAEEVRYFLSKLGLRKLEDAVGRTDLLYASSNPVNKKATMLEFGSILKNAQQMFPNISIKGGSVKQVIELGALETRMLTELDGVFNDAGEHKVFENEYITNIDRTFGTRISYEISKRYGELGLEGSRSITIGLKGHAGQSFCAFLAKGVSVTLEGDANDYVGKCLSGGKIVIFPPKAA--SYKSEENSVIGNVALYGATSGDCWFRGVAGERFAVRNSGANVIVEAVGDHGCEYMTGGRVIVLGSIGRNFAAAMSGGIAYLFAQEDNFSRLINAATVDL--DDASTEDLIFVKAKIEEFVKLTGSELGQRILTNWQKEHQKIIKVFPRDYKRVLAEQEEARKKQAELDKANQD 1549          

HSP 2 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 291/529 (55.01%), Postives = 375/529 (70.89%), Query Frame = 2
Query: 4676 QEKVEEKNSIELEKNGLIDIEDLVTSNTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGH----VAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTSLAGPGGLL 6250
            +E VE+K S+++E  G+     L   +  LDKL+GF+KY R K  YR+ +ER+NDW E+Y  + VR  +R QAARCM+CGVPFCQ H GCPLGNIIPKWND V+K NW++AL QLLQTNNFPEFTGR CPAPCE AC LGI  PAVTIK+IECAIID  F +GWM P  P   TGKRI ++GSGPSGL AAAQL K GH V+V ER +R+GGLL+YGIP+MK+ K VV RR++ + +EG+ F T   IG    PAD LL + DAI++C G++  RD+N+ GR+  G+ FA+ +LEK QR +R   +  +  +   +K VIILGGGDT  DCIATS R G ++V  FEILP P  +R   NPWPEWP I+RVDYGHEE K   G DPR +++ +K FL+  N      + G+  V VEW +D +   W + E   +     C++ +LAMGF+GPEK +I QL L+ D R+NI TP  KY + + KV+AAGDCRRGQSLVV AI+EGRQAAR++D+ +M +T+LAGPGG++
Sbjct: 1642 EEFVEKKASVDIESLGIP--AHLRKKDEPLDKLRGFVKYNRQKKMYRDPKERLNDWDEVYDFEAVRSNIREQAARCMDCGVPFCQGHSGCPLGNIIPKWNDFVFKKNWRQALEQLLQTNNFPEFTGRVCPAPCEGACTLGIGSPAVTIKSIECAIIDYAFMQGWMKPCKPAFNTGKRIAIIGSGPSGLGAAAQLVKVGHTVVVYERKNRVGGLLRYGIPTMKLDKFVVDRRVSLLEQEGVRFLTNTEIGK-HVPADFLLKENDAIIVCTGSTTARDLNVEGRDAKGVCFAMEYLEKSQR-RRAGDDVSWEGLDPANKKVIILGGGDTATDCIATSNRLGCKTVGAFEILPQPGPNRKPENPWPEWPLIFRVDYGHEEAKEMTGSDPRTYSVSTKRFLTTTNAAGITVLTGLEIVDVEWEKDDKG-AWKLIEKNETIRTIECDLCILAMGFVGPEKSVIEQLNLKTDPRSNILTPKDKYDSDVAKVFAAGDCRRGQSLVVWAIHEGRQAARQVDEYLMGKTTLAGPGGIV 2165          
BLAST of Glutamate synthase vs. Ensembl Celegans
Match: W07E11.1 (pep chromosome:WBcel235:X:10084627:10104063:1 gene:WBGene00012326.1 transcript:W07E11.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07E11.1)

HSP 1 Score: 1730.69 bits (4481), Expect = 0.000e+0
Identity = 884/1555 (56.85%), Postives = 1118/1555 (71.90%), Query Frame = 2
Query:  140 ANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKE-NGTELPERGKFAVGMLFVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAE---MSLTLKD-----------------LHQIIPDDQSFQHEEDPLLANYDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHI------------YTYNKRI--GDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSE-PIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSN-DPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREM----KNQPKLIDATQE 4681
            ANTGL+ P +E+D+CGVGFV  I G  + KI+ +AR ML  M HRGA   DND+GDGAGV+T IP +LY+   KE +G++LP  G++A G+LF++ E+ +++ E F  + + C L  + W++   +   IG  AK TEP I Q+F+  +  +  P   +R V++LRK     M ++    Y+CSLS  T+VYKGQF   QL++FY DL +P Y+TH+A++H+RFSTNTFPSW RA P R+LAHNGEINTLRGNINLMRAREGVMK+  +   L +LFPI+E  ++DSGCLDN +EFL  A  RSLPE  +TM+PEAW  D  M   KK FY WAA S+EPWDGPAL+ FSDGRY+GAILDRNGLRP+RYY++D D +Y+SSE+GV  I  E ++ K RLK GR+LLVDT +KKI  DE LK  I   RP +Q  A    + L  KD                 L Q+ P       ++D  L + D+RL+L+ YT++   +L++PMIK+KKEALGSMGNDA LACLS Y+PLLF YF+QLFAQVTNPPIDPFRE+IVM+L CPIGPE+N+LEP  E   RL L QP+LS+ D++V+ +  Y+GW  K IDITYP+       +  +D +C  A  A   GY+I+VLSDR    +++ +PSL+ VGA+H  LI  +LR+K A++++TGEAR VH FC LLG+GADAICPY V+E + RLR+ G+L+K   D+ +++ +   VE G++KVMAKMGISTLHSYK AQIFE VGLA++V+D CF  T SR+GG TFE LA E+L RH             YT  K I  GD+  L   G +HWR GGE HINEP A++ LQ++ + NN  TF ++  +SN++ R+C +RGQLE   + +  IPL EVEPA EIVK+F TGAMSFGSIS+E HT LAIAMNRIG KSNTGEGGE PER+  + DP +NLRSAIKQVASARFGVTS+YLA+ADELQIKMAQGAKPGEGGELPGHKV+ +IA TR + AGVGLISPPPHHDIYSIEDLAQLIYDLK ANP AR+SVKLVSE G+G+VA+GV KG A+HIT+SGHDGGTGASSWTGIKHAGLPWELGVAETHQ L +NNLRSRVVLQADGQIRTGRDV+IAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVG+ATQDP+LR KF+GKPEHVVNY+F++AE+VR  ++KLG R L + +G ++ L A+++ +N KA++L+F  +L N     PN+ I+ G VKQ   LG+     L +         E ++  N  I N DR F + +SY ISK +G+  L   +SI I   G+ GQSFCAFL +G+SV LEGDANDYV K LSGG++VI PPK +   + SE N ++GNV LYGA SG  +FRG A ERF VRNSGA  +VE +GDHGCEYMTGGRVIVLG  GRNFAA MSGGIAY++  ++ F    N   VDL   +  + D  F+   + EF   T S + ++IL+NW +  +  +KVFP++Y++VL E     K Q +L  A Q+
Sbjct:   13 ANTGLWLPQLERDACGVGFVCSIKGTTSSKIMSDARTMLERMAHRGACGCDNDSGDGAGVLTAIPDDLYRKSVKEQDGSDLPPLGQYATGILFLEAESYKQAKEAFQDLARACGLRVVAWRKLGTNRECIGEEAKKTEPLIRQVFVSADYAESDPAKFERSVYLLRKQAVNSMTKQEIECYVCSLSTSTIVYKGQFNTHQLFKFYDDLTNPEYQTHLALVHSRFSTNTFPSWNRAQPNRILAHNGEINTLRGNINLMRAREGVMKSKYYRDDLQKLFPIVEEGLTDSGCLDNVMEFLVRAGGRSLPEAAMTMVPEAWEKDDDMSTEKKHFYRWAAMSMEPWDGPALLAFSDGRYIGAILDRNGLRPARYYLTDDDHLYLSSEVGVNDIPIEKVVKKDRLKPGRMLLVDTHLKKIELDEDLKTRIALSRPHKQLSASRIYLDLIRKDDVLSHGAVTNEYLNRLHLEQVNP---GLMKKKDVHL-DSDRRLALYAYTHDTFSLLLVPMIKEKKEALGSMGNDAALACLSDYSPLLFSYFQQLFAQVTNPPIDPFREQIVMSLRCPIGPESNMLEPDTELASRLILEQPVLSMVDMEVIKRTMYKGWKAKEIDITYPVKYGVKGLVPGLDAMCCVACTAALDGYQILVLSDRNASSERVPIPSLLAVGAIHQCLIRHRLRMKVAIVVETGEARVVHDFCVLLGFGADAICPYMVYETMHRLRNLGLLDKELNDDQVYQGYRQGVERGIFKVMAKMGISTLHSYKHAQIFEIVGLAKDVVDMCFKNTVSRLGGATFEILAAEALKRHRSAFPTTSDASFDYTNVKGIEYGDSKTLVASGTFHWRAGGEKHINEPLAIAKLQAAARLNNSKTFQEYSLASNMAQRWCTLRGQLEIKTSKKIQIPLSEVEPASEIVKKFVTGAMSFGSISWETHTALAIAMNRIGGKSNTGEGGEKPERYRKDQDPNQNLRSAIKQVASARFGVTSSYLANADELQIKMAQGAKPGEGGELPGHKVTQDIADTRKSTAGVGLISPPPHHDIYSIEDLAQLIYDLKCANPVARVSVKLVSEAGVGIVAAGVAKGNADHITVSGHDGGTGASSWTGIKHAGLPWELGVAETHQVLTMNNLRSRVVLQADGQIRTGRDVMIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGVATQDPVLRAKFDGKPEHVVNYMFMVAEEVRYFLSKLGLRKLEDAVGRTDLLYASSNPVNKKATMLEFGSILKNAQQMFPNISIKGGSVKQVIELGALETRMLTELDGVFNDAGEHKVFENEYITNIDRTFGTRISYEISKRYGELGLEGSRSITIGLKGHAGQSFCAFLAKGVSVTLEGDANDYVGKCLSGGKIVIFPPKAA--SYKSEENSVIGNVALYGATSGDCWFRGVAGERFAVRNSGANVIVEAVGDHGCEYMTGGRVIVLGSIGRNFAAAMSGGIAYLFAQEDNFSRLINAATVDL--DDASTEDLIFVKAKIEEFVKLTGSELGQRILTNWQKEHQKIIKVFPRDYKRVLAEQEEARKKQAELDKANQD 1559          

HSP 2 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 291/529 (55.01%), Postives = 375/529 (70.89%), Query Frame = 2
Query: 4676 QEKVEEKNSIELEKNGLIDIEDLVTSNTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGH----VAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTSLAGPGGLL 6250
            +E VE+K S+++E  G+     L   +  LDKL+GF+KY R K  YR+ +ER+NDW E+Y  + VR  +R QAARCM+CGVPFCQ H GCPLGNIIPKWND V+K NW++AL QLLQTNNFPEFTGR CPAPCE AC LGI  PAVTIK+IECAIID  F +GWM P  P   TGKRI ++GSGPSGL AAAQL K GH V+V ER +R+GGLL+YGIP+MK+ K VV RR++ + +EG+ F T   IG    PAD LL + DAI++C G++  RD+N+ GR+  G+ FA+ +LEK QR +R   +  +  +   +K VIILGGGDT  DCIATS R G ++V  FEILP P  +R   NPWPEWP I+RVDYGHEE K   G DPR +++ +K FL+  N      + G+  V VEW +D +   W + E   +     C++ +LAMGF+GPEK +I QL L+ D R+NI TP  KY + + KV+AAGDCRRGQSLVV AI+EGRQAAR++D+ +M +T+LAGPGG++
Sbjct: 1652 EEFVEKKASVDIESLGIP--AHLRKKDEPLDKLRGFVKYNRQKKMYRDPKERLNDWDEVYDFEAVRSNIREQAARCMDCGVPFCQGHSGCPLGNIIPKWNDFVFKKNWRQALEQLLQTNNFPEFTGRVCPAPCEGACTLGIGSPAVTIKSIECAIIDYAFMQGWMKPCKPAFNTGKRIAIIGSGPSGLGAAAQLVKVGHTVVVYERKNRVGGLLRYGIPTMKLDKFVVDRRVSLLEQEGVRFLTNTEIGK-HVPADFLLKENDAIIVCTGSTTARDLNVEGRDAKGVCFAMEYLEKSQR-RRAGDDVSWEGLDPANKKVIILGGGDTATDCIATSNRLGCKTVGAFEILPQPGPNRKPENPWPEWPLIFRVDYGHEEAKEMTGSDPRTYSVSTKRFLTTTNAAGITVLTGLEIVDVEWEKDDKG-AWKLIEKNETIRTIECDLCILAMGFVGPEKSVIEQLNLKTDPRSNILTPKDKYDSDVAKVFAAGDCRRGQSLVVWAIHEGRQAARQVDEYLMGKTTLAGPGGIV 2175          
BLAST of Glutamate synthase vs. Ensembl Celegans
Match: dpyd-1 (Dihydropyrimidine dehydrogenase [NADP(+)] [Source:UniProtKB/Swiss-Prot;Acc:Q18164])

HSP 1 Score: 78.9518 bits (193), Expect = 3.587e-14
Identity = 87/365 (23.84%), Postives = 152/365 (41.64%), Query Frame = 2
Query: 4697 NSIELEKNGLIDIEDLVTSNTNL-DKLKGFIKYPRHKNPY---RNVEERI----------NDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAP--CEAACVLGINEP-AVTIKNIECAIID--KGFDEGWMVPSAPK----VKTGKRIVVVGSGPSGLAAAAQLNKAGHA-VLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLND-YDAIVLCVGASWPR-DINIPGRNL-SGIHFALSFLEKWQRHQR-DESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVT 5707
            N++ L      DIE L+  N  + DK          KN +   RN E+            ND+ +I       +G  ++A RC++C    CQ    CP    +  +   +   N+  A  Q+L  N      G  CP    C  +C L  +E  A+ I  ++    D  K  +   +V    +        +++ ++G GP+ ++ A+ L + G+  + + E+   IGGL    IP  ++  DVV   I    + G++ +T   +G D     KL      A+ + +G   P+ D    G  + +G + + ++L       +      +   +      V++LG GDT +DC  ++LR GA  VT
Sbjct:   12 NNLPLLSKDSPDIESLLILNPKVQDKANAVPSAVTKKNKHNWKRNEEKGCGSTCGESKLKNDFRDIKHTTLSERGALKEAMRCLKCADAPCQ--KSCPTQLDVKSFITSISNKNYYGAARQILSDNPLGLTCGMICPTSDLCVGSCNLQASEEGAINIGGLQQYACDVFKQMNVRQIVSKEVRENRNASHKEQVALIGCGPASISCASFLARLGYTDITIYEKRAYIGGLSSAEIPQFRLPYDVVDFEIQLARDIGVQIETNRPLGKDGLTLAKLKEQGAAAVFIGIGNPEPKIDPLFEGLTIENGFYTSKNYLPAVAAASKPGMCGCKRTPLPTMRGRVVVLGAGDTAMDCATSALRCGASRVT 374          
BLAST of Glutamate synthase vs. Ensembl Celegans
Match: Y62E10A.6 (NADPH:adrenodoxin oxidoreductase, mitochondrial [Source:UniProtKB/TrEMBL;Acc:Q9U1X0])

HSP 1 Score: 61.2326 bits (147), Expect = 6.146e-9
Identity = 48/160 (30.00%), Postives = 81/160 (50.62%), Query Frame = 2
Query: 5204 RIVVVGSGPSGLAAA-AQLNKAGHAVLVLERNDRIGGLLQYGI-PSMKMSKDVVQRRINFMIE---EGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDC 5668
            R+ +VGSGP+G+ A    L K+  +V V E +    GL++YG+ P  +  K+V+    + M E   E ++    V+IG D    D+L   YDA++L  G+   R ++IPG + S +     F+  W     + S  +         +V+I+G G+  +DC
Sbjct:   27 RLAIVGSGPAGMFACNGLLRKSNFSVDVFENSPVPFGLVRYGVAPDHQEVKNVINT-FDAMFEKNRERLKLFCNVNIGRD-ITFDELTRGYDAVLLAYGSYKTRTLDIPGSDASNVISGSEFV-GWYNGVPNASTPDLTT-----SNVVIVGNGNVALDC 178          
BLAST of Glutamate synthase vs. Ensembl Fly
Match: CG9674 (gene:FBgn0036663 transcript:FBtr0333608)

HSP 1 Score: 2415.57 bits (6259), Expect = 0.000e+0
Identity = 1196/2053 (58.26%), Postives = 1522/2053 (74.14%), Query Frame = 2
Query:  137 PANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELPERGKFAVGMLFVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDDQSFQHEEDPLLAN----YDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVG-QKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQPKLIDATQEKVEEKNSIELEKNGLIDIEDLVT--------SNTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHH-GCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTS-LAGPGGLL 6250
            P   GLYDP  E ++CGVGF+V I+GK++HKI+ +A+ +   M HRGA + DNDTGDGAGV+  IP+ LY     + G  LPE G +A G+ ++D      + + F  + K   LE + W+    + SAIG VA+ +EP   Q+F++        K  +RQVF+LRK     + +   RFYICSLS +TVVYKG FT+ QLW++Y DLKDP ++T++A++H RFSTNTFPSWERAHP R+LAHNGEINTLRGN+NLM+AREGVM++  FG +L +L+P++EPN+SDSG  D  LEFL  AS RSLPE+V+TM+PEAW ND  M   K+ FY WAA  +EPWDGPALI+F+DGRY+GA+LDRNGLRPSR+YV+  +++ M+SE+GV  ++P  +  K RLK GR+LLVDT+ KK+I D  LK +I + RP  +W+ +  +TL ++      +     E   L A+    +D RLSLFGY+ E + ML++PM K+KKEALGSMGNDAPLACLS + P+ +EYFKQLFAQVTNPPIDPFREK+VM++ CP+GPEAN+L+PSA+Q HR+WL  PILS+ D  +L +  +RGW TK +DIT+  ++    +I+AID +CR+   A   GY+++V+SDR  G   K+++ +L+ +GA+HH+LI    R+K  ++++T EAREVHH C LLGYGADAICPY  FE+ Q LRD+GV+     D+ ++  +  A++TG+ KVMAKMGISTL SYK AQIFEAVGL  +++ KCF GT SRIGGVT E LA E L R+  TY K   D  IL NPG YHWR GGE HINEP+++  LQ +    N + F  F  ++  S + C +RGQLEFV   + I + EVEPA EIVKRF TGAMSFGSIS EAH TL+I MNRIG KSNTGEGGE  +R+L+ DP  + RSAIKQVAS RFGVT++YLA+AD+LQIKMAQGAKPGEGGELPG+KV+ +IA TR ++ GVGLISPPPHHDIYSIEDLA+LIYDLK +NP ARISVKLVSEVG+GVVASGV KGKAEHI ISGHDGGTGASSWTGIK+AGLPWELGVAETHQ L+LNNLRSRV++QADGQ+RTG DVV+AALLGADEFG STAPLIV+GCTMMRKCHLNTCPVGIATQDP LRKKF GKPEHV+N+ F+LAED+R+IMA LG R   +LIG ++ L+  +   + KAS LD   LL       P   I  G VKQDF L  R D +LI +A  +  G +  + + ++I+N++RAF STLSY I+  +G+  LP+ KSI I   G+ GQSFCAFL +G++V L+GDANDYV KGL GG VVI+ P+++ P F S  N+IVGNVCLYGA  G  +FRG A+ERFCVRNSG  AVVEG+GDHGCEYMTGG V++LG TGRNFAAGMSGGIAYVYD    F  + N + V+L P+  +  D   + + L +F +KT S +A+++L NW+E    FVKVFP EY+K L++M  Q  +    +  +E  N     +  + DIE+ +         ++  LDK +GF+KY R   PYR+  ER  DW E+Y    VRK L+ QAARCMECGVPFCQS+  GCPLGNIIPKWNDLV+   W+EAL QLLQTNNFPEFTGR CPAPCE +CVLGI+EPAVTIKNIECAIID  F++GW+ P  P+V+TGKR+ +VGSGPSGLAA+ QLN+AGH V V ERNDR+GGLLQYGIP+MK+SK+VV+RR++ M +EGIEF+T VH+G D   A++LL +YDA++L  G++WPRD+ +  R+L GIHFA+ FLE  Q+ Q    N     + A  K+VII+GGGDTG DCIATSLRQGA+S+TTFEILP P + RA  NPWP+WP+++RVDYGHEEVKL+WGKDPR +   +KEF+  ENG + G+ TV+VEWT+ ++T QW M+EV  SE  F  +++LLAMGFLGPEK + ++L LE+D R NIK  +G+Y TS  KV+AAGDCRRGQSLVV AI EGRQAAR++D  +  + S L GPGG++
Sbjct:   73 PGKQGLYDPQNEHEACGVGFIVAIDGKRSHKILRDAQTLSERMNHRGACACDNDTGDGAGVLASIPHGLYSKALAKQGVTLPELGDYATGIFYLDEAQHAAAEKEFDDLAKSLGLEVIAWRTVPSNQSAIGVVARKSEPLSRQVFVRRPAGS-DEKAFERQVFVLRKRASHELIKPGRRFYICSLSDRTVVYKGLFTSDQLWDYYTDLKDPEFETYLALVHTRFSTNTFPSWERAHPLRVLAHNGEINTLRGNVNLMKAREGVMQSDLFGDQLKKLYPVVEPNLSDSGSFDCVLEFLTMASDRSLPESVMTMVPEAWQNDKTMPQEKRDFYQWAACVMEPWDGPALISFTDGRYIGAVLDRNGLRPSRFYVTKENVLVMASEVGVYDVDPSQVTLKSRLKPGRMLLVDTKEKKLIQDIELKAKIAKSRPHSEWLQQKMITLDEIRNANVLNTPPVDELAKLPASERGIFDPRLSLFGYSTETVNMLLIPMFKNKKEALGSMGNDAPLACLSNFQPIPYEYFKQLFAQVTNPPIDPFREKVVMSMQCPLGPEANLLQPSAQQVHRIWLTNPILSIPDTQLLKRNTHRGWRTKVLDITFQYNEGVQGYIDAIDRICREGYAAAQAGYQLLVISDRGAGIDGKVAVSALLALGALHHHLIETLQRMKVGIVVETAEAREVHHICVLLGYGADAICPYLAFELAQALRDDGVIAPEVNDKQIYAAYAQAIDTGIAKVMAKMGISTLQSYKSAQIFEAVGLGSDLVAKCFRGTQSRIGGVTLEILAKEGLQRYQLTYGKATPDTRILRNPGQYHWRHGGEAHINEPSSIGSLQEAAVNKNLDAFEAFKKTTLDSVKKCALRGQLEFVTDRQSIDISEVEPASEIVKRFATGAMSFGSISLEAHQTLSITMNRIGGKSNTGEGGEDSDRYLNQDPNNSRRSAIKQVASGRFGVTASYLANADDLQIKMAQGAKPGEGGELPGYKVTKDIAKTRKSVPGVGLISPPPHHDIYSIEDLAELIYDLKCSNPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLVLNNLRSRVIVQADGQLRTGFDVVVAALLGADEFGFSTAPLIVMGCTMMRKCHLNTCPVGIATQDPELRKKFTGKPEHVINFFFMLAEDIRKIMAGLGIRKFQDLIGRTDLLRVASQR-DAKASNLDLKLLLQPALELRPGTNIVGGSVKQDFQLEKRSDNELIAKAQQIFSGADDNVTVKMRIHNEERAFGSTLSYHIACKYGEAGLPAGKSIDIFLEGSAGQSFCAFLARGVNVTLKGDANDYVGKGLCGGNVVIM-PQDTVP-FESHLNVIVGNVCLYGATEGTAYFRGIASERFCVRNSGVTAVVEGVGDHGCEYMTGGVVVILGLTGRNFAAGMSGGIAYVYDLDGSFKPKVNPESVELLPLEIEK-DVLLVKELLADFIEKTGSKVAKELLDNWAEAQGKFVKVFPYEYQKALKDMAEQQAVEQPLKSAIENGNG--KHEPHIKDIEEAIQDVVLEQKRADRVLDKTRGFVKYKRESAPYRDAGERQKDWDEVYNFPHVRKNLKVQAARCMECGVPFCQSNSTGCPLGNIIPKWNDLVFHGEWQEALRQLLQTNNFPEFTGRVCPAPCEGSCVLGISEPAVTIKNIECAIIDHAFEQGWIKPEIPEVRTGKRVAIVGSGPSGLAASQQLNRAGHFVTVFERNDRVGGLLQYGIPTMKLSKEVVKRRVDLMADEGIEFRTNVHVGKD-LKAEQLLQEYDAVLLTTGSTWPRDLPLANRDLKGIHFAMEFLEAQQKKQLGGKND---IISAAGKNVIIIGGGDTGCDCIATSLRQGAKSITTFEILPEPPQKRAQDNPWPQWPKVFRVDYGHEEVKLKWGKDPRQYCTTTKEFVG-ENGAIKGVNTVEVEWTK-TETGQWRMQEVAGSEKYFPADLILLAMGFLGPEKTVPSELGLELDPRGNIKASNGQYGTSNSKVFAAGDCRRGQSLVVWAITEGRQAARQVDSYLTGRPSGLPGPGGVI 2112          
BLAST of Glutamate synthase vs. Ensembl Fly
Match: CG9674 (gene:FBgn0036663 transcript:FBtr0305916)

HSP 1 Score: 2415.57 bits (6259), Expect = 0.000e+0
Identity = 1196/2053 (58.26%), Postives = 1522/2053 (74.14%), Query Frame = 2
Query:  137 PANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELPERGKFAVGMLFVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDDQSFQHEEDPLLAN----YDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVG-QKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQPKLIDATQEKVEEKNSIELEKNGLIDIEDLVT--------SNTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHH-GCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTS-LAGPGGLL 6250
            P   GLYDP  E ++CGVGF+V I+GK++HKI+ +A+ +   M HRGA + DNDTGDGAGV+  IP+ LY     + G  LPE G +A G+ ++D      + + F  + K   LE + W+    + SAIG VA+ +EP   Q+F++        K  +RQVF+LRK     + +   RFYICSLS +TVVYKG FT+ QLW++Y DLKDP ++T++A++H RFSTNTFPSWERAHP R+LAHNGEINTLRGN+NLM+AREGVM++  FG +L +L+P++EPN+SDSG  D  LEFL  AS RSLPE+V+TM+PEAW ND  M   K+ FY WAA  +EPWDGPALI+F+DGRY+GA+LDRNGLRPSR+YV+  +++ M+SE+GV  ++P  +  K RLK GR+LLVDT+ KK+I D  LK +I + RP  +W+ +  +TL ++      +     E   L A+    +D RLSLFGY+ E + ML++PM K+KKEALGSMGNDAPLACLS + P+ +EYFKQLFAQVTNPPIDPFREK+VM++ CP+GPEAN+L+PSA+Q HR+WL  PILS+ D  +L +  +RGW TK +DIT+  ++    +I+AID +CR+   A   GY+++V+SDR  G   K+++ +L+ +GA+HH+LI    R+K  ++++T EAREVHH C LLGYGADAICPY  FE+ Q LRD+GV+     D+ ++  +  A++TG+ KVMAKMGISTL SYK AQIFEAVGL  +++ KCF GT SRIGGVT E LA E L R+  TY K   D  IL NPG YHWR GGE HINEP+++  LQ +    N + F  F  ++  S + C +RGQLEFV   + I + EVEPA EIVKRF TGAMSFGSIS EAH TL+I MNRIG KSNTGEGGE  +R+L+ DP  + RSAIKQVAS RFGVT++YLA+AD+LQIKMAQGAKPGEGGELPG+KV+ +IA TR ++ GVGLISPPPHHDIYSIEDLA+LIYDLK +NP ARISVKLVSEVG+GVVASGV KGKAEHI ISGHDGGTGASSWTGIK+AGLPWELGVAETHQ L+LNNLRSRV++QADGQ+RTG DVV+AALLGADEFG STAPLIV+GCTMMRKCHLNTCPVGIATQDP LRKKF GKPEHV+N+ F+LAED+R+IMA LG R   +LIG ++ L+  +   + KAS LD   LL       P   I  G VKQDF L  R D +LI +A  +  G +  + + ++I+N++RAF STLSY I+  +G+  LP+ KSI I   G+ GQSFCAFL +G++V L+GDANDYV KGL GG VVI+ P+++ P F S  N+IVGNVCLYGA  G  +FRG A+ERFCVRNSG  AVVEG+GDHGCEYMTGG V++LG TGRNFAAGMSGGIAYVYD    F  + N + V+L P+  +  D   + + L +F +KT S +A+++L NW+E    FVKVFP EY+K L++M  Q  +    +  +E  N     +  + DIE+ +         ++  LDK +GF+KY R   PYR+  ER  DW E+Y    VRK L+ QAARCMECGVPFCQS+  GCPLGNIIPKWNDLV+   W+EAL QLLQTNNFPEFTGR CPAPCE +CVLGI+EPAVTIKNIECAIID  F++GW+ P  P+V+TGKR+ +VGSGPSGLAA+ QLN+AGH V V ERNDR+GGLLQYGIP+MK+SK+VV+RR++ M +EGIEF+T VH+G D   A++LL +YDA++L  G++WPRD+ +  R+L GIHFA+ FLE  Q+ Q    N     + A  K+VII+GGGDTG DCIATSLRQGA+S+TTFEILP P + RA  NPWP+WP+++RVDYGHEEVKL+WGKDPR +   +KEF+  ENG + G+ TV+VEWT+ ++T QW M+EV  SE  F  +++LLAMGFLGPEK + ++L LE+D R NIK  +G+Y TS  KV+AAGDCRRGQSLVV AI EGRQAAR++D  +  + S L GPGG++
Sbjct:   73 PGKQGLYDPQNEHEACGVGFIVAIDGKRSHKILRDAQTLSERMNHRGACACDNDTGDGAGVLASIPHGLYSKALAKQGVTLPELGDYATGIFYLDEAQHAAAEKEFDDLAKSLGLEVIAWRTVPSNQSAIGVVARKSEPLSRQVFVRRPAGS-DEKAFERQVFVLRKRASHELIKPGRRFYICSLSDRTVVYKGLFTSDQLWDYYTDLKDPEFETYLALVHTRFSTNTFPSWERAHPLRVLAHNGEINTLRGNVNLMKAREGVMQSDLFGDQLKKLYPVVEPNLSDSGSFDCVLEFLTMASDRSLPESVMTMVPEAWQNDKTMPQEKRDFYQWAACVMEPWDGPALISFTDGRYIGAVLDRNGLRPSRFYVTKENVLVMASEVGVYDVDPSQVTLKSRLKPGRMLLVDTKEKKLIQDIELKAKIAKSRPHSEWLQQKMITLDEIRNANVLNTPPVDELAKLPASERGIFDPRLSLFGYSTETVNMLLIPMFKNKKEALGSMGNDAPLACLSNFQPIPYEYFKQLFAQVTNPPIDPFREKVVMSMQCPLGPEANLLQPSAQQVHRIWLTNPILSIPDTQLLKRNTHRGWRTKVLDITFQYNEGVQGYIDAIDRICREGYAAAQAGYQLLVISDRGAGIDGKVAVSALLALGALHHHLIETLQRMKVGIVVETAEAREVHHICVLLGYGADAICPYLAFELAQALRDDGVIAPEVNDKQIYAAYAQAIDTGIAKVMAKMGISTLQSYKSAQIFEAVGLGSDLVAKCFRGTQSRIGGVTLEILAKEGLQRYQLTYGKATPDTRILRNPGQYHWRHGGEAHINEPSSIGSLQEAAVNKNLDAFEAFKKTTLDSVKKCALRGQLEFVTDRQSIDISEVEPASEIVKRFATGAMSFGSISLEAHQTLSITMNRIGGKSNTGEGGEDSDRYLNQDPNNSRRSAIKQVASGRFGVTASYLANADDLQIKMAQGAKPGEGGELPGYKVTKDIAKTRKSVPGVGLISPPPHHDIYSIEDLAELIYDLKCSNPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLVLNNLRSRVIVQADGQLRTGFDVVVAALLGADEFGFSTAPLIVMGCTMMRKCHLNTCPVGIATQDPELRKKFTGKPEHVINFFFMLAEDIRKIMAGLGIRKFQDLIGRTDLLRVASQR-DAKASNLDLKLLLQPALELRPGTNIVGGSVKQDFQLEKRSDNELIAKAQQIFSGADDNVTVKMRIHNEERAFGSTLSYHIACKYGEAGLPAGKSIDIFLEGSAGQSFCAFLARGVNVTLKGDANDYVGKGLCGGNVVIM-PQDTVP-FESHLNVIVGNVCLYGATEGTAYFRGIASERFCVRNSGVTAVVEGVGDHGCEYMTGGVVVILGLTGRNFAAGMSGGIAYVYDLDGSFKPKVNPESVELLPLEIEK-DVLLVKELLADFIEKTGSKVAKELLDNWAEAQGKFVKVFPYEYQKALKDMAEQQAVEQPLKSAIENGNG--KHEPHIKDIEEAIQDVVLEQKRADRVLDKTRGFVKYKRESAPYRDAGERQKDWDEVYNFPHVRKNLKVQAARCMECGVPFCQSNSTGCPLGNIIPKWNDLVFHGEWQEALRQLLQTNNFPEFTGRVCPAPCEGSCVLGISEPAVTIKNIECAIIDHAFEQGWIKPEIPEVRTGKRVAIVGSGPSGLAASQQLNRAGHFVTVFERNDRVGGLLQYGIPTMKLSKEVVKRRVDLMADEGIEFRTNVHVGKD-LKAEQLLQEYDAVLLTTGSTWPRDLPLANRDLKGIHFAMEFLEAQQKKQLGGKND---IISAAGKNVIIIGGGDTGCDCIATSLRQGAKSITTFEILPEPPQKRAQDNPWPQWPKVFRVDYGHEEVKLKWGKDPRQYCTTTKEFVG-ENGAIKGVNTVEVEWTK-TETGQWRMQEVAGSEKYFPADLILLAMGFLGPEKTVPSELGLELDPRGNIKASNGQYGTSNSKVFAAGDCRRGQSLVVWAITEGRQAARQVDSYLTGRPSGLPGPGGVI 2112          
BLAST of Glutamate synthase vs. Ensembl Fly
Match: CG9674 (gene:FBgn0036663 transcript:FBtr0075344)

