WD repeat and SOCS box-containing 1

Overview
NameWD repeat and SOCS box-containing 1
Smed IDSMED30026669
Length (bp)1609
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat and SOCS box-containing 1 (SMED30026669) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat and SOCS box-containing 1 (SMED30026669) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat and SOCS box-containing 1 (SMED30026669) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat and SOCS box-containing 1 (SMED30026669) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026669

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30026669SMESG000032294.1 dd_Smed_v4_1381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30026669SMESG000032294.1 dd_Smed_v4_1381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026669SMESG000032294.1 dd_Smed_v4_1381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026669SMESG000032294.1 dd_Smed_v4_1381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
whole organismSMED30026669SMESG000032294.1 Contig51174newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30026669SMESG000032294.1 Contig51174uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Human
Match: WSB1 (WD repeat and SOCS box containing 1 [Source:HGNC Symbol;Acc:HGNC:19221])

HSP 1 Score: 137.502 bits (345), Expect = 5.526e-35
Identity = 113/390 (28.97%), Postives = 188/390 (48.21%), Query Frame = 2
Query:  146 AISSCGYYLAFNSDSQTLKIV----CLKS--IRSTKLDKNETNLNDCLPILFESKMGSQ--------IRCLDFGRGNVSNNRLPHRSSK----RRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQ 1261
            A +  G Y A++   +T+K+V    CL++  +  TK   N ++L   LP   ++  G Q        I C D        + +P + S+        +    +  LLA GL +G++KI+ +                G   L L +H E +  ++F+ DGSL L S S D  L +WD+ DDGNM K +    ++  S CA+   S  +C  G+     ++  +K   M+  L + H++D+ AC +S D +LL T+S+DT + IW       +++       P+ IF GGA+++++R  +FS D +++ S++DD ++R W + D   PV Q+     G      C  F+ DG+     T DG V F+ +     SL  LCR S+R  +  Q
Sbjct:   41 AFAPDGSYFAWSQGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLR--LPR--QNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVY--------------TGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYS-CAFSPDSSMLCSVGASKAVFLWNMDK-YTMIRKL-EGHHHDVVACDFSPDGALLATASYDTRVYIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRI-DEDYPV-QVAPLSNGL-----CCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMPTQ 402          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Human
Match: WSB1 (WD repeat and SOCS box containing 1 [Source:HGNC Symbol;Acc:HGNC:19221])

HSP 1 Score: 129.028 bits (323), Expect = 3.466e-33
Identity = 85/261 (32.57%), Postives = 138/261 (52.87%), Query Frame = 2
Query:  485 PLVENGGNAKLMLH--NHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQ 1261
            P V      KL+L+  +H E +  ++F+ DGSL L S S D  L +WD+ DDGNM K +    ++  S CA+   S  +C  G+     ++  +K   M+  L + H++D+ AC +S D +LL T+S+DT + IW       +++       P+ IF GGA+++++R  +FS D +++ S++DD ++R W + D   PV Q+     G      C  F+ DG+     T DG V F+ +     SL  LCR S+R  +  Q
Sbjct:    6 PRVNEKEIGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYS-CAFSPDSSMLCSVGASKAVFLWNMDK-YTMIRKL-EGHHHDVVACDFSPDGALLATASYDTRVYIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRI-DEDYPV-QVAPLSNGL-----CCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMPTQ 256          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Human
Match: WSB2 (WD repeat and SOCS box containing 2 [Source:HGNC Symbol;Acc:HGNC:19222])

HSP 1 Score: 97.8265 bits (242), Expect = 2.382e-21
Identity = 84/303 (27.72%), Postives = 137/303 (45.21%), Query Frame = 2
Query:  353 PHRSSKRRITYPVMDNACL-LAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVV 1258
            P R    R    V D +CL LA GL  GQ+KI+ +                G   L L  H + +  +SF+  GSL L S S D  L +WD+   G   + ++  +     CC+       +C         ++ S +   ++  L + H + + +C +S D +LL T+S+DT++++W   T + +  +  T + P++      H   +R   FSP+ + L +V+DD ++R+W LE   +P+     P T       C  F P G      T DG V F+ +     SL  LCRK++R  L  
Sbjct:  108 PSRKLWARHHPQVPDVSCLVLATGLNDGQIKIWEV--------------QTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQ-VLSGHLQWVYCCSISPDCSMLCSAAGEKSVFLW-SMRSYTLIRKL-EGHQSSVVSCDFSPDSALLVTASYDTNVIMWDPYTGERLRSLHHTQVDPAMD-DSDVHISSLRSVCFSPEGLYLATVADDRLLRIWALE-LKTPI--AFAPMTNGL----CCTFFPHGGVIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTT 385          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Human
Match: WSB2 (WD repeat and SOCS box containing 2 [Source:HGNC Symbol;Acc:HGNC:19222])

HSP 1 Score: 97.8265 bits (242), Expect = 2.423e-21
Identity = 84/303 (27.72%), Postives = 137/303 (45.21%), Query Frame = 2
Query:  353 PHRSSKRRITYPVMDNACL-LAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVV 1258
            P R    R    V D +CL LA GL  GQ+KI+ +                G   L L  H + +  +SF+  GSL L S S D  L +WD+   G   + ++  +     CC+       +C         ++ S +   ++  L + H + + +C +S D +LL T+S+DT++++W   T + +  +  T + P++      H   +R   FSP+ + L +V+DD ++R+W LE   +P+     P T       C  F P G      T DG V F+ +     SL  LCRK++R  L  
Sbjct:  106 PSRKLWARHHPQVPDVSCLVLATGLNDGQIKIWEV--------------QTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQ-VLSGHLQWVYCCSISPDCSMLCSAAGEKSVFLW-SMRSYTLIRKL-EGHQSSVVSCDFSPDSALLVTASYDTNVIMWDPYTGERLRSLHHTQVDPAMD-DSDVHISSLRSVCFSPEGLYLATVADDRLLRIWALE-LKTPI--AFAPMTNGL----CCTFFPHGGVIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTT 383          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Human
Match: WSB2 (WD repeat and SOCS box containing 2 [Source:HGNC Symbol;Acc:HGNC:19222])