HSP 1 Score: 2412.49 bits (6251), Expect = 0.000e+0
Identity = 1196/2053 (58.26%), Postives = 1522/2053 (74.14%), Query Frame = 2
Query:  137 PANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELPERGKFAVGMLFVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDDQSFQHEEDPLLAN----YDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVG-QKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQPKLIDATQEKVEEKNSIELEKNGLIDIEDLVT--------SNTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHH-GCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTS-LAGPGGLL 6250
            P   GLYDP  E ++CGVGF+V I+GK++HKI+ +A+ +   M HRGA + DNDTGDGAGV+  IP+ LY     + G  LPE G +A G+ ++D      + + F  + K   LE + W+    + SAIG VA+ +EP   Q+F++        K  +RQVF+LRK     + +   RFYICSLS +TVVYKG FT+ QLW++Y DLKDP ++T++A++H RFSTNTFPSWERAHP R+LAHNGEINTLRGN+NLM+AREGVM++  FG +L +L+P++EPN+SDSG  D  LEFL  AS RSLPE+V+TM+PEAW ND  M   K+ FY WAA  +EPWDGPALI+F+DGRY+GA+LDRNGLRPSR+YV+  +++ M+SE+GV  ++P  +  K RLK GR+LLVDT+ KK+I D  LK +I + RP  +W+ +  +TL ++      +     E   L A+    +D RLSLFGY+ E + ML++PM K+KKEALGSMGNDAPLACLS + P+ +EYFKQLFAQVTNPPIDPFREK+VM++ CP+GPEAN+L+PSA+Q HR+WL  PILS+ D  +L +  +RGW TK +DIT+  ++    +I+AID +CR+   A   GY+++V+SDR  G   K+++ +L+ +GA+HH+LI    R+K  ++++T EAREVHH C LLGYGADAICPY  FE+ Q LRD+GV+     D+ ++  +  A++TG+ KVMAKMGISTL SYK AQIFEAVGL  +++ KCF GT SRIGGVT E LA E L R+  TY K   D  IL NPG YHWR GGE HINEP+++  LQ +    N + F  F  ++  S + C +RGQLEFV   + I + EVEPA EIVKRF TGAMSFGSIS EAH TL+I MNRIG KSNTGEGGE  +R+L+ DP  + RSAIKQVAS RFGVT++YLA+AD+LQIKMAQGAKPGEGGELPG+KV+ +IA TR ++ GVGLISPPPHHDIYSIEDLA+LIYDLK +NP ARISVKLVSEVG+GVVASGV KGKAEHI ISGHDGGTGASSWTGIK+AGLPWELGVAETHQ L+LNNLRSRV++QADGQ+RTG DVV+AALLGADEFG STAPLIV+GCTMMRKCHLNTCPVGIATQDP LRKKF GKPEHV+N+ F+LAED+R+IMA LG R   +LIG ++ L+  +   + KAS LD   LL       P   I  G VKQDF L  R D +LI +A  +  G +  + + ++I+N++RAF STLSY I+  +G+  LP+ KSI I   G+ GQSFCAFL +G++V L+GDANDYV KGL GG VVI+ P+++ P F S  N+IVGNVCLYGA  G  +FRG A+ERFCVRNSG  AVVEG+GDHGCEYMTGG V++LG TGRNFAAGMSGGIAYVYD    F  + N + V+L P+  +  D   + + L +F +KT S +A+++L NW+E    FVKVFP EY+K L++M  Q  +    +  +E  N     +  + DIE+ +         ++  LDK +GF+KY R   PYR+  ER  DW E+Y    VRK L+ QAARCMECGVPFCQS+  GCPLGNIIPKWNDLV+   W+EAL QLLQTNNFPEFTGR CPAPCE +CVLGI+EPAVTIKNIECAIID  F++GW+ P  P+V+TGKR+ +VGSGPSGLAA+ QLN+AGH V V ERNDR+GGLLQYGIP+MK+SK+VV+RR++ M +EGIEF+T VH+G D   A++LL +YDA++L  G++WPRD+ +  R+L GIHFA+ FLE  Q+ Q    N     + A  K+VII+GGGDTG DCIATSLRQGA+S+TTFEILP P + RA  NPWP+WP+++RVDYGHEEVKL+WGKDPR +   +KEF+  ENG + G+ TV+VEWT+ ++T QW M+EV  SE  F  +++LLAMGFLGPEK + ++L LE+D R NIK  +G+Y TS  KV+AAGDCRRGQSLVV AI EGRQAAR++D  +  + S L GPGG++
Sbjct:   73 PGKQGLYDPQNEHEACGVGFIVAIDGKRSHKILRDAQTLSERMNHRGACACDNDTGDGAGVLASIPHGLYSKALAKQGVTLPELGDYATGIFYLDEAQHAAAEKEFDDLAKSLGLEVIAWRTVPSNQSAIGVVARKSEPLSRQVFVRRPAGS-DEKAFERQVFVLRKRASHELIKPGRRFYICSLSDRTVVYKGLFTSDQLWDYYTDLKDPEFETYLALVHTRFSTNTFPSWERAHPLRVLAHNGEINTLRGNVNLMKAREGVMQSDLFGDQLKKLYPVVEPNLSDSGSFDCVLEFLTMASDRSLPESVMTMVPEAWQNDKTMPQEKRDFYQWAACVMEPWDGPALISFTDGRYIGAVLDRNGLRPSRFYVTKENVLVMASEVGVYDVDPSQVTLKSRLKPGRMLLVDTKEKKLIQDIELKAKIAKSRPHSEWL-QQKITLDEIRNANVLNTPPVDELAKLPASERGIFDPRLSLFGYSTETVNMLLIPMFKNKKEALGSMGNDAPLACLSNFQPIPYEYFKQLFAQVTNPPIDPFREKVVMSMQCPLGPEANLLQPSAQQVHRIWLTNPILSIPDTQLLKRNTHRGWRTKVLDITFQYNEGVQGYIDAIDRICREGYAAAQAGYQLLVISDRGAGIDGKVAVSALLALGALHHHLIETLQRMKVGIVVETAEAREVHHICVLLGYGADAICPYLAFELAQALRDDGVIAPEVNDKQIYAAYAQAIDTGIAKVMAKMGISTLQSYKSAQIFEAVGLGSDLVAKCFRGTQSRIGGVTLEILAKEGLQRYQLTYGKATPDTRILRNPGQYHWRHGGEAHINEPSSIGSLQEAAVNKNLDAFEAFKKTTLDSVKKCALRGQLEFVTDRQSIDISEVEPASEIVKRFATGAMSFGSISLEAHQTLSITMNRIGGKSNTGEGGEDSDRYLNQDPNNSRRSAIKQVASGRFGVTASYLANADDLQIKMAQGAKPGEGGELPGYKVTKDIAKTRKSVPGVGLISPPPHHDIYSIEDLAELIYDLKCSNPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLVLNNLRSRVIVQADGQLRTGFDVVVAALLGADEFGFSTAPLIVMGCTMMRKCHLNTCPVGIATQDPELRKKFTGKPEHVINFFFMLAEDIRKIMAGLGIRKFQDLIGRTDLLRVASQR-DAKASNLDLKLLLQPALELRPGTNIVGGSVKQDFQLEKRSDNELIAKAQQIFSGADDNVTVKMRIHNEERAFGSTLSYHIACKYGEAGLPAGKSIDIFLEGSAGQSFCAFLARGVNVTLKGDANDYVGKGLCGGNVVIM-PQDTVP-FESHLNVIVGNVCLYGATEGTAYFRGIASERFCVRNSGVTAVVEGVGDHGCEYMTGGVVVILGLTGRNFAAGMSGGIAYVYDLDGSFKPKVNPESVELLPLEIEK-DVLLVKELLADFIEKTGSKVAKELLDNWAEAQGKFVKVFPYEYQKALKDMAEQQAVEQPLKSAIENGNG--KHEPHIKDIEEAIQDVVLEQKRADRVLDKTRGFVKYKRESAPYRDAGERQKDWDEVYNFPHVRKNLKVQAARCMECGVPFCQSNSTGCPLGNIIPKWNDLVFHGEWQEALRQLLQTNNFPEFTGRVCPAPCEGSCVLGISEPAVTIKNIECAIIDHAFEQGWIKPEIPEVRTGKRVAIVGSGPSGLAASQQLNRAGHFVTVFERNDRVGGLLQYGIPTMKLSKEVVKRRVDLMADEGIEFRTNVHVGKD-LKAEQLLQEYDAVLLTTGSTWPRDLPLANRDLKGIHFAMEFLEAQQKKQLGGKND---IISAAGKNVIIIGGGDTGCDCIATSLRQGAKSITTFEILPEPPQKRAQDNPWPQWPKVFRVDYGHEEVKLKWGKDPRQYCTTTKEFVG-ENGAIKGVNTVEVEWTK-TETGQWRMQEVAGSEKYFPADLILLAMGFLGPEKTVPSELGLELDPRGNIKASNGQYGTSNSKVFAAGDCRRGQSLVVWAITEGRQAARQVDSYLTGRPSGLPGPGGVI 2111          
BLAST of Glutamate synthase vs. Ensembl Fly
Match: CG9674 (gene:FBgn0036663 transcript:FBtr0075341)

HSP 1 Score: 2412.49 bits (6251), Expect = 0.000e+0
Identity = 1196/2053 (58.26%), Postives = 1522/2053 (74.14%), Query Frame = 2
Query:  137 PANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELPERGKFAVGMLFVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDDQSFQHEEDPLLAN----YDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVG-QKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQPKLIDATQEKVEEKNSIELEKNGLIDIEDLVT--------SNTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHH-GCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTS-LAGPGGLL 6250
            P   GLYDP  E ++CGVGF+V I+GK++HKI+ +A+ +   M HRGA + DNDTGDGAGV+  IP+ LY     + G  LPE G +A G+ ++D      + + F  + K   LE + W+    + SAIG VA+ +EP   Q+F++        K  +RQVF+LRK     + +   RFYICSLS +TVVYKG FT+ QLW++Y DLKDP ++T++A++H RFSTNTFPSWERAHP R+LAHNGEINTLRGN+NLM+AREGVM++  FG +L +L+P++EPN+SDSG  D  LEFL  AS RSLPE+V+TM+PEAW ND  M   K+ FY WAA  +EPWDGPALI+F+DGRY+GA+LDRNGLRPSR+YV+  +++ M+SE+GV  ++P  +  K RLK GR+LLVDT+ KK+I D  LK +I + RP  +W+ +  +TL ++      +     E   L A+    +D RLSLFGY+ E + ML++PM K+KKEALGSMGNDAPLACLS + P+ +EYFKQLFAQVTNPPIDPFREK+VM++ CP+GPEAN+L+PSA+Q HR+WL  PILS+ D  +L +  +RGW TK +DIT+  ++    +I+AID +CR+   A   GY+++V+SDR  G   K+++ +L+ +GA+HH+LI    R+K  ++++T EAREVHH C LLGYGADAICPY  FE+ Q LRD+GV+     D+ ++  +  A++TG+ KVMAKMGISTL SYK AQIFEAVGL  +++ KCF GT SRIGGVT E LA E L R+  TY K   D  IL NPG YHWR GGE HINEP+++  LQ +    N + F  F  ++  S + C +RGQLEFV   + I + EVEPA EIVKRF TGAMSFGSIS EAH TL+I MNRIG KSNTGEGGE  +R+L+ DP  + RSAIKQVAS RFGVT++YLA+AD+LQIKMAQGAKPGEGGELPG+KV+ +IA TR ++ GVGLISPPPHHDIYSIEDLA+LIYDLK +NP ARISVKLVSEVG+GVVASGV KGKAEHI ISGHDGGTGASSWTGIK+AGLPWELGVAETHQ L+LNNLRSRV++QADGQ+RTG DVV+AALLGADEFG STAPLIV+GCTMMRKCHLNTCPVGIATQDP LRKKF GKPEHV+N+ F+LAED+R+IMA LG R   +LIG ++ L+  +   + KAS LD   LL       P   I  G VKQDF L  R D +LI +A  +  G +  + + ++I+N++RAF STLSY I+  +G+  LP+ KSI I   G+ GQSFCAFL +G++V L+GDANDYV KGL GG VVI+ P+++ P F S  N+IVGNVCLYGA  G  +FRG A+ERFCVRNSG  AVVEG+GDHGCEYMTGG V++LG TGRNFAAGMSGGIAYVYD    F  + N + V+L P+  +  D   + + L +F +KT S +A+++L NW+E    FVKVFP EY+K L++M  Q  +    +  +E  N     +  + DIE+ +         ++  LDK +GF+KY R   PYR+  ER  DW E+Y    VRK L+ QAARCMECGVPFCQS+  GCPLGNIIPKWNDLV+   W+EAL QLLQTNNFPEFTGR CPAPCE +CVLGI+EPAVTIKNIECAIID  F++GW+ P  P+V+TGKR+ +VGSGPSGLAA+ QLN+AGH V V ERNDR+GGLLQYGIP+MK+SK+VV+RR++ M +EGIEF+T VH+G D   A++LL +YDA++L  G++WPRD+ +  R+L GIHFA+ FLE  Q+ Q    N     + A  K+VII+GGGDTG DCIATSLRQGA+S+TTFEILP P + RA  NPWP+WP+++RVDYGHEEVKL+WGKDPR +   +KEF+  ENG + G+ TV+VEWT+ ++T QW M+EV  SE  F  +++LLAMGFLGPEK + ++L LE+D R NIK  +G+Y TS  KV+AAGDCRRGQSLVV AI EGRQAAR++D  +  + S L GPGG++
Sbjct:   73 PGKQGLYDPQNEHEACGVGFIVAIDGKRSHKILRDAQTLSERMNHRGACACDNDTGDGAGVLASIPHGLYSKALAKQGVTLPELGDYATGIFYLDEAQHAAAEKEFDDLAKSLGLEVIAWRTVPSNQSAIGVVARKSEPLSRQVFVRRPAGS-DEKAFERQVFVLRKRASHELIKPGRRFYICSLSDRTVVYKGLFTSDQLWDYYTDLKDPEFETYLALVHTRFSTNTFPSWERAHPLRVLAHNGEINTLRGNVNLMKAREGVMQSDLFGDQLKKLYPVVEPNLSDSGSFDCVLEFLTMASDRSLPESVMTMVPEAWQNDKTMPQEKRDFYQWAACVMEPWDGPALISFTDGRYIGAVLDRNGLRPSRFYVTKENVLVMASEVGVYDVDPSQVTLKSRLKPGRMLLVDTKEKKLIQDIELKAKIAKSRPHSEWL-QQKITLDEIRNANVLNTPPVDELAKLPASERGIFDPRLSLFGYSTETVNMLLIPMFKNKKEALGSMGNDAPLACLSNFQPIPYEYFKQLFAQVTNPPIDPFREKVVMSMQCPLGPEANLLQPSAQQVHRIWLTNPILSIPDTQLLKRNTHRGWRTKVLDITFQYNEGVQGYIDAIDRICREGYAAAQAGYQLLVISDRGAGIDGKVAVSALLALGALHHHLIETLQRMKVGIVVETAEAREVHHICVLLGYGADAICPYLAFELAQALRDDGVIAPEVNDKQIYAAYAQAIDTGIAKVMAKMGISTLQSYKSAQIFEAVGLGSDLVAKCFRGTQSRIGGVTLEILAKEGLQRYQLTYGKATPDTRILRNPGQYHWRHGGEAHINEPSSIGSLQEAAVNKNLDAFEAFKKTTLDSVKKCALRGQLEFVTDRQSIDISEVEPASEIVKRFATGAMSFGSISLEAHQTLSITMNRIGGKSNTGEGGEDSDRYLNQDPNNSRRSAIKQVASGRFGVTASYLANADDLQIKMAQGAKPGEGGELPGYKVTKDIAKTRKSVPGVGLISPPPHHDIYSIEDLAELIYDLKCSNPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQVLVLNNLRSRVIVQADGQLRTGFDVVVAALLGADEFGFSTAPLIVMGCTMMRKCHLNTCPVGIATQDPELRKKFTGKPEHVINFFFMLAEDIRKIMAGLGIRKFQDLIGRTDLLRVASQR-DAKASNLDLKLLLQPALELRPGTNIVGGSVKQDFQLEKRSDNELIAKAQQIFSGADDNVTVKMRIHNEERAFGSTLSYHIACKYGEAGLPAGKSIDIFLEGSAGQSFCAFLARGVNVTLKGDANDYVGKGLCGGNVVIM-PQDTVP-FESHLNVIVGNVCLYGATEGTAYFRGIASERFCVRNSGVTAVVEGVGDHGCEYMTGGVVVILGLTGRNFAAGMSGGIAYVYDLDGSFKPKVNPESVELLPLEIEK-DVLLVKELLADFIEKTGSKVAKELLDNWAEAQGKFVKVFPYEYQKALKDMAEQQAVEQPLKSAIENGNG--KHEPHIKDIEEAIQDVVLEQKRADRVLDKTRGFVKYKRESAPYRDAGERQKDWDEVYNFPHVRKNLKVQAARCMECGVPFCQSNSTGCPLGNIIPKWNDLVFHGEWQEALRQLLQTNNFPEFTGRVCPAPCEGSCVLGISEPAVTIKNIECAIIDHAFEQGWIKPEIPEVRTGKRVAIVGSGPSGLAASQQLNRAGHFVTVFERNDRVGGLLQYGIPTMKLSKEVVKRRVDLMADEGIEFRTNVHVGKD-LKAEQLLQEYDAVLLTTGSTWPRDLPLANRDLKGIHFAMEFLEAQQKKQLGGKND---IISAAGKNVIIIGGGDTGCDCIATSLRQGAKSITTFEILPEPPQKRAQDNPWPQWPKVFRVDYGHEEVKLKWGKDPRQYCTTTKEFVG-ENGAIKGVNTVEVEWTK-TETGQWRMQEVAGSEKYFPADLILLAMGFLGPEKTVPSELGLELDPRGNIKASNGQYGTSNSKVFAAGDCRRGQSLVVWAITEGRQAARQVDSYLTGRPSGLPGPGGVI 2111          
BLAST of Glutamate synthase vs. Ensembl Fly
Match: CG9674 (gene:FBgn0036663 transcript:FBtr0333609)

HSP 1 Score: 1294.26 bits (3348), Expect = 0.000e+0
Identity = 630/1084 (58.12%), Postives = 805/1084 (74.26%), Query Frame = 2
Query:  137 PANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELPERGKFAVGMLFVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDDQSFQHEEDPLLAN----YDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVG-QKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQ 3373
            P   GLYDP  E ++CGVGF+V I+GK++HKI+ +A+ +   M HRGA + DNDTGDGAGV+  IP+ LY     + G  LPE G +A G+ ++D      + + F  + K   LE + W+    + SAIG VA+ +EP   Q+F++        K  +RQVF+LRK     + +   RFYICSLS +TVVYKG FT+ QLW++Y DLKDP ++T++A++H RFSTNTFPSWERAHP R+LAHNGEINTLRGN+NLM+AREGVM++  FG +L +L+P++EPN+SDSG  D  LEFL  AS RSLPE+V+TM+PEAW ND  M   K+ FY WAA  +EPWDGPALI+F+DGRY+GA+LDRNGLRPSR+YV+  +++ M+SE+GV  ++P  +  K RLK GR+LLVDT+ KK+I D  LK +I + RP  +W+ +  +TL ++      +     E   L A+    +D RLSLFGY+ E + ML++PM K+KKEALGSMGNDAPLACLS + P+ +EYFKQLFAQVTNPPIDPFREK+VM++ CP+GPEAN+L+PSA+Q HR+WL  PILS+ D  +L +  +RGW TK +DIT+  ++    +I+AID +CR+   A   GY+++V+SDR  G   K+++ +L+ +GA+HH+LI    R+K  ++++T EAREVHH C LLGYGADAICPY  FE+ Q LRD+GV+     D+ ++  +  A++TG+ KVMAKMGISTL SYK AQIFEAVGL  +++ KCF GT SRIGGVT E LA E L R+  TY K   D  IL NPG YHWR GGE HINEP+++  LQ +    N + F  F  ++  S + C +RGQLEFV   + I + EVEPA EIVKRF TGAMSFGSIS EAH TL+I MNRIG KSNTGEGGE  +R+L+ DP  + RSAIKQVAS RFGVT++YLA+AD+LQIKMAQGAKPGEGGELPG+KV+ +IA TR ++ GVGLISPPPHHDIYSIEDLA+LIYDLK +NP ARISVKLVSEVG+GVVASGV KGKAEHI ISGHDGGTGASSWTGIK+AGLPWELGVAETHQ
Sbjct:   73 PGKQGLYDPQNEHEACGVGFIVAIDGKRSHKILRDAQTLSERMNHRGACACDNDTGDGAGVLASIPHGLYSKALAKQGVTLPELGDYATGIFYLDEAQHAAAEKEFDDLAKSLGLEVIAWRTVPSNQSAIGVVARKSEPLSRQVFVRRPAGS-DEKAFERQVFVLRKRASHELIKPGRRFYICSLSDRTVVYKGLFTSDQLWDYYTDLKDPEFETYLALVHTRFSTNTFPSWERAHPLRVLAHNGEINTLRGNVNLMKAREGVMQSDLFGDQLKKLYPVVEPNLSDSGSFDCVLEFLTMASDRSLPESVMTMVPEAWQNDKTMPQEKRDFYQWAACVMEPWDGPALISFTDGRYIGAVLDRNGLRPSRFYVTKENVLVMASEVGVYDVDPSQVTLKSRLKPGRMLLVDTKEKKLIQDIELKAKIAKSRPHSEWL-QQKITLDEIRNANVLNTPPVDELAKLPASERGIFDPRLSLFGYSTETVNMLLIPMFKNKKEALGSMGNDAPLACLSNFQPIPYEYFKQLFAQVTNPPIDPFREKVVMSMQCPLGPEANLLQPSAQQVHRIWLTNPILSIPDTQLLKRNTHRGWRTKVLDITFQYNEGVQGYIDAIDRICREGYAAAQAGYQLLVISDRGAGIDGKVAVSALLALGALHHHLIETLQRMKVGIVVETAEAREVHHICVLLGYGADAICPYLAFELAQALRDDGVIAPEVNDKQIYAAYAQAIDTGIAKVMAKMGISTLQSYKSAQIFEAVGLGSDLVAKCFRGTQSRIGGVTLEILAKEGLQRYQLTYGKATPDTRILRNPGQYHWRHGGEAHINEPSSIGSLQEAAVNKNLDAFEAFKKTTLDSVKKCALRGQLEFVTDRQSIDISEVEPASEIVKRFATGAMSFGSISLEAHQTLSITMNRIGGKSNTGEGGEDSDRYLNQDPNNSRRSAIKQVASGRFGVTASYLANADDLQIKMAQGAKPGEGGELPGYKVTKDIAKTRKSVPGVGLISPPPHHDIYSIEDLAELIYDLKCSNPNARISVKLVSEVGVGVVASGVAKGKAEHIVISGHDGGTGASSWTGIKNAGLPWELGVAETHQ 1154          
BLAST of Glutamate synthase vs. Ensembl Zebrafish
Match: dpydb (dihydropyrimidine dehydrogenase b [Source:NCBI gene;Acc:405829])

HSP 1 Score: 95.1301 bits (235), Expect = 7.835e-19
Identity = 114/496 (22.98%), Postives = 201/496 (40.52%), Query Frame = 2
Query: 4802 KNPYRNVEERIN---DWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGK-------------RIVVVGSGPSGLAAAAQLNKAGH-AVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWP---RDINIPGRNL-SGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDV--FNCNMVLLAMGFLGPEKEIINQLK-LEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMN 6217
            +NP R+ +  +N   ++ +I       +G  R+A RC++C    CQ    CP    I  +   +   N+  A   +L  N      G  CP      CV G N  A     I    + +   E +     P+++  +             RI ++G GP+ ++ A+ L + G+  + + E+   IGGL    IP  ++  +VVQ  I+ M + G++      +G +      L  +   +V  +G   P   RD    G     G + +  FL    +  +        Q+     +VI+LG GDT  DC  ++LR GAR V  F +       R  +      P         EE++    +       +S   +  +NG V+G+R  + E   D     W + E    E +     + ++ A G +  +  +   L  ++++     +  S   QT+ P V+A GD     +  V ++N+G+QA+  I K I +
Sbjct:   43 RNPERSCDSCVNLENNFDDIKHTTLSERGALREALRCLKCADAPCQ--KSCPTNLDIKSFITSISNKNYYGAAKAILSDNPLGLTCGMVCPT--SDLCVGGCNLYASEEGPINIGGLQQFATEVFSKMGIPQIRNPELPTADNMPKSFHTRIALIGCGPASISCASFLARLGYDNITIFEKQKYIGGLSTSEIPQFRLPYEVVQFEIDLMKDLGVKVVLEKGLGQNGLTLTSLKEEGYQVVF-IGIGLPQANRDKIFEGLTTEQGFYTSKDFLPLVAKASKIGMCNCRSQLPKLHGNVIVLGAGDTAFDCATSALRCGARRV--FVVF------RKGFTNIRAVP---------EEMEAAKEEKCEFLPFLSPHEVMKKNGRVSGLRFCRTEQQEDG---TWIVDE----EQIVHLKADFIISAFGSMLNDPAVTKALDPIKLNRWGTPEVNSETMQTTEPWVFAGGDIAGFANTTVESVNDGKQASWHIHKYIQS 509          
BLAST of Glutamate synthase vs. Ensembl Zebrafish
Match: dpydb (dihydropyrimidine dehydrogenase b [Source:NCBI gene;Acc:405829])

HSP 1 Score: 91.6633 bits (226), Expect = 7.160e-18
Identity = 111/482 (23.03%), Postives = 194/482 (40.25%), Query Frame = 2
Query: 4835 NDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGK-------------RIVVVGSGPSGLAAAAQLNKAGH-AVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWP---RDINIPGRNL-SGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDV--FNCNMVLLAMGFLGPEKEIINQL-KLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMN 6217
            N++ +I       +G  R+A RC++C    CQ    CP    I  +   +   N+  A   +L  N      G  CP      CV G N  A     I    + +   E +     P+++  +             RI ++G GP+ ++ A+ L + G+  + + E+   IGGL    IP  ++  +VVQ  I+ M + G++      +G +      L  +   +V  +G   P   RD    G     G + +  FL    +  +        Q+     +VI+LG GDT  DC  ++LR GAR V  F +       R  +      P         EE++    +       +S   +  +NG V+G+R  + E   D     W + E    E +     + ++ A G +  +  +   L  ++++     +  S   QT+ P V+A GD     +  V ++N+G+QA+  I K I +
Sbjct:   20 NNFDDIKHTTLSERGALREALRCLKCADAPCQ--KSCPTNLDIKSFITSISNKNYYGAAKAILSDNPLGLTCGMVCPT--SDLCVGGCNLYASEEGPINIGGLQQFATEVFSKMGIPQIRNPELPTADNMPKSFHTRIALIGCGPASISCASFLARLGYDNITIFEKQKYIGGLSTSEIPQFRLPYEVVQFEIDLMKDLGVKVVLEKGLGQNGLTLTSLKEEGYQVVF-IGIGLPQANRDKIFEGLTTEQGFYTSKDFLPLVAKASKIGMCNCRSQLPKLHGNVIVLGAGDTAFDCATSALRCGARRV--FVVF------RKGFTNIRAVP---------EEMEAAKEEKCEFLPFLSPHEVMKKNGRVSGLRFCRTEQQEDG---TWIVDE----EQIVHLKADFIISAFGSMLNDPAVTKALDPIKLNRWGTPEVNSETMQTTEPWVFAGGDIAGFANTTVESVNDGKQASWHIHKYIQS 472          
BLAST of Glutamate synthase vs. Ensembl Zebrafish
Match: dpydb (dihydropyrimidine dehydrogenase b [Source:NCBI gene;Acc:405829])

HSP 1 Score: 84.3445 bits (207), Expect = 1.442e-15
Identity = 106/461 (22.99%), Postives = 184/461 (39.91%), Query Frame = 2
Query: 4898 RCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGK-------------RIVVVGSGPSGLAAAAQLNKAGH-AVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWP---RDINIPGRNL-SGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDV--FNCNMVLLAMGFLGPEKEIINQL-KLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMN 6217
            RC++C    CQ    CP    I  +   +   N+  A   +L  N      G  CP      CV G N  A     I    + +   E +     P+++  +             RI ++G GP+ ++ A+ L + G+  + + E+   IGGL    IP  ++  +VVQ  I+ M + G++      +G +      L  +   +V  +G   P   RD    G     G + +  FL    +  +        Q+     +VI+LG GDT  DC  ++LR GAR V  F +       R  +      P         EE++    +       +S   +  +NG V+G+R  + E   D     W + E    E +     + ++ A G +  +  +   L  ++++     +  S   QT+ P V+A GD     +  V ++N+G+QA+  I K I +
Sbjct:    1 RCLKCADAPCQKS--CPTNLDIKSFITSISNKNYYGAAKAILSDNPLGLTCGMVCPT--SDLCVGGCNLYASEEGPINIGGLQQFATEVFSKMGIPQIRNPELPTADNMPKSFHTRIALIGCGPASISCASFLARLGYDNITIFEKQKYIGGLSTSEIPQFRLPYEVVQFEIDLMKDLGVKVVLEKGLGQNGLTLTSLKEEGYQVVF-IGIGLPQANRDKIFEGLTTEQGFYTSKDFLPLVAKASKIGMCNCRSQLPKLHGNVIVLGAGDTAFDCATSALRCGARRV--FVVF------RKGFTNIRAVP---------EEMEAAKEEKCEFLPFLSPHEVMKKNGRVSGLRFCRTEQQEDG---TWIVDE----EQIVHLKADFIISAFGSMLNDPAVTKALDPIKLNRWGTPEVNSETMQTTEPWVFAGGDIAGFANTTVESVNDGKQASWHIHKYIQS 432          
BLAST of Glutamate synthase vs. Ensembl Zebrafish
Match: fdxr (ferredoxin reductase [Source:ZFIN;Acc:ZDB-GENE-130613-2])

HSP 1 Score: 58.5362 bits (140), Expect = 7.055e-8
Identity = 50/157 (31.85%), Postives = 75/157 (47.77%), Query Frame = 2
Query: 5204 RIVVVGSGPSGLAAAAQLNKAGHAVLV--LERNDRIGGLLQYGI-PSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVD 5665
            R+ VVG GP+G   A QL KA    +V   ER     GL+++G+ P     K+V+         E   F   V++G D    ++L   Y A+VL  GA   R + IPG +L  +  A  F+  W  +    SNTE    L+ +   ++LG G+  +D
Sbjct:   40 RVCVVGGGPAGFYTAQQLLKARQDAVVDIYERLPVPFGLVRFGVAPDHPEVKNVINTFTQTAQHERCSFHGNVNVGKD-VTIEELRQAYHAVVLSYGAEGNRSMGIPGEDLCNVFSAKDFV-GW--YNGVPSNTELCPDLSCET-AVVLGQGNVALD 191          
BLAST of Glutamate synthase vs. Ensembl Zebrafish
Match: fdxr (ferredoxin reductase [Source:ZFIN;Acc:ZDB-GENE-130613-2])

HSP 1 Score: 58.5362 bits (140), Expect = 7.055e-8
Identity = 50/157 (31.85%), Postives = 75/157 (47.77%), Query Frame = 2
Query: 5204 RIVVVGSGPSGLAAAAQLNKAGHAVLV--LERNDRIGGLLQYGI-PSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVD 5665
            R+ VVG GP+G   A QL KA    +V   ER     GL+++G+ P     K+V+         E   F   V++G D    ++L   Y A+VL  GA   R + IPG +L  +  A  F+  W  +    SNTE    L+ +   ++LG G+  +D
Sbjct:   40 RVCVVGGGPAGFYTAQQLLKARQDAVVDIYERLPVPFGLVRFGVAPDHPEVKNVINTFTQTAQHERCSFHGNVNVGKD-VTIEELRQAYHAVVLSYGAEGNRSMGIPGEDLCNVFSAKDFV-GW--YNGVPSNTELCPDLSCET-AVVLGQGNVALD 191          
BLAST of Glutamate synthase vs. Ensembl Xenopus
Match: rab25 (RAB25, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-494256])

HSP 1 Score: 97.4413 bits (241), Expect = 1.809e-19
Identity = 118/526 (22.43%), Postives = 213/526 (40.49%), Query Frame = 2
Query: 4727 IDIEDLVTSN------TNLDKLKGFIKYPRH--KNPYRNV---EERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGK-------------RIVVVGSGPSGLAAAAQLNKAGHA-VLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLND-YDAIVLCVGASWPR--DINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNI-KTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMN 6217
            +DIE+++T N       +L       +  +H  +NP R+    E+  N++ +I       +G  R+A RC++C    CQ    CP    I  +   +   N+  A   +   N      G  CP      CV G N  A     I    + +   E +   + P+++                +I ++G+GP+ ++ A+ L + G++ + V E+   +GGL    IP  ++  DVV   I  M + G++   G  +G +      L  + + AI + +G   P+  D+        G + +  FL    +  +         + +    VI+LG GDT  DC  ++LR GAR V  F +       R  +      P         EEV+L   +       +S   +  + G ++G+  V+ E   D     W   E  + +      +V+ A G +  +  ++  +K    +R  + +      QTS   V+  GD     +  V ++N+G+QA+  I K I +
Sbjct:   10 LDIENILTLNPRTPTHASLYSTAAKKQAKKHWKRNPDRSCSKCEKLENNFDDIKHTTLGERGALREAMRCLKCADAPCQ--KSCPTNLDIKSFITSIANKNYYGAAKAIFSDNPLGLTCGMVCPT--SDLCVGGCNLYATEEGPINIGGLQQFATEIFKTMNIPQIRNPSLPATEAMPAQYKTKIALIGAGPASISCASFLARLGYSDITVFEKQKYLGGLSTSEIPQFRLPYDVVSFEIELMKDLGVKVIEGKGLGMNGMNIRSLKEEGFKAIFIGIGLPQPKIDDVFTGLTTEHGFYTSKDFLPLVAKASKQGMCACRSPLPSIKGPVIVLGAGDTAFDCATSALRCGARRV--FVVF------RKGFTNMRAVP---------EEVELAKEEKCEFLPFLSPRKVILKGGKISGMEFVRTEQDDDG---NWIEDE--DQKIQLKAEVVISAFGSVLTDPAVLEAMKPIKFNRWGLPEADPVTMQTSEAGVFVGGDIAGLANTTVESVNDGKQASWHIHKHIQS 509          
BLAST of Glutamate synthase vs. Ensembl Xenopus
Match: rab25 (RAB25, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-494256])

HSP 1 Score: 96.6709 bits (239), Expect = 3.576e-19
Identity = 111/493 (22.52%), Postives = 199/493 (40.37%), Query Frame = 2
Query: 4802 KNPYRNV---EERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGK-------------RIVVVGSGPSGLAAAAQLNKAGHA-VLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLND-YDAIVLCVGASWPR--DINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNI-KTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMN 6217
            +NP R+    E+  N++ +I       +G  R+A RC++C    CQ    CP    I  +   +   N+  A   +   N      G  CP      CV G N  A     I    + +   E +   + P+++                +I ++G+GP+ ++ A+ L + G++ + V E+   +GGL    IP  ++  DVV   I  M + G++   G  +G +      L  + + AI + +G   P+  D+        G + +  FL    +  +         + +    VI+LG GDT  DC  ++LR GAR V  F +       R  +      P         EEV+L   +       +S   +  + G ++G+  V+ E   D     W   E  + +      +V+ A G +  +  ++  +K    +R  + +      QTS   V+  GD     +  V ++N+G+QA+  I K I +
Sbjct:   45 RNPDRSCSKCEKLENNFDDIKHTTLGERGALREAMRCLKCADAPCQ--KSCPTNLDIKSFITSIANKNYYGAAKAIFSDNPLGLTCGMVCPT--SDLCVGGCNLYATEEGPINIGGLQQFATEIFKTMNIPQIRNPSLPATEAMPAQYKTKIALIGAGPASISCASFLARLGYSDITVFEKQKYLGGLSTSEIPQFRLPYDVVSFEIELMKDLGVKVIEGKGLGMNGMNIRSLKEEGFKAIFIGIGLPQPKIDDVFTGLTTEHGFYTSKDFLPLVAKASKQGMCACRSPLPSIKGPVIVLGAGDTAFDCATSALRCGARRV--FVVF------RKGFTNMRAVP---------EEVELAKEEKCEFLPFLSPRKVILKGGKISGMEFVRTEQDDDG---NWIEDE--DQKIQLKAEVVISAFGSVLTDPAVLEAMKPIKFNRWGLPEADPVTMQTSEAGVFVGGDIAGLANTTVESVNDGKQASWHIHKHIQS 511          
BLAST of Glutamate synthase vs. Ensembl Xenopus
Match: rab25 (RAB25, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-494256])

HSP 1 Score: 96.6709 bits (239), Expect = 3.661e-19
Identity = 111/493 (22.52%), Postives = 199/493 (40.37%), Query Frame = 2
Query: 4802 KNPYRNV---EERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGK-------------RIVVVGSGPSGLAAAAQLNKAGHA-VLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLND-YDAIVLCVGASWPR--DINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNI-KTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMN 6217
            +NP R+    E+  N++ +I       +G  R+A RC++C    CQ    CP    I  +   +   N+  A   +   N      G  CP      CV G N  A     I    + +   E +   + P+++                +I ++G+GP+ ++ A+ L + G++ + V E+   +GGL    IP  ++  DVV   I  M + G++   G  +G +      L  + + AI + +G   P+  D+        G + +  FL    +  +         + +    VI+LG GDT  DC  ++LR GAR V  F +       R  +      P         EEV+L   +       +S   +  + G ++G+  V+ E   D     W   E  + +      +V+ A G +  +  ++  +K    +R  + +      QTS   V+  GD     +  V ++N+G+QA+  I K I +
Sbjct:   33 RNPDRSCSKCEKLENNFDDIKHTTLGERGALREAMRCLKCADAPCQ--KSCPTNLDIKSFITSIANKNYYGAAKAIFSDNPLGLTCGMVCPT--SDLCVGGCNLYATEEGPINIGGLQQFATEIFKTMNIPQIRNPSLPATEAMPAQYKTKIALIGAGPASISCASFLARLGYSDITVFEKQKYLGGLSTSEIPQFRLPYDVVSFEIELMKDLGVKVIEGKGLGMNGMNIRSLKEEGFKAIFIGIGLPQPKIDDVFTGLTTEHGFYTSKDFLPLVAKASKQGMCACRSPLPSIKGPVIVLGAGDTAFDCATSALRCGARRV--FVVF------RKGFTNMRAVP---------EEVELAKEEKCEFLPFLSPRKVILKGGKISGMEFVRTEQDDDG---NWIEDE--DQKIQLKAEVVISAFGSVLTDPAVLEAMKPIKFNRWGLPEADPVTMQTSEAGVFVGGDIAGLANTTVESVNDGKQASWHIHKHIQS 499          
BLAST of Glutamate synthase vs. Ensembl Xenopus
Match: rab25 (RAB25, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-494256])

HSP 1 Score: 96.2857 bits (238), Expect = 4.128e-19
Identity = 111/493 (22.52%), Postives = 199/493 (40.37%), Query Frame = 2
Query: 4802 KNPYRNV---EERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGK-------------RIVVVGSGPSGLAAAAQLNKAGHA-VLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLND-YDAIVLCVGASWPR--DINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNI-KTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMN 6217
            +NP R+    E+  N++ +I       +G  R+A RC++C    CQ    CP    I  +   +   N+  A   +   N      G  CP      CV G N  A     I    + +   E +   + P+++                +I ++G+GP+ ++ A+ L + G++ + V E+   +GGL    IP  ++  DVV   I  M + G++   G  +G +      L  + + AI + +G   P+  D+        G + +  FL    +  +         + +    VI+LG GDT  DC  ++LR GAR V  F +       R  +      P         EEV+L   +       +S   +  + G ++G+  V+ E   D     W   E  + +      +V+ A G +  +  ++  +K    +R  + +      QTS   V+  GD     +  V ++N+G+QA+  I K I +
Sbjct:   45 RNPDRSCSKCEKLENNFDDIKHTTLGERGALREAMRCLKCADAPCQ--KSCPTNLDIKSFITSIANKNYYGAAKAIFSDNPLGLTCGMVCPT--SDLCVGGCNLYATEEGPINIGGLQQFATEIFKTMNIPQIRNPSLPATEAMPAQYKTKIALIGAGPASISCASFLARLGYSDITVFEKQKYLGGLSTSEIPQFRLPYDVVSFEIELMKDLGVKVIEGKGLGMNGMNIRSLKEEGFKAIFIGIGLPQPKIDDVFTGLTTEHGFYTSKDFLPLVAKASKQGMCACRSPLPSIKGPVIVLGAGDTAFDCATSALRCGARRV--FVVF------RKGFTNMRAVP---------EEVELAKEEKCEFLPFLSPRKVILKGGKISGMEFVRTEQDDDG---NWIEDE--DQKIQLKAEVVISAFGSVLTDPAVLEAMKPIKFNRWGLPEADPVTMQTSEAGVFVGGDIAGLANTTVESVNDGKQASWHIHKHIQS 511          
BLAST of Glutamate synthase vs. Ensembl Xenopus
Match: rab25 (RAB25, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-494256])

HSP 1 Score: 96.2857 bits (238), Expect = 4.468e-19
Identity = 111/493 (22.52%), Postives = 199/493 (40.37%), Query Frame = 2
Query: 4802 KNPYRNV---EERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGK-------------RIVVVGSGPSGLAAAAQLNKAGHA-VLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLND-YDAIVLCVGASWPR--DINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNI-KTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMN 6217
            +NP R+    E+  N++ +I       +G  R+A RC++C    CQ    CP    I  +   +   N+  A   +   N      G  CP      CV G N  A     I    + +   E +   + P+++                +I ++G+GP+ ++ A+ L + G++ + V E+   +GGL    IP  ++  DVV   I  M + G++   G  +G +      L  + + AI + +G   P+  D+        G + +  FL    +  +         + +    VI+LG GDT  DC  ++LR GAR V  F +       R  +      P         EEV+L   +       +S   +  + G ++G+  V+ E   D     W   E  + +      +V+ A G +  +  ++  +K    +R  + +      QTS   V+  GD     +  V ++N+G+QA+  I K I +
Sbjct:   33 RNPDRSCSKCEKLENNFDDIKHTTLGERGALREAMRCLKCADAPCQ--KSCPTNLDIKSFITSIANKNYYGAAKAIFSDNPLGLTCGMVCPT--SDLCVGGCNLYATEEGPINIGGLQQFATEIFKTMNIPQIRNPSLPATEAMPAQYKTKIALIGAGPASISCASFLARLGYSDITVFEKQKYLGGLSTSEIPQFRLPYDVVSFEIELMKDLGVKVIEGKGLGMNGMNIRSLKEEGFKAIFIGIGLPQPKIDDVFTGLTTEHGFYTSKDFLPLVAKASKQGMCACRSPLPSIKGPVIVLGAGDTAFDCATSALRCGARRV--FVVF------RKGFTNMRAVP---------EEVELAKEEKCEFLPFLSPRKVILKGGKISGMEFVRTEQDDDG---NWIEDE--DQKIQLKAEVVISAFGSVLTDPAVLEAMKPIKFNRWGLPEADPVTMQTSEAGVFVGGDIAGLANTTVESVNDGKQASWHIHKHIQS 499          
BLAST of Glutamate synthase vs. Ensembl Mouse
Match: Dpyd (dihydropyrimidine dehydrogenase [Source:MGI Symbol;Acc:MGI:2139667])

HSP 1 Score: 96.2857 bits (238), Expect = 3.224e-19
Identity = 112/488 (22.95%), Postives = 195/488 (39.96%), Query Frame = 2
Query: 4859 HKTV-RKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKT-------------GKRIVVVGSGPSGLAAAAQLNKAGHA-VLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLL-NDYDAIVLCVGASWPRDINIPG--RNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGA-RSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPE---KEIINQLKL------EVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTSLAGP 6238
            H T+  +G  R+A RC++C    CQ    CP    I  +   +   N+  A   +   N      G  CP      CV G N  A     I    + +   E +   + P+++                +I + G+GP+ ++ A+ L + G++ + + E+ + +GGL    IP  ++  DVV   I  M + G++   G  +  D+     L  N Y A  + +G   P+  +I      + G + +  FL    +  +      +  + +    VI+LG GDT  DC  ++LR GA R    F       K   +    P            EE++L   +       +S   +  ++G +  ++ V+ E     +T  W   E          ++V+ A G +  +   KE ++ +K       EV+  T         QTS P V+A GD     +  V ++N+G+QA+  I K I  Q   + P
Sbjct:   64 HTTLGERGALREAVRCLKCADAPCQ--KSCPTSLDIKSFITSIANKNYYGAAKLIFSDNPLGLTCGMVCPT--SDLCVGGCNLHAAEEGPINIGGLQQFATEVFKAMNIPQIRNPSLPPPEHMPEAYSAKIALFGAGPASISCASFLARLGYSNITIFEKQEYVGGLSTSEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSTDEMTLSSLKENGYRAAFIGIGLPEPKKDHIFQGLTQVQGFYTSKDFLPLVAKSSKTGMCACHSPLPSIRGAVIVLGAGDTAFDCATSALRCGALRVFIVFR------KGFVNIRAVP------------EEMELAKEEKCEFLPFLSPRKVIVKDGKIVAMQFVRTE---QDETGNWVEDEEQTVR--LKADVVISAFGSVLEDPKVKEALSPIKFNRWGLPEVNPET--------MQTSEPWVFAGGDVVGMANTTVESVNDGKQASWYIHKHIQAQYGTSVP 516          
BLAST of Glutamate synthase vs. UniProt/SwissProt
Match: sp|Q9C102|GLT1_SCHPO (Putative glutamate synthase [NADPH] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=glt1 PE=2 SV=1)

HSP 1 Score: 2129.37 bits (5516), Expect = 0.000e+0
Identity = 1096/2069 (52.97%), Postives = 1438/2069 (69.50%), Query Frame = 2
Query:  137 PANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELPERGKFAVGMLFVDTEN--VEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQ--IFIKTNVE---DIHPKLLKRQVFILRKYGERVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDDQSFQHE---EDPLLANYDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVD--YRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTY-NKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVY-TSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVL-REMKNQ--------PKLI---DATQEKVEEKNSIELEKNGLIDIED----LVTSNTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIG-NDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTSLAGPGGLL 6250
            P    LYDP  EKDSCGVGF   I G+ +HKI+ +AR +L +M HRGA  +D   GDGAGVMTG+PY   Q    + G  LP+ G++A+G +F   E     ++M  FT + ++  L  + W+    DNS +G  A S EP I+Q  + +K   +   +    L +RQ+++LRK    ++ +E + FYICSL  +T+VYKGQ    Q++ ++LDL +  Y +H A++H+RFSTNTFPSW+RA P R+ AHNGEINTLRGN N M AREG+MK+  FG +   L PIIE   SDS   DN +E L  +   SLPE V+ ++PEAW ND  +   K AFY WAA  +EPWDGPAL TF+DGRY GA LDRNGLRP R+Y++  D+M  +SE+G V I P+ I+ KGRL  GR+LLVDT+  +I+DD+ LK+ I        W+ +  + +  +   + +  S       +D  LA+ D+ +  FGYT E I M++ PM    KE LGSMGNDA +ACLS    LL++YF+QLFAQVTNPPIDP RE IVM+L C IGP  N+LE +  QC RL +  PIL++ + + L  VD  Y  W    IDIT+  S+    +  AI+ +C +A+ AVN GY+ +VLSDR V  +++ L S+   GAVHHYL+  KLR + AL+ ++G+AREVHH CTLLGYGADA+CPY   E + +L  +  ++   T+E   ++F  A+  G+ KVM+KMGISTL SYKGAQIFEA+G+  EVI+KCF+GTASRI GVTFE +A+++ A H   Y   +   +  +P+ G +++R+GGE H+N P A++ LQ + +  N+  +++F  +    +R C +RG L+F + +S+ IP+++VEP  EIV+RFCTGAMS+GSIS E+H++LAIAMNR+G KSNTGEGGE P R         +RSAIKQ+AS RFGVTS YL+ ADELQIKMAQGAKPGEGGELPG+KVS  IA TR++ AGVGLISPPPHHDIYSIEDL QLIYD+K+ANP AR+SVKLVSEVG+G+VASGV K KA+HI +SGHDGGTGAS WTGIK+AGLPWELGVAETHQTL+LN+LR RVV+Q DGQIRTGRDV IA LLGA+E+G +T PLI LGC MMRKCHLNTCPVGIATQDP LRKKFEG+PEHVVN+ + +AE++R IMAKLGFR+++E++G S+KLK   + IN+K+ LLD T LLT      P       + KQD  L +R+D  LI +A  V   +    V+  +I N DR   +TLS  ISK +G+  LP+  SIR+N  G+ GQSF AFL  G+++ LEGD NDYV KGLSGG ++I PP+ S   F  E N+I+GNVCLYGA SG  F  G AAERF VRNSGAIAVVEG+GDHGCEYMTGGRV++LG TGRNFAAGMSGGIAYVYD + +F  + N +MVD+  +  D+ +  F+   + +    T S +A++ILS++  ++  FVKV P+EY+ VL RE   +        PK     +  ++++EE N+       + D+ED     V  +  LDKL+GF+KY R    YRN  +R NDW E+   +     LR Q ARCM+CG PFCQS +GCP+ N I  WNDLV+K  WKEALTQLL TNNFPEFTGR CPAPCE AC LGI E  V IK++E AIIDK ++EGW+VP  P  +TG+R+ ++GSGP+GLAAA QLN+AGH V++ ER DR GGLLQYGIP+MK+ K VV+RRI  MI+EGIE  T V +G N     D+L   YDA+VL  G++ PRD+ IP R+  GIHFA+ FL K  +   D    +   + AK KDVI++GGGDTG DC+ TS+R GA+SV   E+LP P + RA  NPWP++PR++RVDYGH EV+  +G+D R ++I++K F  DE+G+V GI TV++EWT++S+  +W MKE+ NSE+ F  ++V+LA+GFLGPE++    + ++ D+R+NI TP+  Y+TS+P +YAAGDCRRGQSLVV  I EGRQ AREID     +T L G GGL+
Sbjct:   54 PKAQALYDPAYEKDSCGVGFTCHIKGQVSHKIVTDARLLLCNMTHRGATGADTRDGDGAGVMTGMPYTFMQKEFGQIGCTLPKSGEYAIGNVFFSPEADVCREAMTAFTQVAEKLGLAILAWRSVPCDNSILGPAALSREPTILQPCVVLKAAYDGEAEFDTDLFERQLYVLRKQSSHLIGKEKW-FYICSLHRETIVYKGQLAPVQVYNYFLDLNNAEYVSHFALVHSRFSTNTFPSWDRAQPMRLAAHNGEINTLRGNKNWMHAREGLMKSSRFGEEFASLLPIIERGGSDSAAFDNVIELLCASGVVSLPEAVMLLIPEAWQNDKNISDEKAAFYEWAACQMEPWDGPALFTFADGRYCGANLDRNGLRPCRFYLTSDDMMICASEVGTVGIEPDRIVQKGRLYPGRMLLVDTKEGRIVDDKELKHNIASRYDFRSWLDQELIDMNSIVDSLIESTSVDLTPIVDDVPLAD-DKTMLAFGYTLEQINMIMAPMANGGKETLGSMGNDAAIACLSDQPRLLYDYFRQLFAQVTNPPIDPIREAIVMSLQCYIGPSGNLLEINQSQCRRLRMPTPILTVEEFNALKNVDRIYPDWKVASIDITFFKSEGVAGYAAAIERICSEADTAVNEGYKAIVLSDRNVNSERVPLASIAACGAVHHYLVQNKLRSRVALVCESGDAREVHHMCTLLGYGADAVCPYLAMEALTKLVRQNAMKPGITEETAIKNFKHAINGGILKVMSKMGISTLQSYKGAQIFEALGIDNEVINKCFLGTASRIRGVTFEHIALDAFALHERGYPTDQSIRSLQIPDMGDFYYRDGGEQHVNHPKAIASLQDAVRNKNEAAYAEFSRTHYEQTRRCTLRGMLDFDFDSSQAIPIEQVEPWTEIVRRFCTGAMSYGSISMESHSSLAIAMNRLGGKSNTGEGGEDPARSQRLANGDTMRSAIKQIASGRFGVTSWYLSDADELQIKMAQGAKPGEGGELPGNKVSESIAKTRHSTAGVGLISPPPHHDIYSIEDLKQLIYDMKSANPRARVSVKLVSEVGVGIVASGVAKAKADHILVSGHDGGTGASRWTGIKYAGLPWELGVAETHQTLVLNDLRGRVVIQTDGQIRTGRDVAIACLLGAEEWGFATTPLIALGCIMMRKCHLNTCPVGIATQDPELRKKFEGQPEHVVNFFYYVAEELRGIMAKLGFRTINEMVGRSDKLK-VAEPINNKSKLLDLTPLLTPAFTLRPGAAT-YNVRKQDHRLYTRLDNKLIDEAE-VTLEEGIPSVVECEIINTDRTLGATLSNKISKRYGEEGLPT-DSIRVNVFGSAGQSFGAFLAPGVTLQLEGDCNDYVGKGLSGGRLIIYPPRVS--PFKPEENMIIGNVCLYGATSGHAFISGVAAERFAVRNSGAIAVVEGVGDHGCEYMTGGRVVILGSTGRNFAAGMSGGIAYVYDMQMDFAGKINTEMVDISSVT-DAAEIAFLRGLIQDHRHYTGSQVADRILSDFPRHLSRFVKVLPREYKAVLEREAAKKEEAKRLQYPKAFMPGNPIRQQIEETNA------QIADVEDTLGATVKKSAPLDKLRGFMKYQRRSEHYRNPLKRTNDWKELSV-RLREDELRVQTARCMDCGTPFCQSDYGCPISNKIFTWNDLVFKQQWKEALTQLLLTNNFPEFTGRVCPAPCEGACTLGIIESPVGIKSVERAIIDKAWEEGWIVPRPPAERTGRRVAIIGSGPAGLAAADQLNRAGHHVVIYERADRPGGLLQYGIPNMKLDKKVVERRIQLMIDEGIEVLTNVEVGKNGDVSLDELHKVYDAVVLASGSTVPRDLPIPNRDSKGIHFAMEFLHKNTKSLLDSELKDGNYISAKGKDVIVIGGGDTGNDCLGTSVRHGAKSVRNLELLPIPPRERAFDNPWPQYPRVFRVDYGHAEVQAHYGQDFREYSILTKSFEKDEDGNVKGINTVRIEWTKNSKG-RWIMKEIRNSEEFFPADLVILALGFLGPEEQATAGMNVDRDARSNISTPTKSYETSVPGIYAAGDCRRGQSLVVWGIQEGRQCAREIDLKFQGKTFLPGDGGLV 2105          
BLAST of Glutamate synthase vs. UniProt/SwissProt
Match: sp|Q03460|GLSN_MEDSA (Glutamate synthase [NADH], amyloplastic OS=Medicago sativa OX=3879 PE=1 SV=1)