HSP 1 Score: 97.8265 bits (242), Expect = 2.769e-21
Identity = 84/301 (27.91%), Postives = 137/301 (45.51%), Query Frame = 2
Query:  353 PHRSSKRRITYPVMDNACL-LAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKL 1252
            P R    R    V D +CL LA GL  GQ+KI+ +                G   L L  H + +  +SF+  GSL L S S D  L +WD+   G   + ++  +     CC+       +C         ++ S +   ++  L + H + + +C +S D +LL T+S+DT++++W   T + +  +  T + P++      H   +R   FSP+ + L +V+DD ++R+W LE   +P+     P T       C  F P G      T DG V F+ +     SL  LCRK++R  L
Sbjct:  123 PSRKLWARHHPQVPDVSCLVLATGLNDGQIKIWEV--------------QTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQ-VLSGHLQWVYCCSISPDCSMLCSAAGEKSVFLW-SMRSYTLIRKL-EGHQSSVVSCDFSPDSALLVTASYDTNVIMWDPYTGERLRSLHHTQVDPAMD-DSDVHISSLRSVCFSPEGLYLATVADDRLLRIWALE-LKTPI--AFAPMTNGL----CCTFFPHGGVIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFL 398          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Celegans
Match: lin-53 (Probable histone-binding protein lin-53 [Source:UniProtKB/Swiss-Prot;Acc:P90916])

HSP 1 Score: 48.9062 bits (115), Expect = 5.952e-6
Identity = 46/188 (24.47%), Postives = 86/188 (45.74%), Query Frame = 2
Query:  509 AKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYS-SDDSLLGTSSFDTSIVIWCAGTY--KPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLV-SVSDDNIIRMWNLED 1060
            AK +   H   +  V++ +       S+  D KL +WD+    +     I  +S   +C A+   S+ I   GS  K       +   M     + H ++I   ++S  ++++L +S  D  + +W           +  + G  P L+F+ G H   I DF+++P+   +V SVS+DNI+++W + D
Sbjct:  214 AKDVFKGHESVVEDVAWHVLHDGVFGSVGDDKKLLIWDV--RTSTPGHCIDAHSAEVNCLAFNPYSEFILATGSADKTVALWDLRNLRMKLHSFESHRDEIFQVQWSPHNETILASSGTDKRLHVWDLSKIGEDQSAEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWVVCSVSEDNILQVWQMAD 398          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 50.447 bits (119), Expect = 2.271e-6
Identity = 62/233 (26.61%), Postives = 99/233 (42.49%), Query Frame = 2
Query:  512 KLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASP------VDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFN 1192
            K  L  H + ++ V FS +G   LAS S D  + +W  +D    ++  I  +    S  AW + S+ + V GS  K            + TL + H N +  C ++   +L+ + SFD S+ IW   T K +  +              AH+  +    F+ D   +VS S D + R+W   DTAS       +D    P       +S VKF+P+G   L  T D  +  ++
Sbjct:   65 KFTLAGHTKAVSAVKFSPNGEW-LASSSADKLIKIWGAYD--GKFEKTISGHKLGISDVAWSSDSR-LLVSGSDDKTLKVWELSTGKSLKTL-KGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTL-------------PAHSDPVSAVHFNRDGSLIVSSSYDGLCRIW---DTASGQCLKTLIDDDNPP-------VSFVKFSPNGKYILAATLDNTLKLWD 269          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 50.447 bits (119), Expect = 2.271e-6
Identity = 62/233 (26.61%), Postives = 99/233 (42.49%), Query Frame = 2
Query:  512 KLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASP------VDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFN 1192
            K  L  H + ++ V FS +G   LAS S D  + +W  +D    ++  I  +    S  AW + S+ + V GS  K            + TL + H N +  C ++   +L+ + SFD S+ IW   T K +  +              AH+  +    F+ D   +VS S D + R+W   DTAS       +D    P       +S VKF+P+G   L  T D  +  ++
Sbjct:   65 KFTLAGHTKAVSAVKFSPNGEW-LASSSADKLIKIWGAYD--GKFEKTISGHKLGISDVAWSSDSR-LLVSGSDDKTLKVWELSTGKSLKTL-KGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTL-------------PAHSDPVSAVHFNRDGSLIVSSSYDGLCRIW---DTASGQCLKTLIDDDNPP-------VSFVKFSPNGKYILAATLDNTLKLWD 269          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Fly
Match: Caf1-55 (gene:FBgn0263979 transcript:FBtr0301845)

HSP 1 Score: 48.9062 bits (115), Expect = 7.988e-6
Identity = 43/201 (21.39%), Postives = 94/201 (46.77%), Query Frame = 2
Query:  506 NAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIII-PNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYS-SDDSLLGTSSFDTSIVIWCAGTY--KPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLV-SVSDDNIIRMWNLEDTASPVDQITVP 1093
            +AK +   H   +  V++ L       S++ D KL +WD  ++     S  +  ++   +C ++   S+ I   GS  K       +   +     + H ++I   ++S  ++++L +S  D  + +W       +   +  + G  P L+F+ G H   I DF+++P+   ++ SVS+DNI+++W + +     ++  +P
Sbjct:  221 DAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDG-PPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPEIP 420          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Fly
Match: Gbeta13F (gene:FBgn0001105 transcript:FBtr0331597)

HSP 1 Score: 48.521 bits (114), Expect = 8.222e-6
Identity = 56/229 (24.45%), Postives = 100/229 (43.67%), Query Frame = 2
Query:  512 KLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIY--QSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFN 1192
            +  L  H   +  + +  D S  L S S DGKL +WD     N   +I + +S+  + CA+      +  GG    C IY  ++ +  + V+     H   +S C++  D+ ++ TSS D S  +W            +TGL+ +  F+G  H   +   + +P C   VS + D   ++W++ +    V + T P  G +  ++ V F P+G      + D     F+
Sbjct:   48 RRTLRGHLAKIYAMHWGND-SRNLVSASQDGKLIVWDS-HTTNKVHAIPLRSSWVMT-CAYAPSGSYVACGGLDNMCSIYNLKTREGNVRVSRELPGHGGYLSCCRFLDDNQIV-TSSGDMSCGLWDI----------ETGLQVT-SFLG--HTGDVMALSLAPQCKTFVSGACDASAKLWDIRE---GVCKQTFP--GHESDINAVTFFPNGQAFATGSDDATCRLFD 254          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Fly
Match: Gbeta13F (gene:FBgn0001105 transcript:FBtr0074110)