HSP 1 Score: 2091.23 bits (5417), Expect = 0.000e+0
Identity = 1081/2107 (51.31%), Postives = 1447/2107 (68.68%), Query Frame = 2
Query:  125 FSNYPAN-TGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELPERGKFAVGMLFVDTENVEKSMER--FTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKL-LKRQVFILRKYGE-------RVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYL-DLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAK---LDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDDQSFQHEED---------PLLANYD------------QRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYT------DEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRI-----GDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERF--LSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASL--LDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDK-TLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQPKLIDATQ---EKVEEKN--SIELEKNGLIDIEDLVTSN---------------TNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFC-QSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSK-DVVQRRINFMIEEGIEFQTGVHIGNDK-WPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQ 6220
            FS  P    GLYDP  +KDSCGVGFV ++NG+ + K + +A  ML+ M HRGA   + +TGDGAG++  +P+  YQ        +LP +G +AVGM F+   +  +   +  FT + +    + + W+    DN+ +G  A+ TEP I Q+F+  + +    K+ L++Q++ILRK           +  +    FYICSLS +TV+YKGQ T  QL E+Y  DL +  + ++MA+IH+RFSTNTFPSW+RA P R+L HNGEINTLRGN+N ++AREG++K    G     L +  PI++ N SDSGC D  LEFL H S +SLPE V+ M+PEAW ND  M P++KAFY + +  +EPWDGPALI+F+DG Y+GA LDRNGLRP R+YV+ S  + M+SE+GVV I PE++  KGRL  G +LLVD E + +++D+ALK +    RP   W+ +  + LKD+   +       HE D         P L+N D              L  FGY+ E + +L+LPM KD  EALGSMGND PLA +S    L FEYFKQ+FAQVTNPPIDP REKIV ++ C +GPE ++ E + EQCHRL L  P+LS ++++ + +++YRGW +K IDITY   +      EA+D +C +A NA++ GY  +VLSDR   +K +++ SL+ VGAVH +L+    R + AL++++ E REVHHFCTL+G+GADAICPY   E + RL+ +G +    +      DE++ ++F  A   G+ KV+AKMGISTL SYKGAQIFEA+GL+ EVI+KCF GT SR+ G TFE LA ++L  H   +  RI      +   LPNPG YHWR+GGE H+N+P A++ LQ + + N+ + + ++  + +  ++ CN+RG L+F   +  +P+ EVEPA EIVKRFCTGAMS+GSIS EAHT LA AMN IG KSNTGEGGE P R   L++  +   RSAIKQVAS RFGV+S YL +ADELQIKMAQGAKPGEGGELPGHKV  +IA TRN+ AGVGLISPPPHHDIYSIEDLAQLI+DLK ANP ARISVKLVSE G+GV+ASGVVKG AEH+ ISGHDGGTGAS WTGIK AGLPWELG+AETHQTL+ N+LR R  LQ DGQ++TGRDV IAALLGA+E+G STAPLI LGC MMRKCH NTCPVGIATQDP+LR+KF G+PEHV+N+ F++AE++REIM++LGFR+++E++G S+ L+   + +   A L  +D + LL   +   P    Q  + KQD  L   +D  LI  ++  +      + I   I N +RA  + LS+ ++K +    LP+  +I I   G+ GQSF AFL  GI++ LEGD+NDY+ KGLSGG+VV+ PPK S  +F  ++NI++GNV LYGA  G  +F G AAERFCVRNSGA+AVVEG+GDHGCEYMTGG V+VLGKTGRNFAAGMSGGIAYV D    F  RCN+++VDL  + ++  ++    + LI+ H + T S++A+++L ++   +  FVKVFP+EY++VL  MK+     DA +   E V+E++  +  +EK+   +++ L T++               T+  K +GF+ Y R    YR+   R+NDW E+         L+ Q+ARCM+CG PFC Q + GCPLGN IP++N+LVY++ W+EAL +LL+TNNFPEFTGR CPAPCE +CVLGI E  V+IKNIECAIIDK F+EGWM+P  P  +TGKR+ +VGSGPSGLAAA QLNK GH V V ER DRIGGL+ YG+P+MK  K D+VQRR+N M EEGI F    +IG D  +  ++L  + DAIVL VGA+ PRD+ +PGR LSG+HFA+ FL    +   D +  +   + AK K V+++GGGDTG DCI TS+R G  +V   E+LP P  +RA  NPWP+WPRI+RVDYGH+E + ++GKDPR + +++K F+ DENG V G+  V+V W +D +T ++  KE+  SE++   ++VLLAMGFLGPE  I  +L +E D+R+N K   G++ TS+  V+AAGDCRRGQSLVV AI+EGRQAA ++D  + N+
Sbjct:   82 FSAVPDKPMGLYDPAFDKDSCGVGFVAELNGQSSRKTVTDALEMLVRMTHRGACGCEANTGDGAGILVALPHGFYQEVVD---FQLPPQGNYAVGMFFLPKSDSRRKESKNIFTKVAESLGHKVLGWRSVPTDNTGLGKSAQLTEPVIEQVFLTPSSDS---KVDLEKQMYILRKLSMVSITSALNLQSDGITDFYICSLSSRTVIYKGQLTPAQLGEYYYADLGNERFTSYMALIHSRFSTNTFPSWDRAQPFRVLGHNGEINTLRGNVNWIKAREGLLKCKELGLSENDLKKFLPIVDANSSDSGCFDGVLEFLLH-SGKSLPEAVMMMIPEAWQNDKNMDPQRKAFYEYYSALMEPWDGPALISFTDGHYLGATLDRNGLRPGRFYVTHSGRVIMASEVGVVDIPPEDVCRKGRLNPGMMLLVDFEKQIVVNDDALKEQYSLARPYGDWLEKQKIELKDIIDSV-------HESDIVPPTISGVPPLSNDDVDMENMGIQGLLAPLKAFGYSVESLEILLLPMAKDGVEALGSMGNDTPLAVMSNREKLTFEYFKQMFAQVTNPPIDPIREKIVTSMRCMVGPEGDLTETTEEQCHRLSLKGPLLSTKEMEAIKKMNYRGWRSKVIDITYSKERGTKGLEEALDRICTEAHNAISEGYTTLVLSDRAFSKKHVAVSSLLAVGAVHQHLVKTLERTRVALMVESAEPREVHHFCTLVGFGADAICPYLAIEAIWRLQVDGKIPPKASGDFNSKDELVKKYF-KASTYGMMKVLAKMGISTLASYKGAQIFEALGLSSEVIEKCFAGTPSRVEGATFEMLAQDALHLHELAFPSRIFSPGSAEAVALPNPGDYHWRKGGEVHLNDPLAIAKLQEAARTNSVDAYKQYSKTIHELNKACNLRGLLKFKDAASKVPISEVEPASEIVKRFCTGAMSYGSISLEAHTALATAMNTIGGKSNTGEGGEQPSRMEPLADGSRNPKRSAIKQVASGRFGVSSYYLTNADELQIKMAQGAKPGEGGELPGHKVIGDIAITRNSTAGVGLISPPPHHDIYSIEDLAQLIHDLKNANPAARISVKLVSEAGVGVIASGVVKGHAEHVLISGHDGGTGASRWTGIKSAGLPWELGLAETHQTLVANDLRGRTTLQTDGQLKTGRDVAIAALLGAEEYGFSTAPLITLGCIMMRKCHKNTCPVGIATQDPVLREKFAGEPEHVINFFFMVAEEMREIMSQLGFRTVNEMVGRSDMLEVDKEVVKGNAKLENIDLSLLLRPAAELRPEAA-QYCVQKQDHGLDMALDNKLISLSNAALE-KGLPVYIETPICNTNRAVGTMLSHEVTKRYNLAGLPA-DTIHIQFTGSAGQSFGAFLCPGITLELEGDSNDYIGKGLSGGKVVVYPPKGS--NFDPKDNILIGNVALYGATRGEAYFNGMAAERFCVRNSGALAVVEGVGDHGCEYMTGGTVVVLGKTGRNFAAGMSGGIAYVLDVDGTFQSRCNLELVDLDKVEEE--EDIITLRMLIQQHQRHTNSLLAKEVLVDFENLLPKFVKVFPREYKRVLASMKSDAASKDAVERAAEDVDEQDDEAQAVEKDAFEELKKLATASLNEKPSEAPKRPSQVTDAVKHRGFVAYEREGVQYRDPNVRLNDWNEVMMETKPGPLLKTQSARCMDCGTPFCHQENSGCPLGNKIPEFNELVYQNRWQEALERLLETNNFPEFTGRVCPAPCEGSCVLGIIENPVSIKNIECAIIDKAFEEGWMIPRPPVKRTGKRVAIVGSGPSGLAAADQLNKMGHIVTVFERADRIGGLMMYGVPNMKTDKVDIVQRRVNLMAEEGINFVVNANIGLDPLYSLERLREENDAIVLAVGATKPRDLPVPGRELSGVHFAMEFLHANTKSLLDSNLQDGNYISAKGKKVVVIGGGDTGTDCIGTSIRHGCTAVVNLELLPQPPPTRAPGNPWPQWPRIFRVDYGHQEAETKFGKDPRTYEVLTKRFVGDENGVVKGLEVVRVCWEKD-ETGKFQFKEIEGSEEIIEADLVLLAMGFLGPEATIAEKLGVERDNRSNFKADYGRFSTSVDGVFAAGDCRRGQSLVVWAISEGRQAAAQVDSYLTNE 2165          
BLAST of Glutamate synthase vs. UniProt/SwissProt
Match: sp|Q0DG35|GLT2_ORYSJ (Glutamate synthase 2 [NADH], chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0555600 PE=2 SV=2)

HSP 1 Score: 2057.72 bits (5330), Expect = 0.000e+0
Identity = 1054/2080 (50.67%), Postives = 1418/2080 (68.17%), Query Frame = 2
Query:  140 ANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELPERGKFAVGMLFVDTENVEKSMERFTLIVKE----CHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMRE-------ENYRFYICSLSLQTVVYKGQFTARQL-WEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDE---LFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDDQSF------------QHEEDPLLANYDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLE----KHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRI-----GDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLS-NDPQKNLR-SAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYI--NHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHD-KTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQP----------KLIDATQ-EKVEEKNSIELEKNGLIDIEDLVTSN--TNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQ---SHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKD-VVQRRINFMIEEGIEFQTGVHIGNDK-WPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREID 6202
            ++ GLYDP++E+DSCGVGF+ +++G+ + K +++A  ML  M HRGA   + +TGDGAG++  +P+  ++   K+ G ELP  G++AVGM F+ T++  K  E+  L+ +E         + W+R   DNS +G  A  TEP I Q+F+  +         +RQ+++LR++    +RE           FY+CSLS +T+VYKGQ    QL   F+ DL D ++ ++MA+IH+RFSTNTFPSW+RA P R+L HNGEINTLRGN N M+AREG++K    G   DE   L PI++   SDSG +DN LE L   S RS PE V+ M+PEAW ND  M P +KA Y + +  +EPWDGPALI+F+DGRY+GA LDRNGLRP R+YV+ S  + M+SE+GVV + P+++  KGRL  G +LLVD E   +++D+ LK E  ++RP  +W+    + L D+ + + + +              +++ D  +      L  FGYT E + ML+LPM KD +EALGSMGND PLA +S    L FEYFKQ+FAQVTNPPIDP REKIV ++ C IGPE ++ E +  QCHRL L  P+L+  +++ + +++YRGW +K +DITYP         + +D +C QA  A++ GY I+VLSDR    +++++ SL+ VGAVH +L++   R +  L++++ E REVHHF TL+G+GADAICPY   E + RL+ +G +     K YT E + E +  A   G+ KV+AKMGISTL SYKGAQIFEA+GLA EV+ KCF GT SR+ G TFE LA ++L  H   +  R       D   LPNPG YHWR+ GE H+N+P +++ LQ + + N++  + ++       ++ C +RG L+F      I LDEVEPAKEIVKRFCTGAMS+GSIS EAHT+LA AMN +G KSNTGEGGE P R +   D  KN R SAIKQVAS RFGV+  YL +A E+QIKMAQGAKPGEGGELPGHKV  +IA TRN+ AGVGLISPPPHHDIYSIEDLAQLI+DLK ANP ARISVKLVSE G+G+VASGVVKG A+H+ ISGHDGGTGAS WTGIK+AGLPWELG+AETHQTL+ N LR R VLQ DGQ++TGRDV +A LLGA+EFG STAPLI LGC MMRKCH NTCP GIATQDP+LR KF GKPEHV+NY F+LAE+VREIMA+LGFR+++E++G S+ L+     +  N K   +D ++LL   +   P  V Q  + KQD  L   +D  LI  ++  +      + I   + N +RA  + LS+ ++K +  + LPS  +I I   G+ GQSF AFL  GI++ LEGD+NDYV KGLSGG++V+ PP+NS   F  ++NI++GNV LYGA  G  +F G AAERFCVRNSGA AVVEG+GDHGCEYMTGG  ++LGKTGRNFAAGMSGGIAYVYD   +F  RCN ++VDL  + ++  D+    + +I+ H   T S +A  IL N+   +  F+KV+P++Y++VL ++K +           +++D    E ++  N I ++   +++ E     +  +N  K +GFIKY R    YR+  ER+ DW E+         L+ Q+ARCM+CG PFC    S  GCPLGN IP++N+LV+++ W EAL +LL+TNNFPEFTGR CPAPCE +CVLGI +  V+IK+IECAIIDKGF+EGWMVP  P  +TGKR+ +VGSGP+GLAAA QLNK GH V V ER DRIGGL+ YG+P+MK  K+ +VQRR+  M +EG++F    H+G+D  +  +KL ++ DAI+L  GA+ P+D+ IPGR L+GIHFA+ FL    +   D +  +   + A+ + V+++GGGDTG DCI TS+R G  ++   E+LP P + RA  NPWP+WPRI+RVDYGH+E   ++GKDPR + +++K F+ DENG+V  +  ++VEW + +   Q+  KEV  SE++   ++VLLAMGFLGPE  + N+L LE D R+N K   G + T++  V+AAGDCRRGQSLVV AI EGRQAA  +D
Sbjct:   93 SSIGLYDPSMERDSCGVGFIAELSGEYSRKTVDDAIEMLDRMAHRGACGCEKNTGDGAGILVALPHNFFREVTKDAGFELPPPGEYAVGMFFMPTDD--KRREKSKLLFREKAELLGHTVLGWRRVPTDNSGLGQSAVDTEPVIEQVFVTKSASS--KADFERQMYVLRRFSVMSIREVLGVKNGGTKDFYMCSLSSRTIVYKGQLKPSQLKGYFFADLGDESFTSYMALIHSRFSTNTFPSWDRAQPMRVLGHNGEINTLRGNKNWMKAREGLLKCEGLGLTRDEMLKLLPIVDATSSDSGAIDNVLELLIQ-SGRSAPEAVMMMIPEAWQNDVNMDPERKALYEFFSALMEPWDGPALISFTDGRYLGATLDRNGLRPGRFYVTYSGRVIMASEVGVVDVPPQDVSRKGRLNPGMMLLVDFENHCVVNDDELKKEYSKVRPYGEWLKRQRIQLTDIIESVNEAERIAPSISGALPITKENKADMGICGILTPLKAFGYTREALEMLMLPMAKDGQEALGSMGNDTPLAVMSNREKLTFEYFKQMFAQVTNPPIDPIREKIVTSMECMIGPEGDLSETTERQCHRLTLKSPLLNTNEMEAIKKMNYRGWRSKVLDITYPKKNGRMGLKQTLDKICAQAREAIHEGYTILVLSDRGFSSERVAVSSLLAVGAVHQHLVSHLERTRIGLLVESAEPREVHHFSTLIGFGADAICPYLAIEAIWRLQIDGRIPPNDGKPYTQEQLIEKYFYASNYGMMKVLAKMGISTLASYKGAQIFEALGLASEVVSKCFEGTPSRVEGATFEMLAQDALRLHEIAFPSRTLPPGSADANALPNPGDYHWRKNGEVHLNDPFSIAKLQEAARINSREAYKEYSRRIYELNKACTLRGMLKFREIPNQISLDEVEPAKEIVKRFCTGAMSYGSISLEAHTSLAEAMNTLGGKSNTGEGGEQPCRMVPLPDGSKNPRISAIKQVASGRFGVSIYYLTNAVEVQIKMAQGAKPGEGGELPGHKVIGDIAVTRNSTAGVGLISPPPHHDIYSIEDLAQLIHDLKNANPGARISVKLVSEAGVGIVASGVVKGHADHVLISGHDGGTGASRWTGIKNAGLPWELGLAETHQTLVANGLRGRAVLQTDGQMKTGRDVAVACLLGAEEFGFSTAPLITLGCIMMRKCHTNTCPAGIATQDPVLRAKFAGKPEHVINYFFMLAEEVREIMAQLGFRTVNEMVGRSDMLEIDPKVLEGNEKLENIDLSRLLKPAAEISPGAV-QYCVEKQDHGLDMALDNKLIASSTAALR-KGVRVFIETPVRNINRAVGTMLSHEVTKRYHIHGLPS-DTIHIKLNGSAGQSFGAFLCPGITLELEGDSNDYVGKGLSGGKIVVYPPRNSR--FNPQDNIVIGNVALYGATKGEAYFNGMAAERFCVRNSGAQAVVEGIGDHGCEYMTGGTAVILGKTGRNFAAGMSGGIAYVYDVDGKFSSRCNYELVDLYAVVEE--DDITTLRMMIQQHRLHTQSDLARDILLNFDTLLPKFIKVYPRDYKRVLDKLKEEKAAKEAEQKAREVVDKKPVEVIQAPNGISVKTEKVMNEEPSSRPSRVSNAVKYRGFIKYEREGTSYRDPNERVKDWNEVAIELVPGPLLKTQSARCMDCGTPFCHQEGSGAGCPLGNKIPEFNELVHQNRWHEALDRLLETNNFPEFTGRVCPAPCEGSCVLGIIDNPVSIKSIECAIIDKGFEEGWMVPRPPLRRTGKRVAIVGSGPAGLAAADQLNKMGHFVTVFERADRIGGLMMYGVPNMKADKEGIVQRRVELMAKEGVQFIVNAHVGSDPLYSVEKLRSENDAIILACGATKPKDLPIPGRELAGIHFAMEFLHANTKSLLDSNLEDGNYISAQGRKVVVIGGGDTGTDCIGTSIRHGCTNLVNLELLPEPPRKRAPDNPWPQWPRIFRVDYGHQEATSKFGKDPRSYKVLTKRFIGDENGNVKALEVIRVEWGKVNGRFQF--KEVEGSEEIIEADLVLLAMGFLGPEATVANKLGLEQDMRSNFKAQFGNFATNVEGVFAAGDCRRGQSLVVWAITEGRQAAAAVD 2158          
BLAST of Glutamate synthase vs. UniProt/SwissProt
Match: sp|Q9LV03|GLUT1_ARATH (Glutamate synthase 1 [NADH], chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLT1 PE=1 SV=2)

HSP 1 Score: 2053.87 bits (5320), Expect = 0.000e+0
Identity = 1063/2097 (50.69%), Postives = 1421/2097 (67.76%), Query Frame = 2
Query:  125 FSNYPANT-GLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELPERGKFAVGMLFVDT--ENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMREE-NYR------FYICSLSLQTVVYKGQFTARQLWEFYL-DLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELF---PIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDDQSF----------QHEEDPL----LANYDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLE-----KHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKR-----IGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERF--LSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYI--NHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDK-TLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQPKLIDATQEK------------------VEEKNSI------ELEKNGLIDIEDLVTSNTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFC-QSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSK-DVVQRRINFMIEEGIEFQTGVHIGND-KWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDK 6205
            FS  P    GLYDP+ +KDSCGVGFV +++G+ T K + ++  MLI M HRGA   +++TGDGAG++ G+P++ Y   A E G  LP  G +AVGM F+ T     E+S   FT + +      + W+    DNS +G+ A  TEP I Q+F+    +       ++Q++ILR+     +R   N +      FYICSLS +T+VYKGQ    QL ++Y  DL    + ++MA++H+RFSTNTFPSW+RA P R+L HNGEINTLRGN+N MRAREG++K +  G    EL    PI++ + SDSG  D  LE L  A  RSLPE V+ M+PEAW ND  + P +K FY + +  +EPWDGPALI+F+DGRY+GA LDRNGLRP R+Y++ S  + M+SE+GVV + PE+++ KGRL  G +LLVD E   ++DD+ALK +    RP  +W+    + LKD+ + +P+ +             +++D +    +      L  FGYT E + ML+LPM KD  EALGSMGND PLA +S    L FEYFKQ+FAQVTNPPIDP REKIV ++ C IGPE ++ E + EQCHRL L  P+L + +++ + +++YRGW TK +DITY   +      E +D +C +A  A+  GY ++VLSDR     ++++ SL+ VGAVHH+L+    R +  L++++ E REVHHFCTL+G+GADAICPY   E V RL+ +G +      + ++ E + + +  A   G+ KV+AKMGISTL SYKGAQIFEA+GL+ EVI KCF GT SR+ G TFE LA + L  H   +  R       +   L NPG YHWR+ GE H+N+P A++ LQ + + N+   + ++    N  ++  N+RG ++F      IPLDEVEPA EIVKRFCTGAMS+GSIS EAHTTLA+AMN++G KSNTGEGGELP R   L++  +   RS+IKQ+AS RFGV+S YL +ADELQIKMAQGAKPGEGGELPGHKV  +IA TRN+ AGVGLISPPPHHDIYSIEDLAQLI+DLK ANP ARISVKLVSE G+GV+ASGVVKG A+H+ I+GHDGGTGAS WTGIK+AGLPWELG+AETHQTL+ N+LR R VLQ DGQ++TGRDV +AALLGA+EFG STAPLI LGC MMRKCH NTCPVGIATQDP+LR+KF G+PEHV+N+ F+LAE+VREIM+ LGFR+++E+IG ++ L+   + +  N K   +D + LL   +   P    Q  + KQD  L   +D +LI  +   +      + I   I N +RA  + LS+ ++K +    LP   +I I   G+ GQS  AFL  GI + LEGD+NDYV KGLSGG+VV+ PPK S   F  + NI++GNV LYGA SG  +F G AAERF VRNSGA AVVEGLGDHGCEYMTGG V+VLGKTGRNFAAGMSGGIAYV D   +F  RCN+++VDL  +  +  +++   K +I+ H + T S +A+++L+++   +  F+KVFP++Y++VL  MK++     A +                     E KN        E+  NG +  E   +   N  K  GFI Y R    YR+   R+NDW E+         L  Q+ARCM+CG PFC Q + GCPLGN IP++N+LVY++ W+EAL +LL+TNNFPEFTGR CPAPCE +CVLGI E  V+IK+IECAIIDK F+EGWMVP  P  +TGK++ ++GSGP+GLAAA QLNK GH V V ER+DRIGGL+ YG+P+MK  K DVVQRR++ M +EGI F    +IG D  +  D L  + DAIVL VG++ PRD+ +PGR+LSG+HFA+ FL    +   D ++ +   + AK K V+++GGGDTG DCI TS+R G  ++   E+LP P  +RA  NPWP+WPR++R+DYGH+E   ++GKDPR + +++K F+ D+NG+V G+  V+V W +D +T ++  KE+  SE++   ++V LAMGFLGPE  +  +L LE D+R+N K   G++ T++  V+AAGDCRRGQSLVV AI+EGRQAA ++DK
Sbjct:   97 FSAVPEKPLGLYDPSYDKDSCGVGFVAELSGETTRKTVTDSLEMLIRMTHRGACGCESNTGDGAGILVGLPHDFYAEAATELGFVLPSAGNYAVGMFFLPTVESRREESKNVFTKVAESLGHSVLGWRLVPTDNSGLGNSALQTEPIIAQVFLTPTTKSKAD--FEQQMYILRRVSMVAIRAALNLQHGAMKDFYICSLSSRTIVYKGQLKPDQLKDYYYADLGSERFTSYMALVHSRFSTNTFPSWDRAQPMRVLGHNGEINTLRGNVNWMRAREGLLKCNELGLSKKELKKLLPIVDVSSSDSGAFDGVLELLVRAG-RSLPEAVMMMIPEAWQNDKNIDPSRKEFYEYLSALMEPWDGPALISFTDGRYLGATLDRNGLRPGRFYITHSGRVIMASEVGVVDVPPEDVMRKGRLNPGMMLLVDFEKHIVVDDDALKQQYSLARPYGEWLKRQKIELKDIIESVPEAERIAPSISGVVPASNDDDSMESMGIHGLLSPLKAFGYTVEALEMLLLPMAKDGSEALGSMGNDTPLAVMSNREKLCFEYFKQMFAQVTNPPIDPIREKIVTSMECMIGPEGDLTETTEEQCHRLSLKGPLLKIEEMEAIKKMNYRGWRTKVLDITYAKERGTKGLEETLDRICDEANEAIKEGYTLLVLSDRAFSATRVAVSSLMAVGAVHHHLVKTLARTQVGLVVESAEPREVHHFCTLVGFGADAICPYLAVEAVYRLQVDGKIPPKSNGEFHSKEELVKKYYKASNYGMMKVLAKMGISTLASYKGAQIFEALGLSSEVIQKCFAGTPSRVEGATFEMLARDGLQLHELAFPTRGYAPGSAEASALTNPGNYHWRKNGEIHLNDPLAIAKLQEAARTNSVAAYKEYSKRINELNKQSNLRGLMKFKDADVKIPLDEVEPASEIVKRFCTGAMSYGSISLEAHTTLAMAMNKLGGKSNTGEGGELPSRMEPLADGSRNPKRSSIKQIASGRFGVSSYYLTNADELQIKMAQGAKPGEGGELPGHKVIGDIAITRNSTAGVGLISPPPHHDIYSIEDLAQLIHDLKNANPGARISVKLVSEAGVGVIASGVVKGHADHVLIAGHDGGTGASRWTGIKNAGLPWELGLAETHQTLVANDLRGRTVLQTDGQLKTGRDVAVAALLGAEEFGFSTAPLITLGCIMMRKCHKNTCPVGIATQDPVLREKFAGEPEHVINFFFMLAEEVREIMSGLGFRTVTEMIGRADMLELDREVVKNNDKLENIDLSLLLRPAAEIRPGAA-QYCVQKQDHGLDMALDQELIALSKSALE-KSLPVYIETPICNVNRAVGTMLSHEVTKRYHLTGLPK-DTIHIKFTGSAGQSLGAFLCPGIMLELEGDSNDYVGKGLSGGKVVVYPPKGS--SFDPKENIVIGNVALYGATSGEAYFNGMAAERFSVRNSGAKAVVEGLGDHGCEYMTGGTVVVLGKTGRNFAAGMSGGIAYVLDVDGKFNTRCNLELVDLDKVEDE--EDKMTLKMMIQQHQRHTNSQLAQEVLADFENLLPKFIKVFPRDYKRVLSAMKHEEVSKQAIERASEEADETEEKELEEKDAFAELKNMAAASSKEEMSGNG-VAAEARPSKVDNAVKNGGFIAYEREGVKYRDPNVRLNDWNEVMEESKPGPLLTTQSARCMDCGTPFCHQENSGCPLGNKIPEFNELVYQNRWQEALNRLLETNNFPEFTGRVCPAPCEGSCVLGIIENPVSIKSIECAIIDKAFEEGWMVPRPPLKRTGKKVAIIGSGPAGLAAADQLNKMGHLVTVYERSDRIGGLMMYGVPNMKTDKIDVVQRRVDLMTKEGINFVVNANIGKDPSYSLDGLKEENDAIVLAVGSTKPRDLPVPGRDLSGVHFAMEFLHANTKSLLDSNHEDGNYISAKGKKVVVIGGGDTGTDCIGTSIRHGCTNIVNLELLPQPPSTRAPGNPWPQWPRVFRIDYGHQEATTKFGKDPRTYEVLTKRFIGDDNGNVKGLELVRVSWEKD-ETGRFQFKEIEGSEEIIEADLVFLAMGFLGPEPTLAEKLGLECDNRSNFKAEYGRFSTTVEGVFAAGDCRRGQSLVVWAISEGRQAADQVDK 2181          
BLAST of Glutamate synthase vs. UniProt/SwissProt
Match: sp|Q0JKD0|GLT1_ORYSJ (Glutamate synthase 1 [NADH], chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0681900 PE=2 SV=1)

HSP 1 Score: 2050.4 bits (5311), Expect = 0.000e+0
Identity = 1052/2087 (50.41%), Postives = 1409/2087 (67.51%), Query Frame = 2
Query:  122 PFSNYPANT-GLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELPERGKFAVGMLF--VDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFI-KTNVEDIHPKLLKRQVFILRKYGERVMREE-NYR------FYICSLSLQTVVYKGQFTARQL-WEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDE---LFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDD------------QSFQHEEDPLLANYDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLE-----KHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRI-----GDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERF--LSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYI--NHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHD-KTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQPKL------------IDATQEKVEEKNSIELEKNGLIDIEDLVTSNTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQ---SHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSK-DVVQRRINFMIEEGIEFQTGVHIGNDK-WPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDK 6205
            P S  P ++ GLYDP+ E+DSCGVGFV +++G      + +A  ML  M HRGA   + +TGDGAG++  +P+  ++   K+ G ELP+ G++AVGM+F  +D +  E+S   F  + +      + W+R   DNS +G  A  TEP I Q+F+ K++  +      ++Q++ILR+     +R   N R      FY+CSLS +T+VYKGQ    QL   +Y DL   N+ ++MA++H+RFSTNTFPSW+RA P R+L HNGEINTL+GN N M+AREG+++    G   D+   + PI++   SDSG  D  LE L     RSLPE V+ M+PEAW ND  M P KKA Y + +  +EPWDGPALI+F+DGRY+GA LDRNGLRP R+YV+ S  + M SE+GVV +  ++++ KGRL  G +LLVD E   ++DDEALK +  +  P  +W+    + LKD+ + +P+             Q  + +E   +      L  FGYT E + ML+LPM KD  EALGSMGND PLA +S    L FEYFKQ+FAQVTNPPIDP REKIV ++ C IGPE ++LE + +QC+RL L  P++S+ +++ + +++YRGW +K +DITYP         E +D +C +A  A+  GY ++VLSDR     ++++ SL+ VGAVH +L+    R +  L++++ E REVHHFCTL+G+GADA+CPY   E +  L+++G +      K Y+ E + + +  A   G+ KV+AKMGISTL SYKGAQIFEA+GL+ EVI KCF GT SRI G TFE LA ++L  H   +  R       D   LPNPG YHWR+ GE H+N+P A++ LQ + + N++  + ++       ++ CN+RG L+F  T++ I +DEVEPA EIVKRF TGAMS+GSIS EAHT LA+AMN++G KSNTGEGGE P R   L+N      RSAIKQVAS RFGV+S YL +ADELQIKMAQGAKPGEGGELPGHKV  +IA TR++ AGVGLISPPPHHDIYSIEDLAQLI+DLK +NP ARISVKLVSE G+GVVASGVVKG A+H+ ISGHDGGTGAS WTGIK+AGLPWELG+AETHQTL+ N LR R +LQ DGQ++TG+DV +A LLGA+EFG STAPLI LGC MMRKCH NTCPVGIATQDP+LR+KF G+PEHV+N+ F+LAE++REIM++LGFR+++E++G S+ L+   + +  N K   +D + +L   +   P    Q  + KQD  L   +D  LI  +   +   E  + I   I N +RA  + LS+ ++K +    LP+  +I +   G+ GQS  AFL  GI++ LEGD+NDYV KGLSGG++V+ PP++S   F  E+NI++GNV LYGA  G  +F G AAERFCVRNSGA AVVEG+GDHGCEYMTGG V++LGKTGRNFAAGMSGGIAYVYD   +F  RCN ++VDL  + ++  ++    K +IE H   T SV+A  ILSN+   +  FVKVFP++Y++VL  MK +               +  T +KV+ + S            +  T  +N  K +GFI Y R    YR+  ER+ DW E+         L  Q+ARCM+CG PFC    S  GCPLGN IP++N+LV+++ W+EAL +LL+TNNFPEFTGR CPAPCE +CVLGI E  V+IK+IECAIIDKGF+EGWMVP  P  +TGK++ ++GSGP+GLAAA QLNK GH V V ER DRIGGL+ YG+P+MK  K ++VQRR+N M EEGI F    ++G+D  +  ++L ++ DA++L  GA+ PRD+ IPGR LSG+HFA+ FL    +   D +  +   + AK K V+++GGGDTG DCI TS+R G  S+   E+L  P   RA+ NPWP+WPRI+RVDYGH+E   ++G DPR + +++K F+ DENG+V  +  V+V+W +     Q+  KE+  S +    ++VLLAMGFLGPE  I  +L LE D+R+N K   G + TS+  ++AAGDCRRGQSLVV AI EGRQAA  +DK
Sbjct:   79 PLSTLPESSIGLYDPSRERDSCGVGFVAELSGDYKRATVNDALEMLERMAHRGACGCEKNTGDGAGILVALPHNFFREVTKDAGFELPQPGEYAVGMVFLPIDEKRRERSKAEFQKVAESLGHVILGWRRVPTDNSDLGESALQTEPVIEQVFLTKSSSSEAD---FEQQLYILRRLSILSIRAALNLRRGGKRDFYMCSLSSRTIVYKGQLKPCQLKGYYYADLGHENFTSYMALVHSRFSTNTFPSWDRAQPMRVLGHNGEINTLKGNKNWMKAREGLLECEKLGLTKDQFSKILPIVDATSSDSGAFDGVLELLIRGG-RSLPEAVMMMIPEAWQNDVNMEPEKKALYEFLSALMEPWDGPALISFTDGRYLGATLDRNGLRPGRFYVTHSGRVVMGSEVGVVDVPSKDVLRKGRLNPGMMLLVDFENHTVVDDEALKAQYSKAHPYGEWLKRQKIYLKDIVESVPETERVAPGISGSLTQKNEKKEHAGVNGIVTPLKAFGYTVEALEMLLLPMAKDGVEALGSMGNDTPLAVMSNREKLTFEYFKQMFAQVTNPPIDPIREKIVTSMECMIGPEGDLLETTEKQCNRLALEGPLVSIDEMEAIKKMNYRGWRSKVLDITYPKKSGRKGLEETLDRICTEARGAIKKGYTVLVLSDRGFSSDRVAVSSLLAVGAVHQHLVANLERTRVGLLVESAEPREVHHFCTLVGFGADAVCPYLAIEAIWCLQNDGKIPPNGDGKPYSKEELVKKYFYASNYGMMKVLAKMGISTLASYKGAQIFEALGLSSEVIRKCFDGTPSRIEGATFEMLARDALRLHELAFPSRAPPPGSADAKALPNPGDYHWRKNGEVHLNDPLAMAKLQEAARVNSRAAYKEYSRRIQELNKTCNLRGMLKFKDTADMISVDEVEPASEIVKRFVTGAMSYGSISLEAHTALAMAMNKLGGKSNTGEGGEQPSRMEPLANGSMNPKRSAIKQVASGRFGVSSYYLTNADELQIKMAQGAKPGEGGELPGHKVIGDIAVTRHSTAGVGLISPPPHHDIYSIEDLAQLIHDLKNSNPRARISVKLVSEAGVGVVASGVVKGHADHVLISGHDGGTGASRWTGIKNAGLPWELGLAETHQTLVANGLRGRAILQTDGQLKTGKDVAVACLLGAEEFGFSTAPLITLGCIMMRKCHTNTCPVGIATQDPVLREKFAGEPEHVINFFFMLAEELREIMSQLGFRTITEMVGRSDMLEVDPEVVKSNEKLENIDLSLILKPAAEIRPGAA-QYCVEKQDHGLDMALDNKLIALSKAALE-KEVRVFIETPIQNTNRAVGTMLSHEVTKRYHMKGLPA-GTIHVKLTGSAGQSLGAFLCPGITLELEGDSNDYVGKGLSGGKIVVYPPRDS--TFIPEDNIVIGNVALYGATIGEAYFNGMAAERFCVRNSGAQAVVEGIGDHGCEYMTGGTVVILGKTGRNFAAGMSGGIAYVYDIDGKFSVRCNHELVDLYHVEEE--EDITTLKMMIEQHRLNTGSVVARDILSNFDTLLPKFVKVFPRDYKRVLDNMKAEKAAAKLAKEPKISNGVSVTTKKVQPEQST-----------NRPTRVSNAKKYRGFISYERESISYRDPNERVKDWKEVAIESVPGPLLNTQSARCMDCGTPFCHQESSGAGCPLGNKIPEFNELVHQNRWREALDRLLETNNFPEFTGRVCPAPCEGSCVLGIIENPVSIKSIECAIIDKGFEEGWMVPRPPLQRTGKKVAIIGSGPAGLAAADQLNKMGHFVTVFERADRIGGLMMYGVPNMKTDKIEIVQRRVNLMAEEGITFVVNANVGSDPLYSIERLRSENDAVILACGATKPRDLGIPGRELSGVHFAMEFLHANTKSLLDSNLEDGRYISAKGKKVVVIGGGDTGTDCIGTSIRHGCTSIVNLELLTKPPSKRAADNPWPQWPRIFRVDYGHQEASSKFGNDPRTYEVLTKRFIGDENGNVKALEVVRVKWEKVDGRFQF--KEIEGSNETIEADLVLLAMGFLGPEATIAEKLGLEKDNRSNFKAQFGNFATSVDGIFAAGDCRRGQSLVVWAITEGRQAAAAVDK 2141          
BLAST of Glutamate synthase vs. TrEMBL
Match: A0A1S3HCB8 (glutamate synthase [NADH], amyloplastic-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106153998 PE=4 SV=1)