HSP 1 Score: 48.521 bits (114), Expect = 8.222e-6
Identity = 56/229 (24.45%), Postives = 100/229 (43.67%), Query Frame = 2
Query:  512 KLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIY--QSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFN 1192
            +  L  H   +  + +  D S  L S S DGKL +WD     N   +I + +S+  + CA+      +  GG    C IY  ++ +  + V+     H   +S C++  D+ ++ TSS D S  +W            +TGL+ +  F+G  H   +   + +P C   VS + D   ++W++ +    V + T P  G +  ++ V F P+G      + D     F+
Sbjct:   48 RRTLRGHLAKIYAMHWGND-SRNLVSASQDGKLIVWDS-HTTNKVHAIPLRSSWVMT-CAYAPSGSYVACGGLDNMCSIYNLKTREGNVRVSRELPGHGGYLSCCRFLDDNQIV-TSSGDMSCGLWDI----------ETGLQVT-SFLG--HTGDVMALSLAPQCKTFVSGACDASAKLWDIRE---GVCKQTFP--GHESDINAVTFFPNGQAFATGSDDATCRLFD 254          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Zebrafish
Match: wsb1 (WD repeat and SOCS box containing 1 [Source:NCBI gene;Acc:323226])

HSP 1 Score: 142.51 bits (358), Expect = 6.126e-37
Identity = 109/387 (28.17%), Postives = 183/387 (47.29%), Query Frame = 2
Query:  146 AISSCGYYLAFNSDSQTLKIV----CLKSIRSTKLDKNE-------TNLNDCLPILFESKMGSQIRCLDFGRGNVSNNRLPHRSSK----RRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQ 1261
            A +  G Y A++   + +++V    CL S    K D++        +  N    +L        I C D   G    + +P + S+        +    +  LLA GL +G++KI+ +                G   L L +H + +  ++F+ DGSL L S S D  L +WD+ DDGNM K ++  +     C A+   S  +C  G+     ++  +K  L+     + H+ND+  C++S D +LL T+S+DT +++W   T   +L++      PS IF GGA+++++R  AF  D  ++ SV+DD ++R W++ D  SP  Q   P T       C  F+ DG+     + DG V F+ S  +  SL  LCR ++R  +  Q
Sbjct:   41 AFAPDGSYFAWSQGHRIVRLVPWKKCLASFSVRKEDRSSGAGPRRLSRQNSEGSLLPGEPREHTIDCGDIVWGLAFGSSVPEKQSRCVNIEWHRFKFGQDQLLLATGLNNGRIKIWDVYT--------------GKLLLNLMDHTDIVRDLTFAPDGSLVLVSASRDKTLRVWDLKDDGNMVK-VLRGHQNWVYCSAFSPDSSVLCSVGAGKAVFLWDMDKYTLIRKL--EGHHNDVVCCEFSPDGALLATASYDTRVIVWDPHTATVLLELGHLFPPPSPIFAGGANDRWVRSVAFCHDGRHIASVTDDRLVRFWSI-DEKSP--QAIGPLTNGL----CCAFSTDGSVLSAGSRDGSVHFWASPRSIASLQHLCRMTLRRVMPTQ 403          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Zebrafish
Match: wsb2 (WD repeat and SOCS box containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-26])

HSP 1 Score: 62.003 bits (149), Expect = 6.767e-10
Identity = 67/305 (21.97%), Postives = 125/305 (40.98%), Query Frame = 2
Query:  329 GNVSNNRLPHRSSKRRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVR 1243
            G  ++ R+      RR      ++  LLA GL +G ++++              + + GN +  L  H   +  + F+ +GSL L S S D  L +WD+   G     +  PN +   C    + S    V     K +++ S +    +  L   H   +++C +S D +LL  +S+ ++   W    + P      T ++   +    + N  +   +FSP  + L++  D   +++W++E      D++       +    C  F P G        DG V F+   +   SL  LCR ++R
Sbjct:   92 GPCTSTRVDSAHQHRR------EHELLLAAGLHNGSIQVW--------------LVSTGNLQFTLTGHQAPVRDLVFAPNGSLTLISASRDKTLRIWDLGKKGASPHVLRGPNYWVFRCAVSPDSSVIASVCNLDSKVYLW-SLRSYTFMKHLTYDHERTMASCDFSQDGALLAIASYHSNTGWW-LDLWDPYTADLLTRVQDCEVCAYRSDN-LLTSLSFSPVAL-LLAFKDYRALQIWDVER-----DKLVADTDHNRAGGVCCAFHPQGGVIATGCRDGHVKFWKVPHLVPSLRHLCRVALR 367          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Zebrafish
Match: gnb2 (guanine nucleotide binding protein (G protein), beta polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-050320-65])

HSP 1 Score: 54.6842 bits (130), Expect = 1.349e-7
Identity = 57/241 (23.65%), Postives = 104/241 (43.15%), Query Frame = 2
Query:  476 GSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIY--QSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFN 1192
            G  P+       +  L  H   +  + +  D  L L S S DGKL +WD +   N   +I + +S+  +C A+      +  GG    C IY  ++ +  + V+     H   +S C++  D+ ++ TSS DT+  +W            +TG + +L F G  H+  +   + +PD    +S + D  I++W++ D+          FTG +  ++   F P G+     + D     F+
Sbjct:   36 GLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRL-LVSASQDGKLIIWDSYTT-NKIHAIPLRSSWVMTC-AYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFIDDNQII-TSSGDTTCALWDI----------ETGQQTTL-FSG--HSGDVMSLSLAPDSRTFISGACDASIKLWDIRDS-----MCRQTFTGHESDINAACFFPSGSAFATGSDDATCRLFD 254          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Zebrafish
Match: gnb2 (guanine nucleotide binding protein (G protein), beta polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-050320-65])

HSP 1 Score: 54.6842 bits (130), Expect = 1.349e-7
Identity = 57/241 (23.65%), Postives = 104/241 (43.15%), Query Frame = 2
Query:  476 GSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIY--QSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFN 1192
            G  P+       +  L  H   +  + +  D  L L S S DGKL +WD +   N   +I + +S+  +C A+      +  GG    C IY  ++ +  + V+     H   +S C++  D+ ++ TSS DT+  +W            +TG + +L F G  H+  +   + +PD    +S + D  I++W++ D+          FTG +  ++   F P G+     + D     F+
Sbjct:   36 GLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRL-LVSASQDGKLIIWDSYTT-NKIHAIPLRSSWVMTC-AYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFIDDNQII-TSSGDTTCALWDI----------ETGQQTTL-FSG--HSGDVMSLSLAPDSRTFISGACDASIKLWDIRDS-----MCRQTFTGHESDINAACFFPSGSAFATGSDDATCRLFD 254          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Zebrafish
Match: gnb2 (guanine nucleotide binding protein (G protein), beta polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-050320-65])

HSP 1 Score: 54.6842 bits (130), Expect = 1.349e-7
Identity = 57/241 (23.65%), Postives = 104/241 (43.15%), Query Frame = 2
Query:  476 GSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIY--QSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFN 1192
            G  P+       +  L  H   +  + +  D  L L S S DGKL +WD +   N   +I + +S+  +C A+      +  GG    C IY  ++ +  + V+     H   +S C++  D+ ++ TSS DT+  +W            +TG + +L F G  H+  +   + +PD    +S + D  I++W++ D+          FTG +  ++   F P G+     + D     F+
Sbjct:   36 GLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRL-LVSASQDGKLIIWDSYTT-NKIHAIPLRSSWVMTC-AYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFIDDNQII-TSSGDTTCALWDI----------ETGQQTTL-FSG--HSGDVMSLSLAPDSRTFISGACDASIKLWDIRDS-----MCRQTFTGHESDINAACFFPSGSAFATGSDDATCRLFD 254          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Xenopus
Match: wsb1 (WD repeat and SOCS box containing 1 [Source:NCBI gene;Acc:395021])

HSP 1 Score: 143.28 bits (360), Expect = 6.001e-37
Identity = 109/384 (28.39%), Postives = 184/384 (47.92%), Query Frame = 2
Query:  146 AISSCGYYLAFNSDSQTLKIV----CLKSIRSTKLDKNETNLNDCLPILFESKMGSQ-------IRCLDFGRGNVSNNRLPHRSSK----RRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKL 1252
            A +  G Y A++   + +K+V    CLK+  +    KN  NL +       S +G +       I C D        + +P + S+        +    +  LLA GL +G++KI+ +                G   L L +H E +  ++F+ DGSL L S S D  L +WD+ DDGNM K ++  +     CCA+   S  +C  G+     ++  +K   M+  L   HYND+ AC++S D +LL T+S+DT + +W       + +       P+ IF GG + ++++  +FS D V++ S++DDN++R W + D + PV+    P + + L   C  F+ DG+     T DG   F+++     SL  LCR ++R  +
Sbjct:   41 AFAPDGSYFAWSQGHRIVKLVPWSRCLKNFTACST-KNGVNLTNGRLSRQNSDLGQRNKPIEHTIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFKFGQDQLLLATGLSNGRIKIWDVYT--------------GKLLLNLMDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMK-VLRGHQNWVYCCAFSPDSSMLCSVGAGKAVFLWDMDK-YTMIRKL-DGHYNDVVACEFSPDGALLATASYDTRVYVWDPHIGSILFEFGHLFPPPTPIFAGGDNGRWVKSVSFSHDGVHIASLADDNLVRFWRI-DKSYPVE--VAPLS-KGL---CCAFSTDGSVLAAGTQDGNAYFWSTPKYVSSLQHLCRMAIRRVM 399          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Xenopus
Match: wsb1 (WD repeat and SOCS box containing 1 [Source:NCBI gene;Acc:395021])

HSP 1 Score: 142.895 bits (359), Expect = 6.497e-37
Identity = 109/382 (28.53%), Postives = 183/382 (47.91%), Query Frame = 2
Query:  146 AISSCGYYLAFNSDSQTLKIV----CLKSIRSTKLDKNETNLNDCLPILFESKMGSQ-------IRCLDFGRGNVSNNRLPHRSSK----RRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVRE 1246
            A +  G Y A++   + +K+V    CLK+  +    KN  NL +       S +G +       I C D        + +P + S+        +    +  LLA GL +G++KI+ +                G   L L +H E +  ++F+ DGSL L S S D  L +WD+ DDGNM K ++  +     CCA+   S  +C  G+     ++  +K   M+  L   HYND+ AC++S D +LL T+S+DT + +W       + +       P+ IF GG + ++++  +FS D V++ S++DDN++R W + D + PV+    P + + L   C  F+ DG+     T DG   F+++     SL  LCR ++R 
Sbjct:   41 AFAPDGSYFAWSQGHRIVKLVPWSRCLKNFTACST-KNGVNLTNGRLSRQNSDLGQRNKPIEHTIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFKFGQDQLLLATGLSNGRIKIWDVYT--------------GKLLLNLMDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMK-VLRGHQNWVYCCAFSPDSSMLCSVGAGKAVFLWDMDK-YTMIRKL-DGHYNDVVACEFSPDGALLATASYDTRVYVWDPHIGSILFEFGHLFPPPTPIFAGGDNGRWVKSVSFSHDGVHIASLADDNLVRFWRI-DKSYPVE--VAPLS-KGL---CCAFSTDGSVLAAGTQDGNAYFWSTPKYVSSLQHLCRMAIRR 397          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Xenopus
Match: wsb2 (WD repeat and SOCS box containing 2 [Source:NCBI gene;Acc:100145242])