HSP 1 Score: 2595.46 bits (6726), Expect = 0.000e+0
Identity = 1283/2096 (61.21%), Postives = 1585/2096 (75.62%), Query Frame = 2
Query:  149 GLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKE-NGTELPERGKFAVGMLFVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDDQSFQHEEDPLLAN-----------------------YDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREM---KNQPK-----LIDATQEKVEEK------NSIELEK-------NGLIDIEDLVTSNT-------NLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTSLAGPGGLLDVLKAIPVVS 6280
            GLYDP  E+DSCGVGFVV+I+G +T+++++ A+ ML  MEHRG    DNDTGDGAGV+ GIP+ELY    +E +G  LPE+G +A G+ F+D +  +K    F  +  +  LE + W+    DN  IGS+A + EP + Q+F+  N E+     L+R+VF+LRK     + +  +RFYICSLS  T+VYKG FT+RQ+W +Y DL DP++KTH+A++H+RFSTNTFPSWERAHPQR LAHNGEINTLRGNINLM+AREGVMK+  FG  L +L+P++E N+SDSG  DN LEFL  A  R LPE ++ M+PEAW ND  M   KK +Y + A+ +EPWDGPAL+ F DGRYVGAILDRNGLRPSR+YV+  + + M+SE+GV    P NI  KGRLK GR+LLVDTE K+ + D+ +KN++  LRP  +W+ E+ +T+ DL +   DD+   + E  L  N                        D+RL LFGYT E +  L+LPM+K +KEALGSMGNDAPLAC+S +NPL+F+YFKQLFAQVTNPPIDPFREK+VM+LACP+GPE NILEP+  QC RLWL+QP+LSL D DV+  ++Y+GW  K +++ +P++      + A+D +C +A  A   GY+++VLSDR V +  +++ SL+ +GAVHHYLI+ KLR+K  LI++TGEAREVHHFCTLL YGADAICPY V E + RLRD+G++E   +D  +F++++ A   G+ KVMAKMGISTLHSYKGAQIFEAVGL +EVI KCF GTASRIGG TF  LA E L RH Y Y+++ GDN+I+ NPGFYHWR+GGE H+N+PT ++ LQ + + NNK+ +SKF+ S+  S+R+C +RGQL+   + + + + EVEPA  IVKRF TGAMSFGSIS EAH+TLAIAMNR+G KSNTGEGGE PER+L+ DPQ N RSAIKQVAS RFGVTS+YLAHADELQIKMAQGAKPGEGGELPG+KVS EIA TR++I GVGLISPPPHHDIYSIEDLA+LIYDLK A+P ARISVKLVSE+G+GVVA+GV KGKAEHITISGHDGGTGASSWTGIK+AGLPWELG+AETHQ L+LN+LRSRVVLQADGQ+RTGRDV+IA LLGADE G STAPLIV+GCTMMRKCHLNTCPVG+ATQDP+LRKKFEG PEHVVNY F+LAE+VR  +AK+GFRS  E +G S+ L+ T + +N KA LLD   +L + +   P V I  G V QDF L +R+D  LIK A  V+ G  ++  I++ + N+DR F +TLSY +SK F +  LP   SI IN  G+GGQSFCAFL +GI V LEGD+NDYV KGLSGGEVVI PPK+  P F S  NIIVGNVCLYGA SG+  FRG+AAERFCVRNSGA AVVEG GDHGCEYMTGGRVI+LG TGRNFAAGMSGG AYV D +  F  +CNM+ +DL  +  + V   F+   L EFH KT S IA+ +L NW + +  FVKVFPKEYR+ L ++   K Q K     +     E++E        NS  LE+         + DIE++V   T        LDK +GF+KY R    YR   ER+ DW EIY HK V+ GL+ QAARCMECGVPFCQS +GCPLGNIIPKWNDLV+K  WKEAL QLLQTNNFPEFTGRCCPAPCE ACVLGIN PAVTIKNIECAIID  FD+GWMV   P  +TGK + VVGSGPSGLA A QLNKAGH V V ERNDR+GGLLQYGIP+MK+ KDVVQRR+  +  EGI F+T V IG     A +L++ +DA VLC GA+WPRD+ IPGR L GIHFA+SFLE WQ+ Q   +N +YL+  AKD+DV+++GGGDTG DCIATSLRQGARS+TTFEILP P   R+S NPWP WPRI+RVDYGH+E K+++G DPR F +MSKEFL DENG V+GI+TV+V+W +D +  +W + E+PNSE V+  +++LLAMGFLGPEK II++L L  D R+NI+TPSGKY+TS+ KV+AAGDCRRGQSLVVHAINEGRQAARE+D D+M +TSLAGPGG++ + K +P ++
Sbjct:   16 GLYDPECERDSCGVGFVVNIDGNRTYQVLKHAQTMLERMEHRGGCGCDNDTGDGAGVLCGIPHELYAKVVREEHGINLPEQGAYATGIFFMDEQGSKKCEMLFDQLATDNGLEVLCWRTVPGDNKVIGSIAAAKEPLLRQVFVTVNPEERTE--LQRRVFVLRKQATHRIPQLGFRFYICSLSTATIVYKGLFTSRQIWHYYKDLSDPDFKTHVALVHSRFSTNTFPSWERAHPQRYLAHNGEINTLRGNINLMKAREGVMKSSTFGDDLQKLYPVVEKNLSDSGMFDNVLEFLCAAGGRELPEAIMNMVPEAWQNDKTMPELKKNYYHYCAFGMEPWDGPALLAFCDGRYVGAILDRNGLRPSRFYVTSDNHLIMASEVGVTDFTPPNIKQKGRLKPGRMLLVDTEEKQFLQDDVIKNKLATLRPHGEWLKEI-ITMADLFEAY-DDEKLHNSEHILGVNDVDNMVNGITENGMPGVSGSVVEEDRRLPLFGYTVETLNFLVLPMVKARKEALGSMGNDAPLACISEFNPLMFDYFKQLFAQVTNPPIDPFREKVVMSLACPVGPEQNILEPNRLQCQRLWLDQPLLSLIDCDVIKGINYKGWKAKVLNMVFPVAFGDKGLVPALDRLCAEAAEAAIEGYQLIVLSDRKVDRNHVNISSLLAIGAVHHYLIDHKLRMKVGLILETGEAREVHHFCTLLAYGADAICPYLVLESLGRLRDQGLMEPPLSDIEIFDNYMAATARGISKVMAKMGISTLHSYKGAQIFEAVGLHEEVIKKCFEGTASRIGGATFRVLAQEVLNRHAYAYSRKEGDNFIITNPGFYHWRQGGEKHMNDPTTIANLQDAARNNNKSAYSKFVESATESTRWCTLRGQLDMRVSKQQVDISEVEPAANIVKRFVTGAMSFGSISLEAHSTLAIAMNRLGGKSNTGEGGESPERYLNEDPQNNTRSAIKQVASGRFGVTSSYLAHADELQIKMAQGAKPGEGGELPGYKVSKEIAKTRHSIPGVGLISPPPHHDIYSIEDLAELIYDLKCASPAARISVKLVSEMGVGVVAAGVAKGKAEHITISGHDGGTGASSWTGIKNAGLPWELGIAETHQVLVLNDLRSRVVLQADGQMRTGRDVMIACLLGADEIGFSTAPLIVMGCTMMRKCHLNTCPVGVATQDPVLRKKFEGMPEHVVNYFFMLAEEVRGHLAKMGFRSYQEAVGRSDFLRMTANPVNAKAKLLDLGPILHSAAEMKPGVNIVGGSVAQDFKLANRLDNQLIKAAMDVLEGKSSQCNIDMTVCNEDRTFGATLSYEVSKRFVEAGLPD-GSININLKGSGGQSFCAFLAKGIHVTLEGDSNDYVGKGLSGGEVVIYPPKDMPPGFKSIKNIIVGNVCLYGATSGKALFRGQAAERFCVRNSGATAVVEGCGDHGCEYMTGGRVIILGLTGRNFAAGMSGGFAYVLDREKVFHGKCNMETIDLESLGDEDV--PFVKGLLEEFHTKTGSEIAKDVLDNWEQAMDDFVKVFPKEYRRALLDIAKEKAQAKEDLEFMEKMRAERIENDYKEDIVNSKSLERLLEVHHEKTVKDIEEIVADTTAEKKLEKALDKTRGFVKYKRATYQYRQPAERMKDWNEIYNHKQVQNGLKEQAARCMECGVPFCQSSNGCPLGNIIPKWNDLVFKGFWKEALDQLLQTNNFPEFTGRCCPAPCEGACVLGINSPAVTIKNIECAIIDHAFDQGWMVAHPPSERTGKTVAVVGSGPSGLACAHQLNKAGHTVTVYERNDRVGGLLQYGIPTMKLGKDVVQRRVELLKGEGITFKTNVEIGK-TLSAQQLVDGHDATVLCCGATWPRDLPIPGRQLDGIHFAMSFLETWQKKQMG-NNLDYLKYYAKDRDVLVIGGGDTGCDCIATSLRQGARSITTFEILPRPPPDRSSDNPWPTWPRIFRVDYGHDECKVKFGNDPRIFCVMSKEFLGDENGRVSGIKTVQVDWKKD-ENGRWNLVEIPNSEKVYKADLILLAMGFLGPEKTIIDELSLNQDPRSNIETPSGKYRTSVKKVFAAGDCRRGQSLVVHAINEGRQAAREVDLDLMAKTSLAGPGGVV-IAKGVPTIA 2100          
BLAST of Glutamate synthase vs. TrEMBL
Match: C3XUM8 (Glutamine amidotransferase type-2 domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_129259 PE=4 SV=1)

HSP 1 Score: 2594.3 bits (6723), Expect = 0.000e+0
Identity = 1270/2070 (61.35%), Postives = 1570/2070 (75.85%), Query Frame = 2
Query:  101 RFKKMNLPFSNYPANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKE-NGTELPERGKFAVGMLFVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDDQSFQHEEDPLLANYDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQPKLIDATQEKVEEKNSIELEKNG----LIDIEDLV------TSN-----TNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTSLAGPGGLLDVLK 6262
            R +++  P   YP   GLYDP  EKDSCGVGFVV+I G ++HK++ +++ ML  MEHRGA   D+DTGDGAG +TGIP+ELY    KE  G ELP RGK+A G+LF+     ++S + F  I ++C L  + W+    D + IG+VA+ TEP I Q+F+     D+  +  +RQVF LRK     +  ++ RFYICSL+   VVYKGQ T  QLW+++LDL+DP+Y TH++++H+RFSTNTFPSWERAHPQR LAHNGEINTLRGN+NLMRAREGVM + +F  +L EL+P++E + SDSGC DN LEFL +A  RSLPE V+TM+PEAW ND  M   KK FY W+A ++EPWDGPAL TFSDGRY+G+ILDRNGLRPSRYYV+ S  + M+SE+GV+ I PE+++ KGRLK GR+LLVDT++ +I  D  LK +I   RP   W++++ +TL DL++  P D+   +         D+RL L+GYT E + ML+LPMIK+KKEALGSMGNDAPLACLS Y+PL+FEYFKQ+FAQVTNPPIDPFRE++VM+LACPIGPE+NILEPS  QC RL+L  P+L+L+DL+V+      GW T  ID+TYP+       + A++ VC     A   G+  ++LSDR   ++++ + SL+V GAVHHYLIN + RLK  LI++TGEAREVHH C LLGYGADAICPY V+E V  LRD+ +L+   +++ +  +++ A +TG+ KVMAKMGISTLHSYKGAQIFEAVGL +EV+DKCF GTASR+GGVTFE LA ESL RH   +  R  DNY++ NPGFYHWR+GGE HIN+P +++ LQ + K  NK  + KF  S+  + R C +RGQL+     EP+ L  +EPA EIVKRF TGAMSFGSIS E HTTLA AMNR+GAKSNTGEGGE PER+       + RSAIKQVAS RFGVTS YLAH+D+LQIKMAQGAKPGEGGELPGHKVS +IA TR ++ GVGLISPPPHHDIYSIEDLA+LIYDLKAANP ARISVKLVSEVG+GV+A+GV KGKAEHITISGHDGGTGASSWTG+KHAGLPWELG+AETHQTL++N+LRSRV LQ DGQIRTGRDVVIA LLGADEFG STAPLI LGCTMMRKCHLNTCPVG+ATQDP+LR KF GKPE+VVNYLF LAE+VR++MAK+GFR+  ELIG ++ LK     IN K++LLDF  +L N     P + I  G ++QDF    R+D  L+++AS V+ G +  + I + I N+ RAF STLSY IS  +G+  LP+  SI I   G+ GQSFCAFL  G+ V LEGDANDYV KGLSGGEVVI P ++   DF S++NIIVGNV LYGA SG+ FFRG+AAERFCVRNSGA AV EG GDHGCEYMTGGRVI+LG TGRNFAAGMSGG+AYV DT+  F  +CN++ V L P+ ++  D  F+  T+ +FH+ T SV+A+K+L NW+E    FVK+FP EYRK L +MK +  +  A +    + N +    NG      DIED +      T N       LDK++GF+KY R+ + YRNV++R+NDW EIY HK VR  L+ QAARCM+CGVPFCQSH GCPLGNIIPKWNDLV+ D WKEAL +LLQTNNFPEFTGR CPAPCE ACVLGIN   VTIKNIECAIID  F++GW+VP      TGK++ VVGSGPSGLAAAAQL KAGHAV V ERND IGGLL+YGIP+MK+SK+VVQRR++ M EEG+ F     IG D  PA  LL D DA++L  GA+WPRD+ IPGR L GIHFA+SFLEKWQ+ Q    NT    ++AKDKDV+++GGGDTGVDCI T+LRQGA++VTTFEILP P K RA  NPWP WPR++RVDYGHEEV+L++GKDPRHF I+SKEFL D  G+VAG+RTVK++W RD ++ +W MK+VP+SE +F  +++LLAMGFLGPE  I ++L +++D R+N  T S  Y+ +IPK+YAAGDCRRGQSLVV AI+EGRQAAR+ID D+M  TSLAGPGG++   K
Sbjct:    6 REEELRDPPYGYPEKQGLYDPAYEKDSCGVGFVVNIEGNRSHKVLRDSQTMLERMEHRGACGCDSDTGDGAGCLTGIPHELYSRVLKEEQGIELPPRGKYATGLLFLGKNTYQQSQDIFQQIAEKCRLSVLCWRTVPTDETKIGTVARETEPCIKQVFV---TGDMEAEEFRRQVFSLRKQATHKISTDSRRFYICSLNQDIVVYKGQTTTTQLWQYFLDLQDPDYLTHLSLVHSRFSTNTFPSWERAHPQRYLAHNGEINTLRGNVNLMRAREGVMSSLSFKDQLKELYPVVEKDQSDSGCFDNVLEFLVNAGGRSLPEAVMTMVPEAWQNDKYMEKGKKDFYQWSACAMEPWDGPALFTFSDGRYIGSILDRNGLRPSRYYVTKSGYLVMASEVGVLDIPPEDVLRKGRLKPGRMLLVDTQVGEISGDTELKRQIAGARPHGDWLSKL-VTLDDLYKAQPTDEVNNNITRYPNVEDDRRLPLYGYTIETLSMLVLPMIKNKKEALGSMGNDAPLACLSQYSPLVFEYFKQMFAQVTNPPIDPFRERVVMSLACPIGPESNILEPSEGQCRRLFLQHPMLTLQDLEVIKATRVHGWKTCTIDVTYPVEDGTRGLVPALNRVCEDCSQATKEGFTYLILSDRAACKERVPIASLLVCGAVHHYLINTRQRLKVGLILETGEAREVHHLCLLLGYGADAICPYLVYESVINLRDQRLLDPPLSEQHIMANYIQASQTGISKVMAKMGISTLHSYKGAQIFEAVGLGKEVVDKCFTGTASRLGGVTFEMLARESLNRHHVAFADRDCDNYVIQNPGFYHWRDGGEKHINDPLSIANLQDAAKNKNKGAYEKFKESTLEAVRACTLRGQLDLKTLDEPLDLSLIEPASEIVKRFATGAMSFGSISIETHTTLAKAMNRVGAKSNTGEGGENPERYQDQPVDNSTRSAIKQVASGRFGVTSDYLAHSDDLQIKMAQGAKPGEGGELPGHKVSKDIAKTRKSVPGVGLISPPPHHDIYSIEDLAELIYDLKAANPRARISVKLVSEVGVGVIAAGVAKGKAEHITISGHDGGTGASSWTGVKHAGLPWELGIAETHQTLVMNDLRSRVCLQTDGQIRTGRDVVIAGLLGADEFGFSTAPLITLGCTMMRKCHLNTCPVGVATQDPVLRAKFAGKPEYVVNYLFYLAEEVRDLMAKMGFRTFQELIGRTDVLKMAEKPINEKSALLDFEPILKNALDMRPGINIVAGSIQQDFQQEKRLDNKLVEEASDVLEGKKPTVDIRMNIQNEARAFASTLSYNISMKYGEKGLPA-GSINIYLKGSAGQSFCAFLAPGVRVELEGDANDYVGKGLSGGEVVIYPTRSLPEDFDSKDNIIVGNVVLYGATSGKAFFRGQAAERFCVRNSGATAVCEGCGDHGCEYMTGGRVIILGLTGRNFAAGMSGGLAYVLDTEKTFQTKCNLEQVSLDPVEEEE-DVSFLKDTIKQFHEATGSVMAQKVLQNWAEYQPQFVKIFPHEYRKALEKMKEEEAMQVADEPVANDDNKLVNGTNGNGKPEKDIEDTIPDAEMDTKNEKRVMEKLDKVRGFVKYERNTDAYRNVKQRLNDWKEIYNHKGVRSQLKVQAARCMDCGVPFCQSHSGCPLGNIIPKWNDLVFHDQWKEALDRLLQTNNFPEFTGRVCPAPCEGACVLGINAKPVTIKNIECAIIDHAFEQGWIVPHQ-YPSTGKKVAVVGSGPSGLAAAAQLCKAGHAVTVYERNDEIGGLLRYGIPTMKLSKEVVQRRVDLMAEEGVVFVKNTQIGKD-LPAKTLLEDNDAVLLSCGATWPRDLPIPGRKLEGIHFAMSFLEKWQKKQ--HGNTSISPIMAKDKDVLVIGGGDTGVDCIGTALRQGAKTVTTFEILPEPPKERADNNPWPLWPRVFRVDYGHEEVRLKYGKDPRHFEILSKEFLDDGKGNVAGVRTVKIQWVRD-ESGRWQMKDVPDSERIFKADLILLAMGFLGPENTIADELGVDLDPRSNFDTSSAPYKCNIPKLYAAGDCRRGQSLVVTAISEGRQAARQIDLDLMGFTSLAGPGGVVTATK 2064          
BLAST of Glutamate synthase vs. TrEMBL
Match: A0A087SV69 (Putative glutamate synthase [NADPH] (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_00166 PE=4 SV=1)

HSP 1 Score: 2591.99 bits (6717), Expect = 0.000e+0
Identity = 1274/2067 (61.64%), Postives = 1578/2067 (76.34%), Query Frame = 2
Query:  116 NLPFSNYPANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKEN-GTELPERGKFAVGMLFVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDDQSFQHEEDPLL---------ANYDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQPKLI--DATQEKVEEKNSIELEKNGLIDIEDLVTSNTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTSLAGPGGLLDVLKAIPVVS 6280
            +L +   P   GLY P  EK++CGVGF+V+INGK +HK+I +A  +   MEHRGA + DN TGDGAGVM  IP+  Y    KE  G  LP +G++A G++F+D +    +  RF  + KE HLE + W+   +++S +G VAKSTEP + Q+F+     D  P   +R+ F+LRKY    +   + RFYICSLS  TVVYKGQ T+ QLW ++ DL++P ++TH+A++H RFSTNTFPSWERAHP RMLAHNGEINTLRGN+NLMRAREGVMK+  FG +L +L+P++EPN+SDSGC DN LEFL  A  RSLPE V+TM+PEAW ND  M P KKAFY W+   +EPWDGPAL+TF+DG  +GAILDRNGLRPSRYY++  + M M+SE+GV+ +   NI+ KGRL+ GR+LLVDT+    I DE LK +I Q RP+ +W+ EM  TL+DLH       +  H   P L         A  D+RL+LF YT E I MLI+PM+  KKEALGSMGNDAPLACLS+Y PL+++YFKQLFAQVTNPPIDPFRE+IVM+LACPIGP ANILEPSAEQC RL+L QPILSL+D+  L    Y+GW TK ID+ YP+ +     +  +  +C +A +A   GY +V+LSDR  G+  I + +L+ +GAVHH+LINK  R+K  L+++TGEAREVHH C LLGYGADAICPY VFE +  L+ EGV+ +H T++M+F+++V A E G+ KVMAKMGISTL SYKGAQIFEAVGL+QEV+D CF  T SRIGGVTF  LA E+L R+   Y+ R  DN +L NPG YHWR GGE HIN+P A++ LQ + + NNKN ++KF+ ++  + R C +RGQ E     EPI + EVE AKEIVKRF TGAMSFGSIS EAH TLA+AMNR+G KSNTGEGGE P+R++  DP  N RSAIKQVAS RFGVT  YL +ADELQIKMAQGAKPGEGGELPG+KVS +IA TR++I GVGLISPPPHHDIYSIEDLA+LIYDLK ANP ARISVKLVSEVG+GVVASGV KGKAEHITISGHDGGTGASSWTGIK AGLPWELG+AETHQTL+ N+LRSRVVLQADGQIRTG DVV+AA+LGADEFG STAPLIVLGCTMMRKCHLNTCPVGIATQDP LRKKFEGKPEH+VNYLF+LAEDVR  MA+LG R   +LIG ++ L+   +  N K+ LLD++ +L +     P   I  G +KQDF L +R+D  LIKQA+ VI   + ++ I++ I N DRAF STLSY I+K +G N LP + SI+I   G+ GQSFCAFL +GI V LEGDANDYV KGLSGG V++ PP    PDF SE NIIVGNVCLYGA SG+ FFRG AAERFCVRNSGA AV+EG+GDHGCEYMTGG  ++LG TGRNFAAGMSGGIAYV D K     R N+ MVDL P+ + S D  F+   L EF +KT S +A+++LS W  + K FVKVFPKEY++ LR+ + + KL+  +     +E   ++ ++     DIED++    NLDK++GF+KY R  NPYR   +R++DW EIY  K VRK ++ QAARCMECGVPFCQS HGCPLGNIIPKWNDLV+KD+W+EAL QLLQTNNFPEFTGR CPAPCE ACVLGINEP V IK+IECAIID  FD+GWM+P  P V+TGK+I ++GSGPSGLAAAAQLNKAGH V V ERNDR+GGLL+YGIP+MK+SK++V+RR++ +  EGI F T V++G D   A  LL + DA++L VGA+WPRD+ IPGR L+GIHFA++FLE WQ+HQ   +  +Y +V AKDKDVII+GGGDTG DCIATSLRQGA+S+ TFEILP P + RA  NPWP+WP+++RVDYGH+EVK+++G DPR+F I+S++FL D NG+V+GI T+KVEW +D+ +  W M+++P SE VF  ++V+LAMGFLGPE+ +++ + ++ D R NI TP G Y+TSIPKVYAAGDCRRGQSLVVHAI+EGRQAAR+ID D+M  +SLAGPGG++  +  + V +
Sbjct:    7 SLEYHGLPPPKGLYHPQFEKEACGVGFIVNINGKASHKLIVDAATISKRMEHRGACACDNSTGDGAGVMAAIPHSFYSQVLKEELGITLPPKGQYATGIMFLDRKTNRTAETRFEQLAKELHLEVLCWRDVPVESSILGFVAKSTEPLMRQVFVVGPSMD--PDTFRREAFVLRKYATHKIPSSDLRFYICSLSTDTVVYKGQLTSTQLWSYFYDLQNPAFETHLALVHARFSTNTFPSWERAHPMRMLAHNGEINTLRGNVNLMRAREGVMKSQLFGEELHKLYPVVEPNLSDSGCADNVLEFLVMAGQRSLPEAVMTMVPEAWQNDNLMNPDKKAFYRWSGCVMEPWDGPALLTFTDGNLIGAILDRNGLRPSRYYLTRDNHMIMASEVGVLDLENSNIVQKGRLRPGRMLLVDTQKHVFIKDEELKLQIAQKRPLGEWLKEM-FTLEDLHA--AGYAAGHHTSYPKLDPSKRTMSQAVEDRRLALFAYTIETINMLIVPMVDTKKEALGSMGNDAPLACLSLYQPLIYDYFKQLFAQVTNPPIDPFRERIVMSLACPIGPAANILEPSAEQCCRLYLEQPILSLKDIQALKATTYKGWKTKVIDMVYPVHEGAEGLLPTLKKICAEACSAAENGYSLVILSDRKAGRDYIPISALLALGAVHHHLINKLQRMKVGLVLETGEAREVHHMCVLLGYGADAICPYLVFESMAELQGEGVISEHLTEDMIFQNYVEATERGIAKVMAKMGISTLQSYKGAQIFEAVGLSQEVVDLCFKNTPSRIGGVTFRILAEENLERYRIAYSDRDCDNIVLRNPGNYHWRSGGEKHINDPLAVANLQDAARTNNKNAYAKFVETTMENVRACTLRGQFELAKVPEPIDICEVEEAKEIVKRFATGAMSFGSISLEAHKTLAMAMNRVGGKSNTGEGGEDPDRYVIADPNNNARSAIKQVASGRFGVTIEYLTNADELQIKMAQGAKPGEGGELPGYKVSKDIAKTRHSIPGVGLISPPPHHDIYSIEDLAELIYDLKCANPSARISVKLVSEVGVGVVASGVAKGKAEHITISGHDGGTGASSWTGIKGAGLPWELGIAETHQTLVQNDLRSRVVLQADGQIRTGFDVVVAAILGADEFGFSTAPLIVLGCTMMRKCHLNTCPVGIATQDPELRKKFEGKPEHLVNYLFMLAEDVRSHMAELGIRKFQDLIGRTDLLRMYHNEKNPKSLLLDYSAILLDALSLRPGTCIIGGSLKQDFQLENRIDNLLIKQAADVIDRRKKDVTIHMDITNVDRAFGSTLSYHIAKKYGANGLPDN-SIKIKLEGSAGQSFCAFLARGICVELEGDANDYVGKGLSGGTVIVYPPTRLPPDFKSEENIIVGNVCLYGATSGKAFFRGIAAERFCVRNSGATAVIEGVGDHGCEYMTGGFCLILGPTGRNFAAGMSGGIAYVLDEKRSLESRSNLMMVDLLPL-ELSEDLNFVESLLKEFFEKTGSAVAQRLLSTWPASAKNFVKVFPKEYQRALRQAEEE-KLVMTNGPTSAIEATKTVTVK-----DIEDVIPD--NLDKVRGFMKYQRMTNPYREPSDRLHDWNEIYNFKGVRKTIKVQAARCMECGVPFCQSSHGCPLGNIIPKWNDLVFKDDWREALNQLLQTNNFPEFTGRVCPAPCEGACVLGINEPPVNIKHIECAIIDNAFDKGWMIPQIPAVRTGKKIAIIGSGPSGLAAAAQLNKAGHTVHVYERNDRVGGLLEYGIPTMKLSKEIVKRRVDLLTAEGITFHTNVNVGKD-ISAKSLLEENDALLLTVGATWPRDLPIPGRELNGIHFAMNFLETWQKHQLG-NKIDYSKVNAKDKDVIIIGGGDTGCDCIATSLRQGAKSIVTFEILPEPPERRAVDNPWPQWPKVFRVDYGHQEVKVKFGDDPRNFCILSEKFLDDGNGNVSGISTIKVEWKKDT-SGNWVMEKIPGSEKVFKADLVMLAMGFLGPEQYLLSDIGVQQDPRKNIATPKGNYRTSIPKVYAAGDCRRGQSLVVHAISEGRQAARQIDADLMKCSSLAGPGGVIPYVTQLSVAA 2055          
BLAST of Glutamate synthase vs. TrEMBL
Match: A0A4D5R9J1 (Glutamate synthase OS=Scolopendra viridis OX=118503 PE=4 SV=1)