HSP 1 Score: 109.383 bits (272), Expect = 3.642e-25
Identity = 101/358 (28.21%), Postives = 157/358 (43.85%), Query Frame = 2
Query:  173 AFNSDSQTLKIVCLKSIRSTKLDKNETNLNDCLPILFESKMGSQIRCLDFGRGNVSNNRLPHRSSKRRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIF-MGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVR 1243
            AF S +Q +KI  +K  RS      E    DC  I++    GS    L  GR     NR     S   +         LLA GL  G VK++ +     + G+     N G     L  H + +  VSFS + SL L + S D  L +WD+  DG +   ++  ++    CCA       +C         ++ S +   ++  L + H N + +C +S D +LL T+S+DT++++W   T + + +     L P L +         +R   FSP+ + L S++DD  +R+W+LE      D ++V      L   C  F P G        DG V F+ S     SL  LCRK++R
Sbjct:   64 AFASKNQCIKITDIKGRRSP-----EEKTLDCGQIVWGLSFGSSSSPL--GRKLWPCNRHQAAGSNSSLM--------LLATGLNDGHVKVWDV-----HTGNLCFPLNSGCLLFNLAGHQDVVRDVSFSTNQSLILVTASRDKTLRIWDLKKDGKLLH-VLSGHTNWVYCCAISPDCSMLCSAAGENSVLLW-SMRSYTLIRKL-EGHQNSVVSCDFSPDSALLVTASYDTTVIMWDPYTGERLREFLHVSLPPDLEYSTTEPQLSSLRSVCFSPEGLFLASLADDRFLRLWSLELQ----DPVSVAPVTNGL---CCTFLPHGGVLATGNRDGHVQFWTSPKVLSSLRHLCRKALR 391          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Xenopus
Match: hs3st5 (heparan sulfate-glucosamine 3-sulfotransferase 5 [Source:Xenbase;Acc:XB-GENE-5795358])

HSP 1 Score: 56.9954 bits (136), Expect = 7.583e-8
Identity = 53/209 (25.36%), Postives = 85/209 (40.67%), Query Frame = 2
Query:  623 MWDDGNMYKSIIIPNSFR-PS---CCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKS 1237
            +W++   Y SI    S   PS   C +     +   VG S G  H+  ++        +     + +SAC + SDD L             C G+Y  +L+IW+       +    AH + I     SPD   L++ S D  +++W      S +  I+ P+      L+C  F P G    V + DGK+     +N  +  +VLC  S
Sbjct: 1779 LWNNKPAYMSICRSKSLEIPSLLGCVSLSPSGRMAAVGASSGALHLINTDSG--EEVRILHSGCDGVSACNFISDDLL-------------CVGSYDGILEIWKIS-DGCRMHRAEAHRRQITGCCVSPDQRQLITCSLDYQLKLWE-TSRGSLLGSISFPYP-----LACTTFHPRGHVVAVGSWDGKITVLRLEN-WEKTAVLCGSS 1964          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Xenopus
Match: APAF1 (apoptotic peptidase activating factor 1 [Source:NCBI gene;Acc:100127738])

HSP 1 Score: 55.0694 bits (131), Expect = 3.228e-7
Identity = 56/218 (25.69%), Postives = 92/218 (42.20%), Query Frame = 2
Query:  530 HYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPS----------CCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSL--LGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPV-----DQITVPFTG-RKLILSCVK 1129
            H E +    +S D    LAS S+DG L +WD+ +  N  KSI +   F             CCAW N   +I V      C IY +E+ C +++ L   H   I  C + + + +  L  S +              ++Q+W      + I    AH  ++    FSP   + ++ SDD  +++W   + + P       +  V F+G R L+L+  K
Sbjct:  742 HIESVYHCRYSPDDRY-LASSSMDGSLKIWDV-ESANEEKSIEVAKLFENEDEAQPEVLLKCCAWSNDGSRIMVTARNFLC-IYDAER-CNLLSQLKACH--QILYCDFCTTNQIAALALSHY--------------VVQLWDID-SSTKIADFNAHLSWVHCVKFSPKSSSFLTSSDDQTVKLWETSNVSKPAATNLKREFDVTFSGERTLVLATSK 938          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Mouse
Match: Wsb1 (WD repeat and SOCS box-containing 1 [Source:MGI Symbol;Acc:MGI:1926139])

HSP 1 Score: 139.043 bits (349), Expect = 1.127e-35
Identity = 109/387 (28.17%), Postives = 183/387 (47.29%), Query Frame = 2
Query:  146 AISSCGYYLAFNSDSQTLKIVCLKSIRSTKL---DKNETNLNDCLPILFESKMGSQ--------IRCLDFGRGNVSNNRLPHRSSK----RRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQ 1261
            A +  G Y A++   + +K+V     R   L    KN TN + CL +  ++  G Q        I C D        + +P + S+        +    +  LLA GL +G++KI+ +                G   L L +H E +  ++F+ DGSL L S S D  L +WD+ DDGNM K +    ++  S CA+      +C  G+     ++  +K   M+  L + H++D+ AC +S D +LL T+S+DT + +W       +++       P+ IF GGA+++++R  +FS D +++ S++DD ++R W + D   PV Q+     G      C  F+ DG+     T DG V F+ +     SL  +CR S+R  +  Q
Sbjct:   41 AFAPDGSYFAWSQGYRIVKLVPWSQCRKNFLLHGSKNVTN-SSCLKLARQNSNGGQKNKPPEHVIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYT--------------GKLLLNLVDHIEMVRDLTFAPDGSLLLVSASRDKTLRVWDLKDDGNMVKVLRAHQNWVYS-CAFSPDCSMLCSVGASKAVFLWNMDK-YTMIRKL-EGHHHDVVACDFSPDGALLATASYDTRVYVWDPHNGDLLMEFGHLFPSPTPIFAGGANDRWVRAVSFSHDGLHVASLADDKMVRFWRI-DEDCPV-QVAPLSNGL-----CCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHICRMSIRRVMSTQ 402          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Mouse
Match: Wsb2 (WD repeat and SOCS box-containing 2 [Source:MGI Symbol;Acc:MGI:2144041])

HSP 1 Score: 101.293 bits (251), Expect = 1.386e-22
Identity = 84/289 (29.07%), Postives = 134/289 (46.37%), Query Frame = 2
Query:  395 DNACL-LAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVV 1258
            D +CL LA GL  GQ+KI+ +                G   L L  H + +  +SF+  GSL L S S D  L +WD+   G   + ++  +     CC+       +C         ++ S +   ++  L + H + + +C +S D +LL T+S+DTS+++W   T + +  +  T L+P++      H   +R   FSP+ + L +V+DD ++R+W LE  A PV     P T       C  F P G      T DG V F+ +     SL  LCRK++R  L  
Sbjct:  122 DVSCLILATGLNDGQIKIWEV--------------QTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQ-VLSGHLQWVYCCSISPDCSMLCSAAGEKSVFLW-SMRSYTLIRKL-EGHQSSVVSCDFSPDSALLVTASYDTSVIMWDPYTGERLRSLHHTQLEPTMD-DSDVHMSSLRSVCFSPEGLYLATVADDRLLRIWALELKA-PV--AFAPMTNGL----CCTFFPHGGIIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTT 385          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Mouse
Match: Wsb2 (WD repeat and SOCS box-containing 2 [Source:MGI Symbol;Acc:MGI:2144041])

HSP 1 Score: 100.908 bits (250), Expect = 1.666e-22
Identity = 84/289 (29.07%), Postives = 134/289 (46.37%), Query Frame = 2
Query:  395 DNACL-LAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVV 1258
            D +CL LA GL  GQ+KI+ +                G   L L  H + +  +SF+  GSL L S S D  L +WD+   G   + ++  +     CC+       +C         ++ S +   ++  L + H + + +C +S D +LL T+S+DTS+++W   T + +  +  T L+P++      H   +R   FSP+ + L +V+DD ++R+W LE  A PV     P T       C  F P G      T DG V F+ +     SL  LCRK++R  L  
Sbjct:  120 DVSCLILATGLNDGQIKIWEV--------------QTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQ-VLSGHLQWVYCCSISPDCSMLCSAAGEKSVFLW-SMRSYTLIRKL-EGHQSSVVSCDFSPDSALLVTASYDTSVIMWDPYTGERLRSLHHTQLEPTMD-DSDVHMSSLRSVCFSPEGLYLATVADDRLLRIWALELKA-PV--AFAPMTNGL----CCTFFPHGGIIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTT 383          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Mouse
Match: Gnb2 (guanine nucleotide binding protein (G protein), beta 2 [Source:MGI Symbol;Acc:MGI:95784])

HSP 1 Score: 54.299 bits (129), Expect = 2.348e-7
Identity = 55/229 (24.02%), Postives = 101/229 (44.10%), Query Frame = 2
Query:  512 KLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIY--QSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFN 1192
            +  L  H   +  + +  D  L L S S DGKL +WD +   N   +I + +S+  + CA+      +  GG    C IY  ++ +  + V+     H   +S C++  D+ ++ TSS DT+  +W            +TG + ++ F G  H+  +   + +PD    VS + D  I++W++ D+          F G +  ++ V F P+G      + D     F+
Sbjct:   90 RRTLRGHLAKIYAMHWGTDSRL-LVSASQDGKLIIWDSYTT-NKVHAIPLRSSWVMT-CAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQII-TSSGDTTCALWDI----------ETG-QQTVGFAG--HSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDS-----MCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFD 296          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Mouse
Match: Gnb2 (guanine nucleotide binding protein (G protein), beta 2 [Source:MGI Symbol;Acc:MGI:95784])