HSP 1 Score: 2578.51 bits (6682), Expect = 0.000e+0
Identity = 1279/2071 (61.76%), Postives = 1603/2071 (77.40%), Query Frame = 2
Query:  122 PFSNYPANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELY-QSFAKENGTELPERGKFAVGMLFVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIK-TNVEDIHPKLLKRQVFILRKYG-ERVMREENY-RFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIP--------DDQSFQHEEDPLLANYDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYD--TKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQPKLIDATQEKVEEKNSIELEKNGLI----------DIEDLVT----SNTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTSLAGPGGLL 6250
            P  +YP   GLYDP+ E+D+CGVGF+V I+G  +HKI+ +A  + I MEHRGA + DNDTGDGAGVMT IP++LY +   K++G  LP +G +A G++F+D+E   KS E F  I +EC L+ + W+    DN  IG VAK  EP + Q+F+  TN ED      KRQ FILRK    R+ + E+  RFYICSLS +T+VYKGQFT+ QLW+++LDL+DP+Y+ ++A++H RFSTNTFPSWERAHP R LAHNGEINTLRGN+NLM+AREGVMK++ +G  L  L+P++EPN+SDSG +D  LEFL  A  RSLPE VITM+PEAWHND  M P K+ FY W+A ++EPWDGPAL+TF+DGRY+GAILDRNGLRPSRYYV+  +IM M+SE+GV+ ++  NI+ KGRLK GR+LLVDT+ K    DE LK EI + RP+++W+ E+ +T +DL+   P        D     HE + ++  +D+RL++FGY  E I++L+LPM+K KKEALGSMGNDAPLACLS Y PL+++YFKQLFAQVTNPPIDPFRE +VM+LACPIGP+ANILEPSA+QC RL+++QPILS++ L+VL    Y+GW T  IDI YP+  +    + A+D VC++A +A  +GY +VVLSDR  G+K + + SL+ +GAVHH+LI+K+ R+K  +I++TGEAREVHH C LLGYGADAICPY VFE +Q LRDEG++    T++ +++++  A   G+ KVMAKMGISTL SYKGAQIFEAVGL+ EVIDKCF GT SR+GG TF  LAI+ + RH   Y+ R  D+ IL NPG YHWR GGE HINEPT ++ LQ ++K N+ + + KF+ S   S R C +RGQLE +Y  + I + EVEPAKEIVKRF TGAMSFGSIS EAH +LAIAMNRIG KSNTGEGGE  +R+L+ DPQ N RSAIKQVAS RFGVTSAYLA++D+LQIKMAQGAKPGEGGELPG+KV+ +IA TR++I GVGLISPPPHHDIYSIEDLA+LIYDLK ANP ARISVKLVSE+G+GVVASGV KGK+EHITISGHDGGTGASSWTGIK+AGLPWELG++ETHQTL+LN+LRSR+VLQ DGQIRTG DVV+ A+LGADEFG STAPLIVLGCTMMRKCHLNTCPVG+ATQDP LRKKFEGKPEHVVNY FLLAE+VR IMAKLG R   ELIG ++ ++   D  N KA  LDF+ +L N     P V    G +KQDF L  R+D++LI+++  V+ G    + I++KI N+DRAF STLSY IS   GD  LP + SI I+  G+ GQSFCAF+ +GISV LEGDANDYV KGLSGGEVVI PPK+   DF SE+NIIVGNVCLYGA +G+ FFRG AAERFCVRNSGAIAVVEG GDHGCEYMTGG  ++LG TGRNFAAGMSGG+A++ +  +   F + CN  MVDL P++Q   D + +H  L+EF  KT S +A+ +L++W      FVKVFPKEY++ LR++  Q +     ++K++E  + E  KN ++          DIE+ +     +  +LDK +GF+KY R   PYR+ E R +DWGEIY    VRK L+ QAARCM+CGVPFCQS +GCPLGNIIPKWNDL+++DNWKEAL QLLQTNNFPEFTGR CPAPCE ACVLGINEPAV IKNIECAIID  F++GWMVP  P ++TGK+I V+G GP+GLAAAAQLNK GH V V ERN+R+GGLLQYGIP+MK+SK++VQRR+  M +EGI F TG ++G D    D LL D+DAI+L  GA+ PRDI IPGR+L GI+FA++FLE WQ+ Q ++ + +YL+  AKDKDV+++GGGDTG DCI TSLRQGA+S+T+FEILP P   RA  NPWP+WP+I R+DYGH+EVK++WG DPRH+ I+SKEF+ D NG+V+GIRTV+VEWT+D++   W MKE+  +E +F  ++VLLAMGFLGPEK +  +L++E D R+N+KTP GK+ +S+PK+YAAGDCRRGQSLVVHAI+EGRQAAR+ID D M  T L GPGG++
Sbjct:    5 PQWSYPEKQGLYDPSFERDACGVGFIVSIDGISSHKILRDAETISIRMEHRGACACDNDTGDGAGVMTTIPHKLYNREIEKDHGFSLPPKGSYATGIIFMDSETNSKSEELFAEIAEECRLKVLCWRSIPTDNGMIGKVAKMGEPFMRQVFVTWTNEEDD----FKRQTFILRKRATHRIPKHEDVKRFYICSLSNETIVYKGQFTSTQLWQYFLDLQDPDYEPYLALVHARFSTNTFPSWERAHPMRFLAHNGEINTLRGNVNLMQAREGVMKSNVYGEDLKSLYPVVEPNLSDSGSVDCVLEFLVMAGGRSLPEAVITMVPEAWHNDNLMNPEKRDFYHWSACAMEPWDGPALLTFTDGRYIGAILDRNGLRPSRYYVTKDNIMIMASEVGVLDVDHSNILKKGRLKPGRMLLVDTKEKVFTRDEELKLEIARQRPLKEWLQEL-ITFEDLYAAHPPIVSPTVYDFPPGPHERESVM--HDRRLAMFGYNTETIHLLVLPMVKTKKEALGSMGNDAPLACLSQYQPLIYDYFKQLFAQVTNPPIDPFRESVVMSLACPIGPQANILEPSAQQCRRLFIDQPILSIKKLEVLKNTTYKGWKTHVIDIVYPIEDDVNGLLPALDHVCQEAYDAAKSGYTLVVLSDRKAGEKFVPISSLLALGAVHHHLISKRQRMKLGIILETGEAREVHHICVLLGYGADAICPYLVFETIQGLRDEGLVTPPLTNDEIYQNYADATARGISKVMAKMGISTLQSYKGAQIFEAVGLSPEVIDKCFKGTISRLGGATFNVLAIDDIHRHNLAYSPRECDSRILRNPGNYHWRSGGERHINEPTNIANLQDASKSNSVSAYYKFVDSCMESIRACTLRGQLELIYADQEIDIVEVEPAKEIVKRFATGAMSFGSISIEAHKSLAIAMNRIGGKSNTGEGGENADRYLNQDPQFNTRSAIKQVASGRFGVTSAYLANSDDLQIKMAQGAKPGEGGELPGYKVTEDIAKTRHSIPGVGLISPPPHHDIYSIEDLAELIYDLKCANPNARISVKLVSEMGVGVVASGVAKGKSEHITISGHDGGTGASSWTGIKNAGLPWELGLSETHQTLVLNDLRSRIVLQVDGQIRTGFDVVLGAILGADEFGFSTAPLIVLGCTMMRKCHLNTCPVGVATQDPELRKKFEGKPEHVVNYCFLLAEEVRSIMAKLGVRKFQELIGRTDFVRVRKDIQNPKAQGLDFSPILKNALALRPGVNTVGGSIKQDFQLDRRLDHELIEKSKDVLEGKADHIDISMKIRNEDRAFASTLSYFISLKHGDEGLPDN-SINISLKGSAGQSFCAFMAKGISVILEGDANDYVGKGLSGGEVVIYPPKDMPSDFKSEDNIIVGNVCLYGATTGKAFFRGMAAERFCVRNSGAIAVVEGCGDHGCEYMTGGIALILGPTGRNFAAGMSGGLAFILNNWSDKSFYDVCNKSMVDLLPLDQPD-DLKLVHDLLVEFEQKTESKLAQTLLADWPAPASEFVKVFPKEYQRALRQIAEQEE-----KQKIKEMEAAENVKNEIMHKEEIGQHIRDIEETIPDQKRAQVDLDKTRGFMKYKREMAPYRSAERRQHDWGEIYNFPHVRKSLKVQAARCMDCGVPFCQSSNGCPLGNIIPKWNDLIFQDNWKEALKQLLQTNNFPEFTGRVCPAPCEGACVLGINEPAVNIKNIECAIIDHAFEKGWMVPEIPSIRTGKKIAVIGGGPAGLAAAAQLNKCGHLVTVYERNNRVGGLLQYGIPTMKLSKEIVQRRVELMRQEGITFITGTNVGKDVSAKD-LLADFDAILLTTGATQPRDIPIPGRHLEGIYFAMAFLETWQKKQMND-DIDYLKYHAKDKDVVVIGGGDTGCDCIGTSLRQGAKSITSFEILPEPPPDRAFDNPWPQWPKILRIDYGHDEVKVKWGNDPRHYCILSKEFIDDGNGNVSGIRTVQVEWTKDAKG-NWCMKELEGTEKIFKADLVLLAMGFLGPEKYLKQELEVEEDPRSNVKTPLGKFNSSLPKIYAAGDCRRGQSLVVHAISEGRQAARQIDDDFMGSTFLPGPGGVI 2058          
BLAST of Glutamate synthase vs. TrEMBL
Match: A0A2R5LJA7 (Putative glutamate synthase (Fragment) OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 2571.96 bits (6665), Expect = 0.000e+0
Identity = 1264/2056 (61.48%), Postives = 1562/2056 (75.97%), Query Frame = 2
Query:  137 PANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELPERGKFAVGMLFVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMRE-----ENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDD------QSFQHEEDPLLANYDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQPKLIDATQEKVEEKNSIELEKNGLIDIEDLVTSN-------TNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTSLAGPGGLL 6250
            P   GLY+P +E++SCGVGF+V I+G  +HK++ +A  M   MEHRGA + DN+TGDGAGV+  IP+E Y+   +++   LP +G++A G+ F+D  +     + F        L+ + W+    D+S +GSVA+ TEP + Q F+    +      LKR VFILRK     + +     E  RFYICSLS+ T+VYKGQ T  QLW ++ DL+D  ++T++A++H RFSTNTFPSWERAHP RMLAHNGEINTLRGN+NLMRAREGVM     G KL EL+P++EPN+SDSG +D  LEFL  A  RSLPE V+TM+PEAW N+  M   K+ FY W+   +EPWDGPAL+TF+DGRY+GAILDRNGLRPSRYY++    M M+SE+GV+ I  E ++ KGRL+ GR+LLVDT  K +  DE LK +I + RP+E W+ E+  TL+DLH+           +S+  ++  L    D+R++LFGYT E I ML+LPM++ +KEALGSMGNDA  ACLS Y PL+++YFKQLFAQVTNPPIDPFRE+IVM+LACPIGPEANILEPS EQC RLWL QPI+SL D+ VL +V Y+GW +K IDI +P+ +     + AID +CR+A  A   GY +V+LSDR  G+  I + + + +GAVHH+LIN++ R+KC LI++TGEAREVHH C LLGYGADAICPY VFE+V  LR+EG+LE   +DE  F+++V A+E G+ KVMAKMGISTLHSYKGAQIFEAVGLA EV+DKCF  TASRIGG TFE LA E++ RH + YN+   DN IL NPG+YHWR GGE H+N+P +++ LQ +   ++K  + KF+ SS  S+R C +RGQLE +Y   P+ + +VEPAKEIVKRF TGAMSFGSIS EAHTTLAIAMNR+G KSNTGEGGE  +R+    P  N RSAIKQVAS RFGVT+AYLA++DELQIKMAQGAKPGEGGELPGHKVS +IA TR+++ GVGLISPPPHHDIYSIEDLA+LIYDLK +NP ARISVKLVSEVG+GVVASGV KGKAEHITISGHDGGTGASSWTGIK AGLPWELG+AETHQTL+LN+LRSR+VLQADGQIRTG DV++AA+LGADEFG STAPLIV+GCTMMRKCHLNTCPVGIATQDP LRKKF GKPEHVVNYLFLLAE+VR  +AKLG  SL E +G ++ L+   +    KASLL F  +L N     P   I+ G V QDF LG R+D  LIKQA  VI G    + +++ I N+DRAF +TLSY I+K +GD  LP   SI +   G+ GQSFCAFL +G++V LEGDANDYV KGLSGGEVVI PPK+  P+F SE+N+++GNV LYGA  GR F RG AAERFCVRNSGA AV+EG+GDHGCEYMTGG+ ++LG TGRNFAAGMSGGIAYV D   +F  +CN   VDL P+ + + D + +   + EF+D T S +A  +LS W E  K FVKVFPKEY++ LR++  +       +  VE+K +   EK  + DIE+++T           LDK +GF+KY R    YR   +R+ DW EIY HK VRK LR QAARCM+CGVPFCQS HGCPLGNIIP+WNDLVYK++W+EAL QLLQTN+FPEFTGR CPAPCE ACVLGINEPAVTIKNIECAIID+ F++GW+ P  P+V+TGK++ VVGSGP+GLA A QLNKAGH V V ERNDRIGGLLQYGIP+MK+ KDVVQRR+  M EEGI+F     +G D    D L+N+ DA+VL  G++WPRD+ IPGR+L GIH+A+SFLE WQ+ Q   ++ + L + AK+KDV+I+GGGDTGVDCIATSLRQGARS+ TFEILP P  SR   NPWP+WPRI RVDYGHEEVKL++G DPRHF+I+SKEFL D  GHVAGIRTV+V+W +D+ + +W   EVP +   F  ++VLLAMGFLGPEK +I++L LE D R NI+TP+GKY+TS+P+VYAAGDCR+GQSLVVHAINEGRQAARE+D+D+M  + LAGPGGL+
Sbjct:    1 PPAQGLYNPELERESCGVGFIVSIDGIPSHKLLHDAETMSRRMEHRGACACDNNTGDGAGVLVAIPHEFYKEKLRDHDVALPPKGEYATGIFFMDERHSSAMEKAFEAEAVRHGLKVLHWRTLPTDDSTLGSVARDTEPYMRQAFVVAG-KGQKGDALKRDVFILRKASSHKIPKMNIGGEEVRFYICSLSVDTIVYKGQLTTTQLWRYFPDLQDTTFETYIALVHARFSTNTFPSWERAHPLRMLAHNGEINTLRGNVNLMRAREGVMHTSLLGDKLHELYPVVEPNLSDSGSVDTVLEFLVMAGQRSLPEAVMTMVPEAWQNNSLMTKEKRQFYQWSGCIMEPWDGPALLTFTDGRYIGAILDRNGLRPSRYYITKDKYMVMASEVGVLDIPSELVVQKGRLRPGRMLLVDTLEKNVTKDEELKLQIARQRPLEAWLKEL-FTLEDLHKADTAQDGPVSMRSYAKQQSVL---QDRRMALFGYTTETINMLLLPMLQTEKEALGSMGNDASFACLSKYQPLIYDYFKQLFAQVTNPPIDPFRERIVMSLACPIGPEANILEPSPEQCRRLWLQQPIISLSDMAVLKRVHYKGWKSKVIDIVFPVREGNAGLLPAIDRICREACEAAKKGYTLVILSDRNGGRDYIPVSAALALGAVHHHLINERQRMKCGLILETGEAREVHHMCVLLGYGADAICPYLVFEMVGELRNEGLLE--LSDEDAFKNYVAAMERGISKVMAKMGISTLHSYKGAQIFEAVGLAPEVVDKCFKNTASRIGGSTFEVLAEETVQRHNFAYNQNDFDNQILRNPGYYHWRSGGEKHVNDPMSVANLQEAATSDSKAAYDKFVESSMQSNRECTLRGQLELIYAKNPLDISQVEPAKEIVKRFVTGAMSFGSISIEAHTTLAIAMNRVGGKSNTGEGGENADRYTGQSPDNNKRSAIKQVASGRFGVTAAYLANSDELQIKMAQGAKPGEGGELPGHKVSQDIAKTRHSVPGVGLISPPPHHDIYSIEDLAELIYDLKCSNPYARISVKLVSEVGVGVVASGVAKGKAEHITISGHDGGTGASSWTGIKGAGLPWELGIAETHQTLVLNDLRSRIVLQADGQIRTGFDVIVAAILGADEFGFSTAPLIVMGCTMMRKCHLNTCPVGIATQDPELRKKFAGKPEHVVNYLFLLAEEVRSHLAKLGLSSLQEAVGRTDLLRPYKNKDIPKASLLKFDAILLNALSMRPGTNIRGGSVAQDFELGKRMDNLLIKQAKDVIEGRGKHVTVHMDITNEDRAFATTLSYHIAKRYGDAGLPEDSSISVFLKGSAGQSFCAFLSKGVNVTLEGDANDYVGKGLSGGEVVIFPPKDLPPEFKSEDNVVIGNVALYGATCGRAFIRGLAAERFCVRNSGATAVIEGVGDHGCEYMTGGQAVILGVTGRNFAAGMSGGIAYVLDIDGQFKTKCNTSTVDLFPL-ELAEDLEKVESLIREFYDLTGSAVAAALLSKWPEPAKDFVKVFPKEYQRALRQLAEE-------KANVEKKAAAPAEK--VADIEEVITDAEMRKKQMEKLDKTRGFMKYKRETEYYRPAIQRMQDWKEIYNHKGVRKNLRMQAARCMDCGVPFCQSSHGCPLGNIIPRWNDLVYKEDWREALAQLLQTNSFPEFTGRVCPAPCEGACVLGINEPAVTIKNIECAIIDRAFEQGWIKPCPPEVRTGKKVAVVGSGPAGLAVAVQLNKAGHLVTVYERNDRIGGLLQYGIPTMKLGKDVVQRRVELMKEEGIKFSPSTDVGKDVSARD-LVNNNDAVVLTTGSTWPRDLPIPGRHLEGIHYAMSFLETWQKKQLG-NDIDSLPLSAKNKDVLIVGGGDTGVDCIATSLRQGARSIVTFEILPEPPPSRGESNPWPQWPRIMRVDYGHEEVKLKYGHDPRHFSILSKEFLDDGQGHVAGIRTVQVKWDKDN-SGRWVTNEVPGTLKTFKADLVLLAMGFLGPEKYLIDELSLEQDPRCNIRTPTGKYRTSVPRVYAAGDCRKGQSLVVHAINEGRQAAREVDEDLMGDSYLAGPGGLM 2036          
BLAST of Glutamate synthase vs. Ensembl Cavefish
Match: dpyda.3 (dihydropyrimidine dehydrogenase [Source:NCBI gene;Acc:103045749])

HSP 1 Score: 84.3445 bits (207), Expect = 1.237e-15
Identity = 115/505 (22.77%), Postives = 194/505 (38.42%), Query Frame = 2
Query: 4835 NDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTG-------------KRIVVVGSGPSGLAAAAQLNKAGHA-VLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLND-YDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDK----------------DVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPE---KEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDK---DIMNQTSLAGP 6238
            N++ +I       +G  R+A RC++C    CQ    CP    I  +   +   N+  A   +L  N      G  CP      CV G N  A     I    + +   E +     P+V+                +I ++G GP+ ++ A  L + G++ + + E+   +GGL    IP  ++  +VVQ  ++ M + G++      +G +      L  + Y A+ + +G        +P  N   I   LS        Q   ++ ++L ++AK                   VI+LG GDT  DC  ++LR GA+ V            R  +      P         EE++L   +       +S   +  + G V G+     E+ R  QTE     E          + ++ A G +  +   KE +  ++L       +   S   Q S P V+A GD     +  V ++N+G+QA+  I K    I  QT  A P
Sbjct:   89 NNFDDIKHTTLSERGALREAMRCLKCADAPCQK--SCPTNLDIKAFITSIANKNYYGAARAILSDNPLGLTCGMVCPT--SDLCVGGCNLYASEEGPINIGGLQQFATEVFSKMGIPQVRNPHLPPPEQMPESYHSKIALIGCGPASISCATFLARLGYSDITIFEKQKYVGGLSSSEIPQFRLPYEVVQFELDLMKDLGVKVVCEKGLGENGMTLLSLKEEGYKAVFIGIG--------LPQANRHRIFEGLSV------EQGFYTSKDFLPLVAKASKPGMCACGWTLPRLHGSVIVLGAGDTAFDCATSALRCGAQRVYVV--------FRRGFTNIRAVP---------EEMELAKEEKCEFLPFLSPREVLLKGGRVHGM-----EFCRTEQTETGDWVEDQEQITRLKADFIISAFGSVLSDPKVKEAMAPIRLNRWGLPELNPES--MQCSEPWVFAGGDVAGLANTTVESVNDGKQASWHIHKYLQAIHGQTVSAQP 551          
BLAST of Glutamate synthase vs. Ensembl Cavefish
Match: dpyda.3 (dihydropyrimidine dehydrogenase [Source:NCBI gene;Acc:103045749])

HSP 1 Score: 84.3445 bits (207), Expect = 1.330e-15
Identity = 111/502 (22.11%), Postives = 193/502 (38.45%), Query Frame = 2
Query: 4835 NDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTG-------------KRIVVVGSGPSGLAAAAQLNKAGHA-VLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLND-YDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDK----------------DVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPE---KEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTSLAGP 6238
            N++ +I       +G  R+A RC++C    CQ    CP    I  +   +   N+  A   +L  N      G  CP      CV G N  A     I    + +   E +     P+V+                +I ++G GP+ ++ A  L + G++ + + E+   +GGL    IP  ++  +VVQ  ++ M + G++      +G +      L  + Y A+ + +G        +P  N   I   LS        Q   ++ ++L ++AK                   VI+LG GDT  DC  ++LR GA+ V            R  +      P         EE++L   +       +S   +  + G V G+     E+ R  QTE     E          + ++ A G +  +   KE +  ++L       +   S   Q S P V+A GD     +  V ++N+G+QA+  I K + +  +   P
Sbjct:   89 NNFDDIKHTTLSERGALREAMRCLKCADAPCQK--SCPTNLDIKAFITSIANKNYYGAARAILSDNPLGLTCGMVCPT--SDLCVGGCNLYASEEGPINIGGLQQFATEVFSKMGIPQVRNPHLPPPEQMPESYHSKIALIGCGPASISCATFLARLGYSDITIFEKQKYVGGLSSSEIPQFRLPYEVVQFELDLMKDLGVKVVCEKGLGENGMTLLSLKEEGYKAVFIGIG--------LPQANRHRIFEGLSV------EQGFYTSKDFLPLVAKASKPGMCACGWTLPRLHGSVIVLGAGDTAFDCATSALRCGAQRVYVV--------FRRGFTNIRAVP---------EEMELAKEEKCEFLPFLSPREVLLKGGRVHGM-----EFCRTEQTETGDWVEDQEQITRLKADFIISAFGSVLSDPKVKEAMAPIRLNRWGLPELNPES--MQCSEPWVFAGGDVAGLANTTVESVNDGKQASWHIHKYLQDLVTNVSP 548          
BLAST of Glutamate synthase vs. Ensembl Cavefish
Match: dpyda.3 (dihydropyrimidine dehydrogenase [Source:NCBI gene;Acc:103045749])

HSP 1 Score: 83.9593 bits (206), Expect = 1.571e-15
Identity = 115/505 (22.77%), Postives = 194/505 (38.42%), Query Frame = 2
Query: 4835 NDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTG-------------KRIVVVGSGPSGLAAAAQLNKAGHA-VLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLND-YDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDK----------------DVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPE---KEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDK---DIMNQTSLAGP 6238
            N++ +I       +G  R+A RC++C    CQ    CP    I  +   +   N+  A   +L  N      G  CP      CV G N  A     I    + +   E +     P+V+                +I ++G GP+ ++ A  L + G++ + + E+   +GGL    IP  ++  +VVQ  ++ M + G++      +G +      L  + Y A+ + +G        +P  N   I   LS        Q   ++ ++L ++AK                   VI+LG GDT  DC  ++LR GA+ V            R  +      P         EE++L   +       +S   +  + G V G+     E+ R  QTE     E          + ++ A G +  +   KE +  ++L       +   S   Q S P V+A GD     +  V ++N+G+QA+  I K    I  QT  A P
Sbjct:   57 NNFDDIKHTTLSERGALREAMRCLKCADAPCQ--KSCPTNLDIKAFITSIANKNYYGAARAILSDNPLGLTCGMVCPT--SDLCVGGCNLYASEEGPINIGGLQQFATEVFSKMGIPQVRNPHLPPPEQMPESYHSKIALIGCGPASISCATFLARLGYSDITIFEKQKYVGGLSSSEIPQFRLPYEVVQFELDLMKDLGVKVVCEKGLGENGMTLLSLKEEGYKAVFIGIG--------LPQANRHRIFEGLSV------EQGFYTSKDFLPLVAKASKPGMCACGWTLPRLHGSVIVLGAGDTAFDCATSALRCGAQRVYVV--------FRRGFTNIRAVP---------EEMELAKEEKCEFLPFLSPREVLLKGGRVHGM-----EFCRTEQTETGDWVEDQEQITRLKADFIISAFGSVLSDPKVKEAMAPIRLNRWGLPELNPES--MQCSEPWVFAGGDVAGLANTTVESVNDGKQASWHIHKYLQAIHGQTVSAQP 519          
BLAST of Glutamate synthase vs. Ensembl Cavefish
Match: dpyda.3 (dihydropyrimidine dehydrogenase [Source:NCBI gene;Acc:103045749])

HSP 1 Score: 83.9593 bits (206), Expect = 1.637e-15
Identity = 115/505 (22.77%), Postives = 194/505 (38.42%), Query Frame = 2
Query: 4835 NDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTG-------------KRIVVVGSGPSGLAAAAQLNKAGHA-VLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLND-YDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDK----------------DVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPE---KEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDK---DIMNQTSLAGP 6238
            N++ +I       +G  R+A RC++C    CQ    CP    I  +   +   N+  A   +L  N      G  CP      CV G N  A     I    + +   E +     P+V+                +I ++G GP+ ++ A  L + G++ + + E+   +GGL    IP  ++  +VVQ  ++ M + G++      +G +      L  + Y A+ + +G        +P  N   I   LS        Q   ++ ++L ++AK                   VI+LG GDT  DC  ++LR GA+ V            R  +      P         EE++L   +       +S   +  + G V G+     E+ R  QTE     E          + ++ A G +  +   KE +  ++L       +   S   Q S P V+A GD     +  V ++N+G+QA+  I K    I  QT  A P
Sbjct:   89 NNFDDIKHTTLSERGALREAMRCLKCADAPCQK--SCPTNLDIKAFITSIANKNYYGAARAILSDNPLGLTCGMVCPT--SDLCVGGCNLYASEEGPINIGGLQQFATEVFSKMGIPQVRNPHLPPPEQMPESYHSKIALIGCGPASISCATFLARLGYSDITIFEKQKYVGGLSSSEIPQFRLPYEVVQFELDLMKDLGVKVVCEKGLGENGMTLLSLKEEGYKAVFIGIG--------LPQANRHRIFEGLSV------EQGFYTSKDFLPLVAKASKPGMCACGWTLPRLHGSVIVLGAGDTAFDCATSALRCGAQRVYVV--------FRRGFTNIRAVP---------EEMELAKEEKCEFLPFLSPREVLLKGGRVHGM-----EFCRTEQTETGDWVEDQEQITRLKADFIISAFGSVLSDPKVKEAMAPIRLNRWGLPELNPES--MQCSEPWVFAGGDVAGLANTTVESVNDGKQASWHIHKYLQAIHGQTVSAQP 551          
BLAST of Glutamate synthase vs. Ensembl Cavefish
Match: KDM1B (lysine demethylase 1B [Source:NCBI gene;Acc:103045768])

HSP 1 Score: 53.5286 bits (127), Expect = 2.953e-6
Identity = 26/46 (56.52%), Postives = 32/46 (69.57%), Query Frame = 2
Query: 5174 PSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGG 5311
            P  P+    K+++VVG+GPSGLAAA QL   G  V+VLE  DRIGG
Sbjct:  299 PLLPEPYRNKKVLVVGAGPSGLAAARQLQNFGMQVVVLESRDRIGG 344          
BLAST of Glutamate synthase vs. Ensembl Yeast
Match: GLT1 (NAD(+)-dependent glutamate synthase (GOGAT); synthesizes glutamate from glutamine and alpha-ketoglutarate; with Gln1p, forms the secondary pathway for glutamate biosynthesis from ammonia; expression regulated by nitrogen source; assembles into filaments as cells approach stationary phase and under cytosolic acidification and starvation conditions [Source:SGD;Acc:S000002330])