HSP 1 Score: 53.9138 bits (128), Expect = 2.419e-7
Identity = 55/229 (24.02%), Postives = 101/229 (44.10%), Query Frame = 2
Query:  512 KLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIY--QSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFN 1192
            +  L  H   +  + +  D  L L S S DGKL +WD +   N   +I + +S+  + CA+      +  GG    C IY  ++ +  + V+     H   +S C++  D+ ++ TSS DT+  +W            +TG + ++ F G  H+  +   + +PD    VS + D  I++W++ D+          F G +  ++ V F P+G      + D     F+
Sbjct:   48 RRTLRGHLAKIYAMHWGTDSRL-LVSASQDGKLIIWDSYTT-NKVHAIPLRSSWVMT-CAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQII-TSSGDTTCALWDI----------ETG-QQTVGFAG--HSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDS-----MCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFD 254          
BLAST of WD repeat and SOCS box-containing 1 vs. UniProt/SwissProt
Match: sp|Q6P1V3|WSB1_XENTR (WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis OX=8364 GN=wsb1 PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 3.179e-36
Identity = 109/384 (28.39%), Postives = 184/384 (47.92%), Query Frame = 2
Query:  146 AISSCGYYLAFNSDSQTLKIV----CLKSIRSTKLDKNETNLNDCLPILFESKMGSQ-------IRCLDFGRGNVSNNRLPHRSSK----RRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKL 1252
            A +  G Y A++   + +K+V    CLK+  +    KN  NL +       S +G +       I C D        + +P + S+        +    +  LLA GL +G++KI+ +                G   L L +H E +  ++F+ DGSL L S S D  L +WD+ DDGNM K ++  +     CCA+   S  +C  G+     ++  +K   M+  L   HYND+ AC++S D +LL T+S+DT + +W       + +       P+ IF GG + ++++  +FS D V++ S++DDN++R W + D + PV+    P + + L   C  F+ DG+     T DG   F+++     SL  LCR ++R  +
Sbjct:   41 AFAPDGSYFAWSQGHRIVKLVPWSRCLKNFTACST-KNGVNLTNGRLSRQNSDLGQRNKPIEHTIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFKFGQDQLLLATGLSNGRIKIWDVYT--------------GKLLLNLMDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMK-VLRGHQNWVYCCAFSPDSSMLCSVGAGKAVFLWDMDK-YTMIRKL-DGHYNDVVACEFSPDGALLATASYDTRVYVWDPHIGSILFEFGHLFPPPTPIFAGGDNGRWVKSVSFSHDGVHIASLADDNLVRFWRI-DKSYPVE--VAPLS-KGL---CCAFSTDGSVLAAGTQDGNAYFWSTPKYVSSLQHLCRMAIRRVM 399          
BLAST of WD repeat and SOCS box-containing 1 vs. UniProt/SwissProt
Match: sp|Q7T2F6|WSB1_DANRE (WD repeat and SOCS box-containing protein 1 OS=Danio rerio OX=7955 GN=wsb1 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 4.624e-36
Identity = 109/387 (28.17%), Postives = 183/387 (47.29%), Query Frame = 2
Query:  146 AISSCGYYLAFNSDSQTLKIV----CLKSIRSTKLDKNE-------TNLNDCLPILFESKMGSQIRCLDFGRGNVSNNRLPHRSSK----RRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQ 1261
            A +  G Y A++   + +++V    CL S    K D++        +  N    +L        I C D   G    + +P + S+        +    +  LLA GL +G++KI+ +                G   L L +H + +  ++F+ DGSL L S S D  L +WD+ DDGNM K ++  +     C A+   S  +C  G+     ++  +K  L+     + H+ND+  C++S D +LL T+S+DT +++W   T   +L++      PS IF GGA+++++R  AF  D  ++ SV+DD ++R W++ D  SP  Q   P T       C  F+ DG+     + DG V F+ S  +  SL  LCR ++R  +  Q
Sbjct:   41 AFAPDGSYFAWSQGHRIVRLVPWKKCLASFSVRKEDRSSGAGPRRLSRQNSEGSLLPGEPREHTIDCGDIVWGLAFGSSVPEKQSRCVNIEWHRFKFGQDQLLLATGLNNGRIKIWDVYT--------------GKLLLNLMDHTDIVRDLTFAPDGSLVLVSASRDKTLRVWDLKDDGNMVK-VLRGHQNWVYCSAFSPDSSVLCSVGAGKAVFLWDMDKYTLIRKL--EGHHNDVVCCEFSPDGALLATASYDTRVIVWDPHTATVLLELGHLFPPPSPIFAGGANDRWVRSVAFCHDGRHIASVTDDRLVRFWSI-DEKSP--QAIGPLTNGL----CCAFSTDGSVLSAGSRDGSVHFWASPRSIASLQHLCRMTLRRVMPTQ 403          
BLAST of WD repeat and SOCS box-containing 1 vs. UniProt/SwissProt
Match: sp|O54927|WSB1_MOUSE (WD repeat and SOCS box-containing protein 1 OS=Mus musculus OX=10090 GN=Wsb1 PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 7.885e-35
Identity = 109/387 (28.17%), Postives = 183/387 (47.29%), Query Frame = 2
Query:  146 AISSCGYYLAFNSDSQTLKIVCLKSIRSTKL---DKNETNLNDCLPILFESKMGSQ--------IRCLDFGRGNVSNNRLPHRSSK----RRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQ 1261
            A +  G Y A++   + +K+V     R   L    KN TN + CL +  ++  G Q        I C D        + +P + S+        +    +  LLA GL +G++KI+ +                G   L L +H E +  ++F+ DGSL L S S D  L +WD+ DDGNM K +    ++  S CA+      +C  G+     ++  +K   M+  L + H++D+ AC +S D +LL T+S+DT + +W       +++       P+ IF GGA+++++R  +FS D +++ S++DD ++R W + D   PV Q+     G      C  F+ DG+     T DG V F+ +     SL  +CR S+R  +  Q
Sbjct:   41 AFAPDGSYFAWSQGYRIVKLVPWSQCRKNFLLHGSKNVTN-SSCLKLARQNSNGGQKNKPPEHVIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYT--------------GKLLLNLVDHIEMVRDLTFAPDGSLLLVSASRDKTLRVWDLKDDGNMVKVLRAHQNWVYS-CAFSPDCSMLCSVGASKAVFLWNMDK-YTMIRKL-EGHHHDVVACDFSPDGALLATASYDTRVYVWDPHNGDLLMEFGHLFPSPTPIFAGGANDRWVRAVSFSHDGLHVASLADDKMVRFWRI-DEDCPV-QVAPLSNGL-----CCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHICRMSIRRVMSTQ 402          
BLAST of WD repeat and SOCS box-containing 1 vs. UniProt/SwissProt
Match: sp|Q9Y6I7|WSB1_HUMAN (WD repeat and SOCS box-containing protein 1 OS=Homo sapiens OX=9606 GN=WSB1 PE=1 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 2.654e-34
Identity = 113/390 (28.97%), Postives = 188/390 (48.21%), Query Frame = 2
Query:  146 AISSCGYYLAFNSDSQTLKIV----CLKS--IRSTKLDKNETNLNDCLPILFESKMGSQ--------IRCLDFGRGNVSNNRLPHRSSK----RRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQ 1261
            A +  G Y A++   +T+K+V    CL++  +  TK   N ++L   LP   ++  G Q        I C D        + +P + S+        +    +  LLA GL +G++KI+ +                G   L L +H E +  ++F+ DGSL L S S D  L +WD+ DDGNM K +    ++  S CA+   S  +C  G+     ++  +K   M+  L + H++D+ AC +S D +LL T+S+DT + IW       +++       P+ IF GGA+++++R  +FS D +++ S++DD ++R W + D   PV Q+     G      C  F+ DG+     T DG V F+ +     SL  LCR S+R  +  Q