HSP 1 Score: 1925.21 bits (4986), Expect = 0.000e+0
Identity = 1030/2117 (48.65%), Postives = 1392/2117 (65.75%), Query Frame = 2
Query:  137 PANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYE-LYQSFAKENGTELPERGKFAVGMLFVDTENVE------KSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKL----LKRQVFILRKYGERVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDL----HQIIP------DDQSFQHEEDP-LLANYDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVL--LQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDE------MMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKR--IGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVY-TSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGL-GDHGCEYMTGGRVIVLGKT-GRNFAAGMSGGIAYVYDTK-NEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVL------------REMKNQPKLIDATQEKVEEKNSI----------------------ELEKNGLIDIEDLVTSNTNLDK-------LKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKT-PSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTS-LAGPGGLL 6250
            P   GLYDP+ E D+CGVGFV + +G+Q+HKI+ +ARY+L++M HRGAVSSD + GDGAG++ GIP+E + + F  +   ++PE GK+AVG +F             K  + F  +    +L  + W+   +D++ +G VA S EP I+Q  +    ++  P+      + Q+++LRK     +  EN+ FY+CSL+  T+VYKGQ T  Q++ +Y DL + ++K+HMA++H+RFSTNTFPSW+RA P R LAHNGEINTLRGN N MR+REGVM +  F  +LD+L+PIIE   SDS  LDN LE L      SLPE V+ M+PEA+H D  M    KA+Y WAA  +EPWDGPAL+TF+DGRY GAILDRNGLRP RYY++  D +  +SE+GV+ I    ++ KG+LK G L LVDT++ +++D + LK++I + +  + W++++ + L DL      ++P      D  S + + DP LLAN        GYT E +  L+ PM    KEALGSMGNDAPLACL+    LL++YF+QLFAQVTNPPIDP RE  VM+L C +GP+ N+LE  + QC RL L  PIL   +   L  ++  Y  W+   IDIT+  S+    + + ID + + A  A++ G +I++++DR +G  ++S+ SL+ +  +HH+LI  K R + ALI++TGEARE+HHFC LLGYG D + PY   E + R+  EG+L     D        + E++  A++ G+ KVM+KMGISTL SYKGAQIFEA+GL   ++D CF GT+SRI GVTFE LA ++ + H   Y  R  I  +  LP  G YH+R+GG  H+NEPTA++ LQ + +  N  ++  ++     + R C +RG LE  +  S  IPL++VEP  EI +RF +GAMS+GSIS EAH+TLAIAMNR+GAKSN GEGGE  ER    +    +RSAIKQVASARFGVTS YL+ ADE+QIK+AQGAKPGEGGELP HKVS +IA TR++   VGLISPPPHHDIYSIEDL QLIYDLK ANP A ISVKLVSEVG+G+VASGV K KA+HI +SGHDGGTGA+ WT +K+AGLPWELG+AETHQTL+LN+LR  VV+Q DGQ+RTG D+ +A LLGA+ F ++T PLI +GC M+R+CHLN+C VGIATQDP LR KF+G+PEHV+N+ + L +D+R+IMAKLGFR++ E++GHSEKLK   D +N KA  +D + +LT   +  P V  +    KQD  L +R+D  LI +A  V       + I+  I N DRA  STLSY +SK FG++ LP   ++ +N  G+ GQSF AFL  GI+  L GDANDYV KGLSGG +VI PPK+S   F S+ N+IVGN C YGA SG  F  G A ERF VRNSGA  VVE + G++  EYMTGGR IVL +    N  +G +GGIAY   +  ++F  + N D V+L  +  D V+  F+   + E  + T S +A +IL N++  +K FVKV P +Y+KVL            +      K   + QE  +E N++                       L++  ++D+ED V  +  L+K        +GF+ + R    +R+   R+NDW E + +   +K  + Q ARCM+CG PFC S  GCPL NIIPK+N+L++K+ WK AL +LL+TNNFPEFTGR CPAPCE AC LGI E  V IK++E  IID  F EGW+ P  P  +TG  + V+GSGP+GLA A  LN+AGH V V ER+DR GGLL YGIP+MK+ K +VQRRI+ +  EGI+F T   IG      D+L N ++A+V  +G++ PRD+ I GR L  I FA+  LE   +   ++ + E ++   + K VI++GGGDTG DC+ TS+R GA SV  FE+LP P   RA  NPWP+WPR+ RVDYGH EVK  +G+DPR + I+SKEF+ ++ G V  IRTV+VEW + SQ+  W M E+PNSE++F  +++LL+MGF+GPE    N  +++   R  I T     Y     K +A GDCRRGQSL+V AI EGR+ A  +DK +M+ T+ L   GG++
Sbjct:   39 PDKRGLYDPDYEHDACGVGFVANKHGEQSHKIVTDARYLLVNMTHRGAVSSDGN-GDGAGILLGIPHEFMKREFKLDLDLDIPEMGKYAVGNVFFKKNEKNNKKNLIKCQKIFEDLAASFNLSVLGWRNVPVDSTILGDVALSREPTILQPLLVPLYDEKQPEFNETKFRTQLYLLRKEASLQIGLENW-FYVCSLNNTTIVYKGQLTPAQVYNYYPDLTNAHFKSHMALVHSRFSTNTFPSWDRAQPLRWLAHNGEINTLRGNKNWMRSREGVMNSATFKDELDKLYPIIEEGGSDSAALDNVLELLTINGTLSLPEAVMMMVPEAYHKD--MDSDLKAWYDWAACLMEPWDGPALLTFTDGRYCGAILDRNGLRPCRYYITSDDRVICASEVGVIPIENSLVVQKGKLKPGDLFLVDTQLGEMVDTKKLKSQISKRQDFKSWLSKV-IKLDDLLSKTANLVPKEFISQDSLSLKVQSDPRLLAN--------GYTFEQVTFLLTPMALTGKEALGSMGNDAPLACLNENPVLLYDYFRQLFAQVTNPPIDPIREANVMSLECYVGPQGNLLEMHSSQCDRLLLKSPILHWNEFQALKNIEAAYPSWSVAEIDITFDKSEGLLGYTDTIDKITKLASEAIDDGKKILIITDRKMGANRVSISSLIAISCIHHHLIRNKQRSQVALILETGEAREIHHFCVLLGYGCDGVYPYLAMETLVRMNREGLLRNVNNDNDTLEEGQILENYKHAIDAGILKVMSKMGISTLASYKGAQIFEALGLDNSIVDLCFTGTSSRIRGVTFEYLAQDAFSLHERGYPSRQTISKSVNLPESGEYHFRDGGYKHVNEPTAIASLQDTVRNKNDVSWQLYVKKEMEAIRDCTLRGLLELDFENSVSIPLEQVEPWTEIARRFASGAMSYGSISMEAHSTLAIAMNRLGAKSNCGEGGEDAERSAVQENGDTMRSAIKQVASARFGVTSYYLSDADEIQIKIAQGAKPGEGGELPAHKVSKDIAKTRHSTPNVGLISPPPHHDIYSIEDLKQLIYDLKCANPRAGISVKLVSEVGVGIVASGVAKAKADHILVSGHDGGTGAARWTSVKYAGLPWELGLAETHQTLVLNDLRRNVVVQTDGQLRTGFDIAVAVLLGAESFTLATVPLIAMGCVMLRRCHLNSCAVGIATQDPYLRSKFKGQPEHVINFFYYLIQDLRQIMAKLGFRTIDEMVGHSEKLKKRDD-VNAKAINIDLSPILTPAHVIRPGVPTKF-TKKQDHKLHTRLDNKLIDEAE-VTLDRGLPVNIDASIINTDRALGSTLSYRVSKKFGEDGLPK-DTVVVNIEGSAGQSFGAFLASGITFILNGDANDYVGKGLSGGIIVIKPPKDSK--FKSDENVIVGNTCFYGATSGTAFISGSAGERFGVRNSGATIVVERIKGNNAFEYMTGGRAIVLSQMESLNAFSGATGGIAYCLTSDYDDFVGKINKDTVELESLC-DPVEIAFVKNLIQEHWNYTQSDLAARILGNFNHYLKDFVKVIPTDYKKVLLKEKAEAAKAKAKATSEYLKKFRSNQEVDDEVNTLLIANQKAKEQEKKKSITISNKATLKEPKVVDLEDAVPDSKQLEKNSERIEKTRGFMIHKRRHETHRDPRTRVNDWKE-FTNPITKKDAKYQTARCMDCGTPFCLSDTGCPLSNIIPKFNELLFKNQWKLALDKLLETNNFPEFTGRVCPAPCEGACTLGIIEDPVGIKSVERIIIDNAFKEGWIKPCPPSTRTGFTVGVIGSGPAGLACADMLNRAGHTVTVYERSDRCGGLLMYGIPNMKLDKAIVQRRIDLLSAEGIDFVTNTEIGK-TISMDELKNKHNAVVYAIGSTIPRDLPIKGRELKNIDFAMQLLESNTKALLNK-DLEIIREKIQGKKVIVVGGGDTGNDCLGTSVRHGAASVLNFELLPEPPVERAKDNPWPQWPRVMRVDYGHAEVKEHYGRDPREYCILSKEFIGNDEGEVTAIRTVRVEWKK-SQSGVWQMVEIPNSEEIFEADIILLSMGFVGPELINGNDNEVKKTRRGTIATLDDSSYSIDGGKTFACGDCRRGQSLIVWAIQEGRKCAASVDKFLMDGTTYLPSNGGIV 2131          
BLAST of Glutamate synthase vs. Ensembl Nematostella
Match: EDO38711 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC78])

HSP 1 Score: 2032.3 bits (5264), Expect = 0.000e+0
Identity = 1014/1804 (56.21%), Postives = 1304/1804 (72.28%), Query Frame = 2
Query:  905 MRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQ----IIPDDQSFQHEEDPLLANYDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDK-TLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQPKLIDATQEKVEEKNSIELEKNG--LIDIEDLVTS--------NTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTSLAGPGGLLDVLKAIP 6271
            M+AREG M +  FG +   LFP++E   +DSG  DN LE L  A  RSLPE V+ M+PEAW ND  M   KK FY W++ S+EPWDGPAL TFSDGRYVGAILDRNGLRPSRYY+++   M M+SE+GV     E I+SKGRL+ GR+LLVDT+   +I+DE LK +I    PV +W+ +   TL+DLH+     +P  QSF+  +       D+RL LFGY+ E + MLI+PMI+DKKEALGSMGNDA LAC+S +  LLF+YFKQLFAQVTNPPIDP RE IVM+LACPIGPE+N+L+P+ E C RL+L+ P+LS  DL+V+       W +K +++ YP+ +   + + A+D +C +A  AV  G   V+LSDR  G   + + SL+ +G +HH+LI  K R K  +I+++ E RE+HH C LLG+G DA+CPY +FE +  LR++ +L K  TD+ +  +++ A   G+ KVMAKMGISTLHSYKGAQIFEAVGL+QEV+DKCFVGTASR+GGV+F+ LA E+L RH   Y  R  DN+++ N G YHWR+GGE H+N+P ++SYLQ + KQNNK  + K++ S+    + C +RGQL+F +   P+ L EVEPA EIVKRF TGAMSFGS+S E H TLA AMN++G KSNTGEGGE   R + +D   N RSAI+Q+AS RFGV + YLA+A ELQIKMAQGAKPGEGGELPG KV+ EIA TR ++ GVGLISPPPHHDIYSIEDLA+LIY+LK +NPEARISVKLVSEVG+GV+ASGV KG AEHI ISGHDGGTGAS+W+GIKHAGLPWELG++ETHQTL+LN+LR RVVLQ DGQ+RTGRDV++AALLGADEFG STAPLI +GCTMMRKCHLNTCPVGIATQDP+LRKKFEGKPEHV+N+ F+LAE+VR ++AKLG R +S++IG  + L   +   N K  LLDF+ LLT  +   P      G   QD  L  R D +LI  A  V+ G    + + V I N DRA  +TLSY ++K +G++ LP   SI +   G+ GQSF AF+ +GI++ LEGDANDYV KGLSGG +++ P +     F +E N+IVGN CLYGA SG+ + RG +AERF VRNSG  AV EG+GDHGCEYMTGG V+VLG+ GRNFAAGMSGG+A++ D +  F   CN   VDL  +  + V+   + ++L++ H K T S +A  +L NW++++  F KV  K  +       +  K I    EK E   S +  KN   ++DIE+ +          +  LDK +GF+KY R  N YR  ++R+ DW EIY HK   + L+ QAARCM+CGVPFCQSH GCPLGNIIPKWNDLV++D W+ AL +LLQTN+FPEFTGR CPAPCE ACVL IN  AVTIK IEC IID  F++GW+ P  P  +TGK++ ++GSGP+GL+AA QLNKAGH V V E+NDR GGLL YGIPSMK+ K +VQRR+N M +EGI F T   +G D   A++L+ D DA+++ VG++WPRD+ IPGR+L G+HFA++FLE  Q+ Q  + +   L   A  K VI++GGGDTGVDCIATS+RQ A+S+ TFE+L    +SR+  NPWP WPR++RV+YGHEEV +++G+DPR +NIMSKEFLS++ GHV  I+ V+++W +D  + +W ++EVPNSE  F  ++VL+A+GF+GPEK +  Q   +VD R N  T  G+YQTS+ K+Y AGDC  GQSLVV A+ EGRQAAREID  +M  TSLAGPGG +   +  P
Sbjct:    1 MQAREGDMYSEYFGQQTARLFPVVEDGQTDSGRADNILELLVMAGERSLPEAVMMMVPEAWQNDHLMSTEKKNFYRWSSCSLEPWDGPALFTFSDGRYVGAILDRNGLRPSRYYITEDGHMIMASEVGVHNFRDEEIVSKGRLRPGRILLVDTKKGIVINDEELKRQISCQYPVGEWLGKGLYTLEDLHKGDHMTLPSIQSFERVQ---CLEQDRRLPLFGYSVEDLTMLIVPMIRDKKEALGSMGNDAALACISTHPQLLFDYFKQLFAQVTNPPIDPIREAIVMSLACPIGPESNLLKPNPESCKRLYLDHPVLSCGDLEVIRNCALPQWKSKTLEMVYPVDEGVMSLVPALDRLCDEASKAVKEGCAFVILSDRSAGISHVPISSLLALGCIHHFLIRTKQRRKIGIIVESAEIREIHHICLLLGFGVDAVCPYLLFETMVNLREQNLLSKPLTDKEIVANYIEAARKGISKVMAKMGISTLHSYKGAQIFEAVGLSQEVVDKCFVGTASRLGGVSFDILAQEALDRHSIAYADRECDNWLINNKGLYHWRDGGEKHVNDPRSISYLQDAVKQNNKTAYEKYVHSTVEMVKACTLRGQLDFKFAHAPLDLSEVEPAAEIVKRFVTGAMSFGSVSIETHKTLAKAMNKLGGKSNTGEGGEDANRGMGDD---NSRSAIRQIASGRFGVDATYLANAVELQIKMAQGAKPGEGGELPGFKVTTEIAKTRKSVPGVGLISPPPHHDIYSIEDLAELIYNLKCSNPEARISVKLVSEVGVGVIASGVTKGHAEHIVISGHDGGTGASTWSGIKHAGLPWELGLSETHQTLVLNDLRRRVVLQVDGQMRTGRDVMVAALLGADEFGFSTAPLIAMGCTMMRKCHLNTCPVGIATQDPVLRKKFEGKPEHVINFFFMLAEEVRSLLAKLGCRRMSDVIGRCD-LLGPSQAQNRKTQLLDFSGLLTTSNELRPGDH-SAGTEAQDHKLEERKDNELIAAAQGVLNGTVPRVYLEVDIINSDRALGTTLSYHVAKRYGEDGLPD-DSIHVKVNGSAGQSFGAFVAKGITLELEGDANDYVGKGLSGGILIVYPSRKHGSQFKAEENVIVGNTCLYGATSGKAYIRGVSAERFAVRNSGVTAVCEGVGDHGCEYMTGGVVVVLGECGRNFAAGMSGGMAFILDRERTFKSFCNHGSVDLEYVTGNDVE---LLRSLLQDHLKSTGSAVAATLLGNWNDSVNLFTKVLKKRGKTCFNLPISLKKKI-GDSEKKERSPSRKNNKNDSPIVDIEEAIPDAEMEQKIIDRVLDKTRGFVKYERSTNHYRPAQQRVKDWKEIYNHKRSDRNLKVQAARCMDCGVPFCQSHAGCPLGNIIPKWNDLVFQDKWQGALERLLQTNSFPEFTGRVCPAPCEGACVLAINAKAVTIKKIECTIIDHAFEQGWIKPQIPMTRTGKKVAIIGSGPAGLSAAVQLNKAGHKVTVYEKNDRCGGLLMYGIPSMKLDKKIVQRRLNLMEQEGITFVTKSEVGRD-VTANQLMADNDAVLMAVGSTWPRDLPIPGRSLEGVHFAMNFLETSQKRQMGDYSLPSLD--ATGKHVIVIGGGDTGVDCIATSVRQDAKSIVTFELLAESPESRSPNNPWPTWPRVFRVEYGHEEVAIKYGRDPRIYNIMSKEFLSNDKGHVRAIKAVEIKWVKDP-SGRWVIEEVPNSEHEFPADLVLIALGFVGPEKSLAKQFGAKVDPRGNFATKRGEYQTSVEKLYTAGDCHYGQSLVVTAMAEGRQAAREIDLALMGTTSLAGPGGQIHTTRPPP 1787          
BLAST of Glutamate synthase vs. Ensembl Nematostella
Match: EDO25814 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVE5])

HSP 1 Score: 523.857 bits (1348), Expect = 2.854e-166
Identity = 292/606 (48.18%), Postives = 392/606 (64.69%), Query Frame = 2
Query: 1592 MIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILE-PSAEQCHRLWLNQPILSLRDLDVLLQVDYR---GWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSN-LSSRYCNIRGQLEFVYT-SEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERF---LSNDPQK------------------------NLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGAS 3310
            M K+ +E +GSMGND+PLA LS  N  L+ YF+Q+FAQVTNPPIDP RE IVM+L   IGP+ N+L+        RL ++QP+L   D+  L  ++      + +  IDITYPLS         +  +C QA +A+  G  I+++SDR+V   ++++P+L+ + A+H +L+ + LR    L+++TG AREVHHF  L GYGA+A+ PY   E +  +  E  L    + +    ++V A+  GL K+M+KMG+ST  SY GAQ+FE +GL  + +DK F GTASR+ G+   E+A E++  H   +        +L   G Y WR  GE H+  P A++ LQ ST+ NN +T+ ++    N  S R+  +RG  EF +  ++ I LD+VE AK+IVKRF TGAMS GSIS EAH TLA+AMNRIG KSNTGEGGE P+R+   L   P K                        +LRS IKQVAS RFGVT+ YL+ +D++QIKMAQGAKPGEGG+LPG KVS  I   R+++ GVGLISPPPHHDIYSIEDLAQLI+DLK   P A ISVKLVSEVG+G +A+GV K K++H+ I+GHDGGTGAS
Sbjct:    1 MAKNGEEGIGSMGNDSPLAVLSDKNKPLYNYFRQMFAQVTNPPIDPIREAIVMSLVSFIGPKPNLLDINQVNPPMRLEVHQPVLDFADMAKLRDIERHTQGKFKSATIDITYPLSWGKQGVEAKLASLCAQAVDAIKGGANILIISDRHVSATQVAIPALLALSAIHQHLVREGLRTTAGLVVETGTAREVHHFAVLAGYGAEAVHPYLAMETLADMHKE--LGGDLSADKAIYNYVKAIGKGLSKIMSKMGVSTYMSYCGAQLFEVIGLNSDTVDKYFTGTASRVEGIGVFEIAEETIRNHRAAFGDDPVLETMLDAGGEYAWRARGEEHMWSPDAIAKLQHSTRSNNWSTYKEYAQLINDQSKRHMTLRGLFEFKFDPAKAIALDQVESAKDIVKRFATGAMSLGSISTEAHATLAVAMNRIGGKSNTGEGGEDPQRYRNELKGIPIKKGETLGSIIGADKVEADIELQDGDSLRSRIKQVASGRFGVTAEYLSSSDQVQIKMAQGAKPGEGGQLPGGKVSDYIGKLRHSVPGVGLISPPPHHDIYSIEDLAQLIHDLKNVAPHADISVKLVSEVGVGTIAAGVAKCKSDHVVIAGHDGGTGAS 604          
BLAST of Glutamate synthase vs. Ensembl Nematostella
Match: EDO27904 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7Z2])

HSP 1 Score: 505.368 bits (1300), Expect = 6.238e-162
Identity = 237/386 (61.40%), Postives = 298/386 (77.20%), Query Frame = 2
Query: 2054 SLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKL 3211
            SL+ +G +HH+LI  K R K  +I+++ E RE+HH C LLG+G DA+CPY +FE +  LR++ +L K  TD+ +  +++ A   G+ KVMAKMGISTLHSYKGAQIFEAVGL+QEV+DKCFVGTASR+GGV+F+ LA E+L RH   Y  R  DN+++ N G YHWR+GGE H+N+P ++SYLQ + KQNNK  + K++ S+    + C +RGQL+F +   P+ L EVEPA EIVKRF TGAMSFGS+S E H TLA AMN++G KSNTGEGGE   R + +D   N RSAI+Q+AS RFGV + YLA+A ELQIKMAQGAKPGEGGELPG KV+ EIA TR ++ GVGLISPPPHHDIYSIEDLA+LIY+LK +NPEARISVKL
Sbjct:    1 SLLALGCIHHFLIRTKQRRKIGIIVESAEIREIHHICLLLGFGVDAVCPYLLFETMVNLREQNLLSKPLTDKEIVANYIEAARKGISKVMAKMGISTLHSYKGAQIFEAVGLSQEVVDKCFVGTASRLGGVSFDILAQEALDRHSIAYADRECDNWLINNKGLYHWRDGGEKHVNDPRSISYLQDAVKQNNKTAYEKYVHSTVEMVKACTLRGQLDFKFAHAPLDLSEVEPAVEIVKRFVTGAMSFGSVSIETHKTLAKAMNKLGGKSNTGEGGEDANRGMGDD---NSRSAIRQIASGRFGVDATYLANAVELQIKMAQGAKPGEGGELPGFKVTTEIAKTRKSVPGVGLISPPPHHDIYSIEDLAELIYNLKCSNPEARISVKL 383          
BLAST of Glutamate synthase vs. Ensembl Nematostella
Match: EDO26058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD00])

HSP 1 Score: 273.092 bits (697), Expect = 2.581e-82
Identity = 143/314 (45.54%), Postives = 201/314 (64.01%), Query Frame = 2
Query: 5267 GHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVL-AKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDK 6205
            GH V V ER+ ++GGLL+YGIP  K+ K ++ RR+  +IEEGI F+T  ++G +    + +  DYDA+++C GA+  R I I G +L G++ A+ FL+    +Q  +   ++  V+ AKDK VI++GGGDTG DCI TS R GA SV  FEIL  P   R +  PWP WP   +    H+E         R F+I +KEFL D+ G++ G++TV VEW    + E+  + EVPN+E  + C+MVLLA+GF G EK +  QL +E+D RTNIK     Y T++  ++AAGD RRGQSL+V AI+EGRQAA  +DK
Sbjct:    1 GHTVTVFERDSKVGGLLRYGIPDFKLEKQIIDRRVEVLIEEGIIFKTNAYVGKN-ISVETIKADYDAVLMCGGATERRGIPIKGNHLKGVYQAMEFLK--LNNQYVDGLIKFDDVISAKDKKVIVIGGGDTGSDCIGTSNRHGAVSVANFEILTKPTVGRPANQPWPYWPMKLKTTSSHKE------GVERFFSISTKEFLGDKKGNLIGLKTVAVEWIF-KEGERPQLIEVPNTEKSWECDMVLLALGFTGAEKTLAEQLGVEMDFRTNIKATEKDYATNVKGIFAAGDMRRGQSLIVWAISEGRQAAYYVDK 304          
BLAST of Glutamate synthase vs. Ensembl Nematostella
Match: EDO28542 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T666])

HSP 1 Score: 209.534 bits (532), Expect = 6.458e-62
Identity = 100/190 (52.63%), Postives = 134/190 (70.53%), Query Frame = 2
Query: 4046 GQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDK-TLSVIAEKILSNWSENIKYFVKVF 4612
            GQSF AF+ +GI++ LEGDANDYV KGLSGG +++ P +     F +E N+IVGN CLYGA SG+ + RG +AERF VRNSG  AV EG+GDHGCEYMTGG V+VLG+ GRNFAAGMSGG+A++ D +  F   CN   VDL  +  + V+   + ++L++ H K T S +A  +L NW++++  F KV 
Sbjct:    1 GQSFGAFVAKGITLELEGDANDYVGKGLSGGILIVYPSRKHGSQFKAEENVIVGNTCLYGATSGKAYIRGVSAERFAVRNSGVTAVCEGVGDHGCEYMTGGVVVVLGECGRNFAAGMSGGMAFILDRERTFKSFCNHGSVDLEYVTGNDVE---LLRSLLQDHLKSTGSAVAATLLGNWNDSVNLFTKVL 187          
BLAST of Glutamate synthase vs. Ensembl Medaka
Match: dpydb (dihydropyrimidine dehydrogenase [Source:NCBI gene;Acc:101175598])

HSP 1 Score: 86.6557 bits (213), Expect = 2.565e-16
Identity = 114/509 (22.40%), Postives = 203/509 (39.88%), Query Frame = 2
Query: 4802 KNPYRNVEERI---NDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKR-------------IVVVGSGPSGLAAAAQLNKAGH-AVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLND-YDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKD----------------VIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFL--GPE-KEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMN 6217
            +NP +N +  +   N++ +I       +G  R+A RC++C    CQ    CP    I  +   +   N+  A   +L  N      G  CP      CV G N  A     I    + +   E +     P++++ +              + ++G GP+ ++ A+ L + G+  + + E+   IGGL    IP  ++  +VVQ  I  M + G++      +G +      L  + + A+ + +G        +P  N + I   L+        Q   ++ ++L ++A                    VI+LG GDT  DC  ++LR GAR V            R  +      P         EE++L   +       +S   +  +NG VAG+     ++ R  QTE+    E          + ++ A G +   P+  E +  +KL       + T +   QTS P V+A GD     +  V ++N+G+QA+  I + I +
Sbjct:   40 RNPEKNCDFCVKLENNFDDIKHTTLSERGALREAYRCLKCADAPCQ--KSCPTNLDIKAFITSIANKNYYGAARVILSDNPLGLTCGMVCPT--SELCVGGCNLYASEEGPINIGGLQQFATEVFSQMGIPQIRSPELPPPNEMPESYHSPVAMIGCGPASISCASFLARLGYDNITIFEKQQYIGGLSTSEIPQFRLPYEVVQFEIELMKDLGVKVVCEKGLGVNGMTLTSLKKEGFKAVFIGIG--------LPQANRAKIFQGLT------GDQGFFTSKDFLPLVASASKKGMCQCRSALPELRGAVIVLGAGDTAFDCATSALRCGARRVYVC--------FRKGFTNIRAVP---------EEMELAKEEKCEFLPFLSPREVIMKNGRVAGL-----QFCRTEQTEEGDWVEDEEQVVKLKADYIISAFGSILNDPKVTEAMAPVKLSHWGTPEVNTET--MQTSEPWVFAGGDVAGLANTTVESVNDGKQASWHIHRYIQS 506          
BLAST of Glutamate synthase vs. Ensembl Medaka
Match: dpydb (dihydropyrimidine dehydrogenase [Source:NCBI gene;Acc:101175598])

HSP 1 Score: 86.2705 bits (212), Expect = 3.028e-16
Identity = 114/509 (22.40%), Postives = 203/509 (39.88%), Query Frame = 2
Query: 4802 KNPYRNVEERI---NDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKR-------------IVVVGSGPSGLAAAAQLNKAGH-AVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLND-YDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKD----------------VIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFL--GPE-KEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMN 6217
            +NP +N +  +   N++ +I       +G  R+A RC++C    CQ    CP    I  +   +   N+  A   +L  N      G  CP      CV G N  A     I    + +   E +     P++++ +              + ++G GP+ ++ A+ L + G+  + + E+   IGGL    IP  ++  +VVQ  I  M + G++      +G +      L  + + A+ + +G        +P  N + I   L+        Q   ++ ++L ++A                    VI+LG GDT  DC  ++LR GAR V            R  +      P         EE++L   +       +S   +  +NG VAG+     ++ R  QTE+    E          + ++ A G +   P+  E +  +KL       + T +   QTS P V+A GD     +  V ++N+G+QA+  I + I +
Sbjct:   43 RNPEKNCDFCVKLENNFDDIKHTTLSERGALREAYRCLKCADAPCQ--KSCPTNLDIKAFITSIANKNYYGAARVILSDNPLGLTCGMVCPT--SELCVGGCNLYASEEGPINIGGLQQFATEVFSQMGIPQIRSPELPPPNEMPESYHSPVAMIGCGPASISCASFLARLGYDNITIFEKQQYIGGLSTSEIPQFRLPYEVVQFEIELMKDLGVKVVCEKGLGVNGMTLTSLKKEGFKAVFIGIG--------LPQANRAKIFQGLT------GDQGFFTSKDFLPLVASASKKGMCQCRSALPELRGAVIVLGAGDTAFDCATSALRCGARRVYVC--------FRKGFTNIRAVP---------EEMELAKEEKCEFLPFLSPREVIMKNGRVAGL-----QFCRTEQTEEGDWVEDEEQVVKLKADYIISAFGSILNDPKVTEAMAPVKLSHWGTPEVNTET--MQTSEPWVFAGGDVAGLANTTVESVNDGKQASWHIHRYIQS 509          
BLAST of Glutamate synthase vs. Ensembl Medaka
Match: fdxr (ferredoxin reductase [Source:NCBI gene;Acc:101160395])

HSP 1 Score: 61.2326 bits (147), Expect = 9.918e-9
Identity = 45/136 (33.09%), Postives = 66/136 (48.53%), Query Frame = 2
Query: 5159 EGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLV--LERNDRIGGLLQYGI-PSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFL 5557
            EG +V     + T  ++ VVG GP+G   A  L KA   V V   ER     GL+++G+ P     K+V+             F   V++G D   A+ LL  Y A+VL  GA   R + +PG +LSG++ A  F+
Sbjct:   27 EGIVVRGKALLSTCPKVCVVGGGPAGFYTAQHLIKARQDVQVDVYERLPVPFGLVRFGVAPDHPEVKNVINTFTQTAKHSRCSFYGNVNVGKDVSVAE-LLRSYHAVVLSYGAEGNRSVGVPGEHLSGVYSAKDFV 161          
BLAST of Glutamate synthase vs. Planmine SMEST
Match: SMESG000077776.1 (SMESG000077776.1)

HSP 1 Score: 4212.14 bits (10923), Expect = 0.000e+0
Identity = 2056/2059 (99.85%), Postives = 2057/2059 (99.90%), Query Frame = 2
Query:  113 MNLPFSNYPANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELPERGKFAVGMLFVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDDQSFQHEEDPLLANYDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLXXXXXXXXXXXXXXXXXXXHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTXXXXXXXXXXXXQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQPKLIDATQEKVEEKNSIELEKNGLIDIEDLVTSNTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTSLAGPGGLLDVLKAIPVVSAVA 6289
            MNLPFSNYPANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELPERGKFAVGMLFVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDDQSFQHEEDPLLANYDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVY SEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLVSEVGIGVVASGVVKGKAEHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTLLLNNLRSRVVLQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQ GLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQPKLIDATQEKVEEK+SIELEKNGLIDIEDLVTSNTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTSLAGPGGLLDVLKAIPVVSAVA
Sbjct:    1 MNLPFSNYPANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELPERGKFAVGMLFVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAIIQIFIKTNVEDIHPKLLKRQVFILRKYGERVMREENYRFYICSLSLQTVVYKGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLAHNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDNALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWDGPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPENIISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLKDLHQIIPDDQSFQHEEDPLLANYDQRLSLFGYTNEHIYMLILPMIKDKKEALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLACPIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDITYPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLVVVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVFEIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKGAQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIGDNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSNLSSRYCNIRGQLEFVYASEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEAHTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGVTSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLISPPPHHDIYSIEDLAQLIYDLKAANPEARISVKLVSEVGIGVVASGVVKGKAEHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTLLLNNLRSRVVLQADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGIATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEKLKATTDYINHKASLLDFTKLLTNLSITHPNVVIQGGLVKQDFNLGSRVDYDLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSHKSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPKNSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEGLGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDMVDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVFPKEYRKVLREMKNQPKLIDATQEKVEEKHSIELEKNGLIDIEDLVTSNTNLDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIVVVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTSLAGPGGLLDVLKAIPVVSAVA 2059          
BLAST of Glutamate synthase vs. Planmine SMEST
Match: SMESG000019456.1 (SMESG000019456.1)

HSP 1 Score: 114.005 bits (284), Expect = 5.191e-29
Identity = 58/90 (64.44%), Postives = 65/90 (72.22%), Query Frame = 2
Query:  113 MNLPFSNYPANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELP 382
            MN   SNY  NTGLYD N+EK+ CGV     IN KQ HKIIEEARYMLI++E RGAVSSDNDT D A VMTGIPYELY   ++  G +L 
Sbjct:    1 MNFLVSNYTDNTGLYDSNLEKNFCGV-----INEKQAHKIIEEARYMLINIECRGAVSSDNDTEDEACVMTGIPYELYIILSQIRGWQLS 85          
BLAST of Glutamate synthase vs. Planmine SMEST
Match: SMESG000001463.1 (SMESG000001463.1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.627e-24
Identity = 49/69 (71.01%), Postives = 53/69 (76.81%), Query Frame = 2
Query:  113 MNLPFSNYPANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLISMEHRGAVSSDNDTGDGAGV 319
            MNLPF NY  NT LY+ N+E  SC VGFVVDINGKQT K IEEARYM I+ME   A+SSDNDTGD  GV
Sbjct:    1 MNLPFYNYQVNTELYNSNLESYSCRVGFVVDINGKQTDKAIEEARYMPINMECNVAISSDNDTGDEGGV 69          
BLAST of Glutamate synthase vs. Planmine SMEST
Match: SMESG000034030.1 (SMESG000034030.1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.506e-18
Identity = 115/516 (22.29%), Postives = 208/516 (40.31%), Query Frame = 2
Query: 4724 LIDIEDLVTSNTNLDKLKGFI----------KYPRHKNPYRNVEERIN-DWGEIYAHKTVRKGLRRQAARCMECGVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCCPAP--CEAACVL-GINEPAVTIKNIECAIIDKGFDEGWMVPSA--PKVK----TGKR---IVVVGSGPSGLAAAAQLNKAGHA-VLVLERNDRIGGLLQYGIPSMKMSKDVVQRRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINIPG--RNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGVDCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVKLRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVPNSEDVFNCNMVLLAMGFLGPEKEIINQLK-LEVDSRTNIKTPSGKYQTSIPKVYAAGDCRRGQSLVVHAINEGRQAA 6190
            L DIE+L++ N    K    +          K+ R+++   +  E +  ++ ++       +G  ++A RC++C    CQ    CP    I  +   +   N+  A   +   N      G  CP    C  +C L G  E  + I  ++    D        +P    P ++    T  R   IV++G GP+ ++ A  L + G++ + + E+ D  GGL    IP  ++   VV   +  M++ G+       +  +    D LL  Y AI L  G    ++I+I        G + +  FL    R  +        ++     +VI+LG GDT  DC   +LR GA+ V          K   + +P P            EE++L   +       MS  +  + N     I ++    T ++  E+  ++  P+       + V+ A G    ++E+I  LK ++++     +      +T++  V+  GD        V A+N+G+QAA
Sbjct:    6 LPDIENLLSLNPKTSKYARLVPSFYTKSEKLKWKRNRDKNCSTCESLEGNFNDVKPTTLSERGALKEANRCLKCADAPCQ--KSCPTQLDIKSFITSIANKNYYGAAKVIFSDNPLGLTCGMVCPTSDLCVGSCNLYGTEEGPINIGGLQQFATD--IFRQMKIPQIRDPNLQNHFLTSYRESSIVLIGCGPASISCATFLARLGYSKIEIFEKYDFSGGLSTSEIPEFRLPYKVVDFELQLMLDLGVTLHLNKPLSKNMTVKD-LLKSYSAIFLGFGLPDAKNIDIFNDLTQEQGFYTSKKFLPIVSRSSKPGMCACSYKLPQLHGNVIVLGAGDTAFDCATCALRCGAKRVYIIF-----RKGFTTISPVP------------EEMELAKEEKCEFIPFMS-PYKVELNKTTNKIHSMAFHKTFEN--EKGEIEIDPDQILTLKADFVISAFGSCLTDQELIESLKPVKINKYGLPECDKMTLKTNLENVFCGGDLAGVAQTTVEAVNDGKQAA 496          
The following BLAST results are available for this feature:
BLAST of Glutamate synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DPYD1.241e-1924.56dihydropyrimidine dehydrogenase [Source:HGNC Symbo... [more]
back to top
BLAST of Glutamate synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
W07E11.10.000e+057.02pep chromosome:WBcel235:X:10084627:10104252:1 gene... [more]
W07E11.10.000e+056.85pep chromosome:WBcel235:X:10084627:10104063:1 gene... [more]
dpyd-13.587e-1423.84Dihydropyrimidine dehydrogenase [NADP(+)] [Source... [more]
Y62E10A.66.146e-930.00NADPH:adrenodoxin oxidoreductase, mitochondrial [... [more]
back to top
BLAST of Glutamate synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG96740.000e+058.26gene:FBgn0036663 transcript:FBtr0333608[more]
CG96740.000e+058.26gene:FBgn0036663 transcript:FBtr0305916[more]
CG96740.000e+058.26gene:FBgn0036663 transcript:FBtr0075344[more]
CG96740.000e+058.26gene:FBgn0036663 transcript:FBtr0075341[more]
CG96740.000e+058.12gene:FBgn0036663 transcript:FBtr0333609[more]
back to top
BLAST of Glutamate synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dpydb7.835e-1922.98dihydropyrimidine dehydrogenase b [Source:NCBI gen... [more]
dpydb7.160e-1823.03dihydropyrimidine dehydrogenase b [Source:NCBI gen... [more]
dpydb1.442e-1522.99dihydropyrimidine dehydrogenase b [Source:NCBI gen... [more]
fdxr7.055e-831.85ferredoxin reductase [Source:ZFIN;Acc:ZDB-GENE-130... [more]
fdxr7.055e-831.85ferredoxin reductase [Source:ZFIN;Acc:ZDB-GENE-130... [more]
back to top
BLAST of Glutamate synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab251.809e-1922.43RAB25, member RAS oncogene family [Source:Xenbase;... [more]
rab253.576e-1922.52RAB25, member RAS oncogene family [Source:Xenbase;... [more]
rab253.661e-1922.52RAB25, member RAS oncogene family [Source:Xenbase;... [more]
rab254.128e-1922.52RAB25, member RAS oncogene family [Source:Xenbase;... [more]
rab254.468e-1922.52RAB25, member RAS oncogene family [Source:Xenbase;... [more]
back to top
BLAST of Glutamate synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Dpyd3.224e-1922.95dihydropyrimidine dehydrogenase [Source:MGI Symbol... [more]
back to top
BLAST of Glutamate synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9C102|GLT1_SCHPO0.000e+052.97Putative glutamate synthase [NADPH] OS=Schizosacch... [more]
sp|Q03460|GLSN_MEDSA0.000e+051.31Glutamate synthase [NADH], amyloplastic OS=Medicag... [more]
sp|Q0DG35|GLT2_ORYSJ0.000e+050.67Glutamate synthase 2 [NADH], chloroplastic OS=Oryz... [more]
sp|Q9LV03|GLUT1_ARATH0.000e+050.69Glutamate synthase 1 [NADH], chloroplastic OS=Arab... [more]
sp|Q0JKD0|GLT1_ORYSJ0.000e+050.41Glutamate synthase 1 [NADH], chloroplastic OS=Oryz... [more]
back to top
BLAST of Glutamate synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HCB80.000e+061.21glutamate synthase [NADH], amyloplastic-like isofo... [more]
C3XUM80.000e+061.35Glutamine amidotransferase type-2 domain-containin... [more]
A0A087SV690.000e+061.64Putative glutamate synthase [NADPH] (Fragment) OS=... [more]
A0A4D5R9J10.000e+061.76Glutamate synthase OS=Scolopendra viridis OX=11850... [more]
A0A2R5LJA70.000e+061.48Putative glutamate synthase (Fragment) OS=Ornithod... [more]
back to top
BLAST of Glutamate synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dpyda.31.237e-1522.77dihydropyrimidine dehydrogenase [Source:NCBI gene;... [more]
dpyda.31.330e-1522.11dihydropyrimidine dehydrogenase [Source:NCBI gene;... [more]
dpyda.31.571e-1522.77dihydropyrimidine dehydrogenase [Source:NCBI gene;... [more]
dpyda.31.637e-1522.77dihydropyrimidine dehydrogenase [Source:NCBI gene;... [more]
KDM1B2.953e-656.52lysine demethylase 1B [Source:NCBI gene;Acc:103045... [more]
back to top
BLAST of Glutamate synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GLT10.000e+048.65NAD(+)-dependent glutamate synthase (GOGAT); synth... [more]
back to top
BLAST of Glutamate synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO387110.000e+056.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO258142.854e-16648.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO279046.238e-16261.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260582.581e-8245.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO285426.458e-6252.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dpydb2.565e-1622.40dihydropyrimidine dehydrogenase [Source:NCBI gene;... [more]
dpydb3.028e-1622.40dihydropyrimidine dehydrogenase [Source:NCBI gene;... [more]
fdxr9.918e-933.09ferredoxin reductase [Source:NCBI gene;Acc:1011603... [more]
back to top
BLAST of Glutamate synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000077776.10.000e+099.85SMESG000077776.1[more]
SMESG000019456.15.191e-2964.44SMESG000019456.1[more]
SMESG000001463.12.627e-2471.01SMESG000001463.1[more]
SMESG000034030.14.506e-1822.29SMESG000034030.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026686 ID=SMED30026686|Name=Glutamate synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=6461bp
TCTAATTCCAATTCTATTGGATAGATTGTAATGTTATAAGAATTGTTTTG
TGATTCGCTAATTCATTAAAAATAATCTTCTGTATCTGCAATAATTTTAT
CGATTTAAAAAAATGAATTTGCCTTTTTCTAACTATCCGGCTAATACTGG
ACTATATGATCCGAACATCGAAAAAGATTCTTGTGGAGTTGGATTTGTGG
TGGATATAAATGGAAAACAAACACACAAAATTATTGAAGAAGCTCGATAT
ATGCTTATTAGTATGGAACATCGTGGTGCAGTTAGTTCTGACAACGATAC
AGGAGATGGAGCTGGCGTAATGACAGGCATTCCATATGAATTATACCAAT
CTTTCGCAAAAGAAAATGGAACTGAATTACCAGAAAGAGGAAAATTTGCT
GTCGGAATGCTTTTTGTTGATACTGAAAACGTTGAGAAAAGTATGGAACG
ATTTACACTCATTGTCAAAGAGTGTCATTTGGAGGCAATGTTTTGGAAAA
GAGCTGATATTGATAACTCTGCCATTGGATCTGTAGCAAAATCCACGGAG
CCTGCCATAATCCAGATTTTCATTAAAACAAATGTCGAAGACATTCATCC
AAAACTTTTAAAAAGACAGGTATTTATACTGCGAAAATATGGTGAAAGAG
TTATGCGCGAAGAAAATTATCGCTTCTACATTTGTTCTTTGTCGTTACAA
ACAGTTGTTTACAAGGGCCAATTTACGGCACGGCAATTATGGGAATTCTA
TCTTGACCTAAAAGATCCAAATTATAAGACTCACATGGCTATTATTCATA
ACAGATTTTCAACCAATACGTTTCCTTCTTGGGAAAGAGCTCATCCTCAA
CGGATGTTAGCTCACAATGGAGAAATTAACACTTTAAGAGGAAATATCAA
CCTGATGAGAGCCAGAGAAGGAGTAATGAAAAACCATAATTTCGGCGCGA
AGCTTGATGAATTATTTCCCATTATTGAACCAAACATGAGCGACTCTGGT
TGTCTTGATAATGCGCTAGAATTCCTCTATCATGCTAGTCATCGAAGTTT
ACCGGAAACCGTTATAACAATGATGCCTGAAGCATGGCACAATGACCCTC
AAATGTGTCCTCGAAAAAAAGCTTTTTACGCATGGGCGGCTTATTCAATT
GAACCTTGGGATGGACCAGCATTAATAACTTTTTCCGATGGTCGCTACGT
TGGAGCAATTCTTGATAGAAATGGATTAAGACCTTCTCGTTATTATGTAT
CAGACAGTGATATCATGTATATGAGTAGTGAAATTGGAGTTGTTCAAATA
AACCCCGAAAATATTATTTCGAAAGGCAGATTAAAAGCAGGCAGACTGCT
TCTAGTTGATACGGAAATGAAAAAGATTATTGACGATGAAGCGTTGAAAA
ATGAAATTATTCAATTGAGGCCGGTTGAACAATGGATGGCGGAAATGTCT
TTGACTTTGAAGGATCTTCATCAAATAATTCCCGATGATCAATCTTTCCA
ACACGAAGAAGATCCTTTACTGGCGAATTATGATCAGCGTTTATCTTTAT
TTGGCTACACAAATGAGCACATATATATGTTGATATTACCAATGATAAAA
GACAAAAAAGAAGCTCTTGGATCTATGGGAAACGATGCTCCGTTAGCGTG
CCTATCTATGTACAATCCATTGCTGTTTGAATATTTCAAGCAACTTTTTG
CCCAAGTTACTAATCCGCCAATTGATCCATTCCGTGAAAAAATCGTCATG
ACTTTAGCCTGCCCAATTGGACCGGAAGCCAATATTCTAGAACCAAGTGC
CGAACAATGTCATAGATTATGGCTGAATCAGCCTATTCTTTCACTGAGAG
ATTTAGACGTCCTGTTGCAAGTAGACTACAGAGGCTGGAACACCAAGCGA
ATCGATATCACATACCCGTTGTCTAAAAATGGAACGACATTCATAGAAGC
AATAGATGATGTGTGCCGGCAAGCTGAAAACGCAGTGAATACTGGCTATC
GAATCGTTGTTTTGTCAGACCGATATGTTGGGCAAAAGAAAATCAGTTTG
CCTTCTTTGGTAGTTGTTGGTGCTGTTCATCATTACTTGATTAATAAAAA
ATTGAGATTGAAATGCGCCTTGATAATCGATACTGGGGAAGCGAGAGAAG
TCCATCATTTTTGCACTCTTTTGGGTTATGGTGCTGATGCGATTTGTCCA
TATTTCGTTTTTGAAATTGTACAAAGGCTGCGAGACGAAGGAGTTCTGGA
AAAACATTATACTGATGAAATGATGTTTGAGCATTTTGTGACAGCAGTGG
AAACTGGATTGTACAAGGTCATGGCAAAGATGGGAATTTCCACTTTACAT
AGTTACAAAGGAGCTCAGATATTCGAGGCGGTTGGTTTAGCACAGGAAGT
GATTGACAAATGTTTTGTTGGCACTGCTTCCCGAATCGGAGGAGTGACAT
TTGAAGAATTAGCTATTGAAAGTTTAGCAAGACATATTTACACATATAAT
AAGCGCATTGGAGATAATTATATATTACCAAATCCAGGATTTTATCATTG
GCGGGAAGGCGGAGAAAATCATATCAACGAACCAACTGCTCTTTCATATC
TACAAAGTTCAACTAAACAAAACAATAAAAATACGTTTTCTAAATTCCTG
GCATCATCCAACCTCAGTTCTCGATATTGTAATATCCGTGGTCAGTTGGA
ATTCGTATATACATCGGAACCAATTCCGTTAGACGAAGTAGAACCAGCTA
AGGAAATTGTTAAAAGATTCTGCACTGGTGCCATGAGTTTTGGTAGTATT
TCATATGAAGCTCATACAACATTGGCCATAGCAATGAATAGAATTGGAGC
CAAATCAAATACAGGAGAAGGAGGAGAACTACCTGAACGATTTTTGAGCA
ATGATCCACAGAAAAATCTAAGATCTGCTATTAAACAAGTTGCGTCTGCG
AGATTTGGAGTGACCAGTGCTTATTTAGCACACGCTGATGAATTACAAAT
TAAAATGGCTCAAGGCGCGAAACCTGGAGAAGGAGGAGAATTACCAGGAC
ACAAAGTATCGGCAGAAATAGCAGCAACTAGAAATGCTATAGCTGGAGTT
GGTCTTATAAGCCCTCCTCCACACCACGATATTTATTCTATAGAAGATTT
AGCTCAATTGATATATGATCTCAAAGCAGCTAATCCCGAAGCTCGAATCA
GTGTAAAATTAGTATCAGAAGTTGGAATTGGCGTAGTTGCATCTGGTGTT
GTAAAGGGGAAAGCTGAACATATAACTATATCTGGTCATGATGGAGGTAC
TGGAGCCAGTAGTTGGACTGGAATTAAACATGCTGGTTTACCATGGGAGT
TAGGTGTAGCCGAAACACATCAGACATTACTTTTAAATAATTTAAGATCA
AGAGTCGTTTTACAAGCTGATGGTCAAATTAGAACAGGTCGTGATGTTGT
GATTGCTGCACTGTTAGGTGCAGATGAATTTGGCATGTCAACTGCTCCGT
TGATTGTTCTGGGTTGTACAATGATGAGGAAATGTCATCTCAATACTTGC
CCAGTCGGTATCGCTACTCAAGATCCGATTCTTCGTAAGAAATTCGAAGG
AAAACCGGAGCATGTTGTAAATTACTTGTTTTTATTGGCCGAAGATGTTC
GAGAAATAATGGCAAAGCTTGGATTCAGAAGTCTTTCAGAATTAATAGGT
CACAGTGAAAAATTGAAGGCTACAACTGACTATATCAATCATAAAGCATC
TTTGCTTGACTTTACGAAGTTGTTAACCAATCTATCAATCACTCACCCCA
ACGTTGTGATTCAGGTGGGTCTTGTTAAACAGGATTTCAATTTGGGTTCA
AGAGTGGATTATGATCTCATTAAACAAGCCTCTCCGGTGATTTACGGAGA
CGAAACTGAATTAGTTATTAATGTGAAGATAAATAATGATGATCGTGCAT
TTTGTTCTACATTAAGCTATACGATTTCAAAGTGTTTCGGCGATAACAAA
TTGCCGTCCCATAAATCTATTCGAATAAATGCAATAGGGAATGGCGGTCA
AAGTTTCTGTGCTTTTTTAGTTCAAGGGATTTCTGTTTATCTTGAAGGTG
ATGCTAATGATTATGTTGCCAAAGGTCTCAGTGGAGGAGAAGTTGTGATA
GTTCCTCCTAAAAATTCTCATCCGGATTTCACATCCGAAAACAATATAAT
CGTTGGTAATGTCTGTCTTTATGGAGCTGTCAGTGGTAGAGTGTTTTTCC
GAGGTAAAGCAGCTGAAAGATTTTGCGTTCGTAATTCCGGAGCAATTGCA
GTTGTAGAAGGTCTTGGGGATCATGGTTGCGAATACATGACAGGAGGCCG
AGTTATTGTATTAGGCAAAACTGGAAGAAATTTCGCTGCCGGGATGTCAG
GAGGAATAGCTTACGTATATGATACGAAAAACGAATTCCCTGAAAGATGT
AATATGGACATGGTTGATCTCTGCCCTATTAATCAAGATAGTGTTGATGA
ACAATTTATTCACAAAACATTAATAGAATTCCATGATAAGACATTATCTG
TGATAGCTGAAAAAATTCTTTCAAATTGGTCAGAAAATATTAAATATTTC
GTGAAAGTTTTCCCAAAAGAGTATCGAAAGGTTTTAAGAGAAATGAAAAA
TCAACCAAAACTTATAGATGCAACACAGGAAAAAGTTGAAGAGAAAAATT
CTATTGAATTGGAAAAGAACGGACTAATTGATATTGAAGACTTAGTGACC
TCCAATACAAATTTGGATAAATTAAAAGGTTTCATTAAATATCCAAGACA
TAAAAATCCATACCGAAATGTGGAGGAGCGTATAAACGATTGGGGTGAAA
TTTATGCTCATAAAACTGTACGAAAAGGTCTTCGTCGTCAAGCTGCTAGG
TGTATGGAATGTGGAGTACCCTTTTGTCAGTCACATCACGGTTGTCCACT
GGGAAATATTATTCCAAAATGGAATGATTTAGTTTATAAGGATAATTGGA
AAGAGGCGTTGACTCAACTCTTGCAAACTAATAATTTTCCTGAATTTACT
GGTAGATGTTGCCCTGCACCGTGCGAAGCCGCTTGTGTTCTGGGCATTAA
TGAACCCGCAGTAACAATTAAAAATATTGAATGTGCAATAATTGACAAAG
GATTCGATGAAGGTTGGATGGTTCCATCAGCACCAAAAGTTAAAACTGGT
AAAAGGATTGTTGTTGTTGGAAGTGGACCATCGGGTTTAGCGGCTGCTGC
TCAGTTAAATAAAGCTGGCCATGCAGTATTGGTCTTAGAACGTAATGACA
GAATAGGTGGACTATTACAGTATGGTATACCATCAATGAAAATGAGCAAA
GATGTTGTTCAAAGACGTATTAATTTTATGATTGAAGAAGGAATCGAATT
CCAAACAGGTGTCCATATTGGAAACGATAAGTGGCCAGCAGATAAATTGT
TGAACGACTACGATGCTATTGTTTTATGTGTTGGTGCGTCATGGCCTCGT
GATATAAATATTCCAGGTCGAAATTTATCTGGAATTCATTTTGCATTAAG
TTTTCTGGAGAAGTGGCAACGTCACCAACGTGATGAATCTAATACTGAAT
ATCTACAGGTTCTTGCTAAAGATAAAGATGTAATTATTCTTGGAGGAGGA
GACACTGGAGTTGATTGTATAGCAACATCTTTAAGACAAGGAGCACGTAG
TGTGACAACCTTTGAAATTTTGCCAACTCCTGATAAATCCCGTGCCTCTT
ATAACCCGTGGCCAGAGTGGCCGCGTATCTGGCGAGTAGACTATGGCCAT
GAAGAAGTTAAACTTAGGTGGGGCAAGGACCCTCGTCATTTTAACATTAT
GAGTAAAGAATTTTTATCCGATGAAAATGGGCATGTAGCTGGAATCCGGA
CTGTTAAAGTTGAATGGACACGAGATTCCCAAACTGAACAATGGACAATG
AAGGAAGTTCCTAACTCTGAAGATGTATTCAATTGTAATATGGTTTTACT
GGCTATGGGATTTCTGGGTCCTGAGAAAGAGATTATTAACCAATTAAAAC
TAGAAGTGGATTCTCGAACTAATATTAAAACTCCTTCTGGAAAATATCAA
ACGAGCATTCCTAAAGTGTACGCGGCAGGAGATTGTCGGCGAGGCCAGTC
ATTGGTCGTCCATGCCATTAACGAAGGTAGGCAAGCAGCTCGAGAAATAG
ATAAAGACATTATGAATCAAACGAGCTTGGCTGGTCCTGGAGGATTACTT
GATGTTCTGAAGGCGATTCCTGTCGTGTCAGCCGTTGCGTAACAGGAAAT
TATTTTAGATATAATTATTTACATTTTAAGAAAAATCATTTAATGTTTTG
TTAAAGTGATCAGTTGTTTATTCATTGTGAGCAGAAATTTTATAATCATT
TAGTCGTAATTTGAATAGTGGTGGTGAAATTTGGATTTCAGTTGTTTCAT
TTATTAAGTTT
back to top

protein sequence of SMED30026686-orf-1

>SMED30026686-orf-1 ID=SMED30026686-orf-1|Name=SMED30026686-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2060bp
MNLPFSNYPANTGLYDPNIEKDSCGVGFVVDINGKQTHKIIEEARYMLIS
MEHRGAVSSDNDTGDGAGVMTGIPYELYQSFAKENGTELPERGKFAVGML
FVDTENVEKSMERFTLIVKECHLEAMFWKRADIDNSAIGSVAKSTEPAII
QIFIKTNVEDIHPKLLKRQVFILRKYGERVMREENYRFYICSLSLQTVVY
KGQFTARQLWEFYLDLKDPNYKTHMAIIHNRFSTNTFPSWERAHPQRMLA
HNGEINTLRGNINLMRAREGVMKNHNFGAKLDELFPIIEPNMSDSGCLDN
ALEFLYHASHRSLPETVITMMPEAWHNDPQMCPRKKAFYAWAAYSIEPWD
GPALITFSDGRYVGAILDRNGLRPSRYYVSDSDIMYMSSEIGVVQINPEN
IISKGRLKAGRLLLVDTEMKKIIDDEALKNEIIQLRPVEQWMAEMSLTLK
DLHQIIPDDQSFQHEEDPLLANYDQRLSLFGYTNEHIYMLILPMIKDKKE
ALGSMGNDAPLACLSMYNPLLFEYFKQLFAQVTNPPIDPFREKIVMTLAC
PIGPEANILEPSAEQCHRLWLNQPILSLRDLDVLLQVDYRGWNTKRIDIT
YPLSKNGTTFIEAIDDVCRQAENAVNTGYRIVVLSDRYVGQKKISLPSLV
VVGAVHHYLINKKLRLKCALIIDTGEAREVHHFCTLLGYGADAICPYFVF
EIVQRLRDEGVLEKHYTDEMMFEHFVTAVETGLYKVMAKMGISTLHSYKG
AQIFEAVGLAQEVIDKCFVGTASRIGGVTFEELAIESLARHIYTYNKRIG
DNYILPNPGFYHWREGGENHINEPTALSYLQSSTKQNNKNTFSKFLASSN
LSSRYCNIRGQLEFVYTSEPIPLDEVEPAKEIVKRFCTGAMSFGSISYEA
HTTLAIAMNRIGAKSNTGEGGELPERFLSNDPQKNLRSAIKQVASARFGV
TSAYLAHADELQIKMAQGAKPGEGGELPGHKVSAEIAATRNAIAGVGLIS
PPPHHDIYSIEDLAQLIYDLKAANPEARISVKLVSEVGIGVVASGVVKGK
AEHITISGHDGGTGASSWTGIKHAGLPWELGVAETHQTLLLNNLRSRVVL
QADGQIRTGRDVVIAALLGADEFGMSTAPLIVLGCTMMRKCHLNTCPVGI
ATQDPILRKKFEGKPEHVVNYLFLLAEDVREIMAKLGFRSLSELIGHSEK
LKATTDYINHKASLLDFTKLLTNLSITHPNVVIQVGLVKQDFNLGSRVDY
DLIKQASPVIYGDETELVINVKINNDDRAFCSTLSYTISKCFGDNKLPSH
KSIRINAIGNGGQSFCAFLVQGISVYLEGDANDYVAKGLSGGEVVIVPPK
NSHPDFTSENNIIVGNVCLYGAVSGRVFFRGKAAERFCVRNSGAIAVVEG
LGDHGCEYMTGGRVIVLGKTGRNFAAGMSGGIAYVYDTKNEFPERCNMDM
VDLCPINQDSVDEQFIHKTLIEFHDKTLSVIAEKILSNWSENIKYFVKVF
PKEYRKVLREMKNQPKLIDATQEKVEEKNSIELEKNGLIDIEDLVTSNTN
LDKLKGFIKYPRHKNPYRNVEERINDWGEIYAHKTVRKGLRRQAARCMEC
GVPFCQSHHGCPLGNIIPKWNDLVYKDNWKEALTQLLQTNNFPEFTGRCC
PAPCEAACVLGINEPAVTIKNIECAIIDKGFDEGWMVPSAPKVKTGKRIV
VVGSGPSGLAAAAQLNKAGHAVLVLERNDRIGGLLQYGIPSMKMSKDVVQ
RRINFMIEEGIEFQTGVHIGNDKWPADKLLNDYDAIVLCVGASWPRDINI
PGRNLSGIHFALSFLEKWQRHQRDESNTEYLQVLAKDKDVIILGGGDTGV
DCIATSLRQGARSVTTFEILPTPDKSRASYNPWPEWPRIWRVDYGHEEVK
LRWGKDPRHFNIMSKEFLSDENGHVAGIRTVKVEWTRDSQTEQWTMKEVP
NSEDVFNCNMVLLAMGFLGPEKEIINQLKLEVDSRTNIKTPSGKYQTSIP
KVYAAGDCRRGQSLVVHAINEGRQAAREIDKDIMNQTSLAGPGGLLDVLK
AIPVVSAVA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:00515383 iron, 4 sulfur cluster binding
GO:0016491oxidoreductase activity
GO:0003824catalytic activity
GO:0016638oxidoreductase activity, acting on the CH-NH2 group of donors
GO:0015930glutamate synthase activity
GO:0010181FMN binding
GO:0005506iron ion binding
GO:0050660flavin adenine dinucleotide binding
GO:0016040glutamate synthase (NADH) activity
GO:0045181glutamate synthase activity, NAD(P)H as acceptor
GO:0051536iron-sulfur cluster binding
GO:0016639oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR002489Glu_synth_asu_C
IPR013785Aldolase_TIM
IPR023753FAD/NAD-binding_dom
IPR002932Glu_synthdom
IPR017932GATase_2_dom
IPR012220Glu_synth_euk
IPR006982Glu_synth_centr_N
IPR016040NAD(P)-bd_dom
IPR029055Ntn_hydrolases_N
IPR028261DPD_II
IPR009051Helical_ferredxn
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0055114oxidation-reduction process
GO:0006537glutamate biosynthetic process
GO:0006807nitrogen compound metabolic process