Sbjct:   41 AFAPDGSYFAWSQGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLR--LPR--QNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVY--------------TGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYS-CAFSPDSSMLCSVGASKAVFLWNMDK-YTMIRKL-EGHHHDVVACDFSPDGALLATASYDTRVYIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHVASLADDKMVRFWRI-DEDYPV-QVAPLSNGL-----CCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHLCRMSIRRVMPTQ 402          
BLAST of WD repeat and SOCS box-containing 1 vs. UniProt/SwissProt
Match: sp|Q9W5Z5|WSB1_TAKRU (WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes OX=31033 GN=wsb1 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.890e-33
Identity = 88/285 (30.88%), Postives = 147/285 (51.58%), Query Frame = 2
Query:  407 LLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQ 1261
            LLA GL +G++KI+ +                G   L L +H + +  ++F+ DGSL L S S D KL +WD+ DDGNM K ++  +  R    A+   S  +C  G+     ++  +K  L+     + H+ND+ +C++S D +LL T+S+DT +++W       +L++      PS IF GGA+++++R  +F  D  ++ SVSDD ++R W++E+ A P    ++P         C  F+  G+     T DG V F+    +  SL  LCR ++R     Q
Sbjct:  147 LLATGLNNGRIKIWDVYT--------------GTLLLNLMDHTDIVRDLTFAPDGSLMLVSASTDKKLRVWDLKDDGNMVK-VLWGHPNRVYSSAFSPDSSVLCSVGASKAVLLWNMDKYTLIRKL--EGHHNDVVSCEFSPDGALLATASYDTRVIVWDHQRGSILLELGHLFPPPSPIFAGGANDRWVRSVSFCADGRHIASVSDDRLVRFWSIEERA-PQAVASLPNG------LCCAFSTTGSVLAAGTCDGSVHFWECPRSIASLQHLCRMALRRVKTTQ 407          
BLAST of WD repeat and SOCS box-containing 1 vs. TrEMBL
Match: A0A504YKW7 (WD repeat and SOCS box-containing protein 1 OS=Fasciola gigantica OX=46835 GN=FGIG_08971 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.096e-51
Identity = 134/445 (30.11%), Postives = 209/445 (46.97%), Query Frame = 2
Query:  104 LTYTTSSKTPIVACAISSCGYYLAFNSDSQTLKIV---------CLKSIR---------------------STKLDKNETNLNDCLPI----LFESKMGSQIRCLDFGRGNVSNNRLPHRSSKRRITYPVMDNAC--LLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRP------SCC-----------AWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVD---QITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQLHN 1270
            + Y    +  + +CA S CG Y AF  +S  + +V         C    R                     S ++  +E    D +PI    +   ++   I+ + F  G++S+ RLPHRS KR     V+  +C  L+ +GL +G  ++Y+L        S   V       L+L      +  +S + D SLR+AS+   G + LWD+WDDGNMY ++    +F P      SC            AW      IC+ G  G   I QSEKP  ++A L   HY+ IS   YS D S+L T+S+D+S V+WC   Y P+   W  G  PSL+ +GGA+  ++   A +PD ++  ++ +D  +R+W L    SP     ++ +   GR L L  V ++P G    V TSD +VL F +++   SL+V C + +R ++   L N
Sbjct:   10 VAYEPYERYNVPSCAFSKCGNYFAF-VESPCVAVVYPVGPFMKACFADFRVSMFPCDSPDPPNIFSSNLRRSWRIVTSELLGGDSVPIDIRPMCRIEVNGAIQHIAFALGDISHCRLPHRSQKRMSR--VLHGSCVSLILLGLVTGYTEVYNL--------SDITVSGSRVPSLVLFADNLPIYLLSVASDASLRVASVHRSGDVKLWDLWDDGNMYANLKEKFAFPPTSSDTLSCSLERIYGEACTFAWQPNGIHICMAGQKGYGVILQSEKPFTLIAILRSGHYHRISCAVYSHDSSMLVTASYDSSCVVWCVPEYAPLFHFWHMGRVPSLLLLGGANGHHLYGVAVAPDNLHFTTICEDRCVRLWPLAAATSPTKTYYELALSTPGR-LKLRSVSYSPCGRLIAVTTSDNRVLLFTTESQVLSLTVQCVRVIRSRITRYLIN 442          
BLAST of WD repeat and SOCS box-containing 1 vs. TrEMBL
Match: G7YP22 (WD repeat and SOCS box-containing protein 1 OS=Clonorchis sinensis OX=79923 GN=CLF_105000 PE=4 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 7.855e-51
Identity = 132/444 (29.73%), Postives = 207/444 (46.62%), Query Frame = 2
Query:   77 VSKIFMQNYLTYTTSSKTPIVACAISSCGYYLAFNSDSQTLKI--------VCLKSIR---------------------------STKLDKNETNLNDCLPILFESKMGSQIRCLDFGRGNVSNNRLPHRSSKRRITYPVMDNA--CLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSI----IIPNS-------FRPSCC--AWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPV----DQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVRE 1246
            +  + ++  + Y ++ +  + +C  S CG Y AF      + +         C  +I                            S++L   ++   D  P+      G  ++CL F  G+ S  RLPHRS KRR    V+ N+   L+ +GL +G  ++Y+L      D + P+        L+L      +  +  + D SLR+AS+ + G + LWD+WDDGNMY ++    + P+         R   C  AW      IC+ G  G   +  SEKP   VATL   HYN ISA  Y+ D SLL T+++D+S V+W    Y P+   W  G  PSL+ +GGA+  ++ D   SPD ++ +++ +D  +R+W L    SPV    +      TG K  L CV F+P G    V TSD +VLFF + +   +L+  C + +R 
Sbjct:   25 IESVPLRLAVAYESNERYNVTSCQFSPCGEYFAFVQSPYVVAVYPVEKLMSFCFMNIPISMPESYNPTGPLTREAPGTPTPWRVLSSELLSGDSVRVDLQPVCRIEAQGV-VQCLAFAHGDCSRCRLPHRSVKRRSV--VLQNSFVSLILIGLVTGYTEVYNLC-----DITLPMARI---PSLVLFADNLPIYRLYVATDDSLRIASVQLGGDVKLWDLWDDGNMYANLKSKFVFPSPDETARDMIRGEACTFAWQPHGSHICLAGQRGYGVVLMSEKPFGRVATLRSGHYNRISAATYTHDASLLITAAYDSSCVVWSVPEYAPLHHYWHMGRVPSLLLVGGANGHHLYDLCMSPDDLHFLTICEDRCVRLWPLAPNTSPVKTYYELALTQSTGPK--LRCVTFSPCGRLISVTTSDNRVLFFTTPSQLVTLTTQCLRVLRR 455          
BLAST of WD repeat and SOCS box-containing 1 vs. TrEMBL
Match: A0A419PFW6 (WD repeat and SOCS box-containing protein 1 OS=Clonorchis sinensis OX=79923 GN=wsb1 PE=4 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 8.613e-51
Identity = 132/444 (29.73%), Postives = 207/444 (46.62%), Query Frame = 2
Query:   77 VSKIFMQNYLTYTTSSKTPIVACAISSCGYYLAFNSDSQTLKI--------VCLKSIR---------------------------STKLDKNETNLNDCLPILFESKMGSQIRCLDFGRGNVSNNRLPHRSSKRRITYPVMDNA--CLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSI----IIPNS-------FRPSCC--AWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPV----DQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVRE 1246
            +  + ++  + Y ++ +  + +C  S CG Y AF      + +         C  +I                            S++L   ++   D  P+      G  ++CL F  G+ S  RLPHRS KRR    V+ N+   L+ +GL +G  ++Y+L      D + P+        L+L      +  +  + D SLR+AS+ + G + LWD+WDDGNMY ++    + P+         R   C  AW      IC+ G  G   +  SEKP   VATL   HYN ISA  Y+ D SLL T+++D+S V+W    Y P+   W  G  PSL+ +GGA+  ++ D   SPD ++ +++ +D  +R+W L    SPV    +      TG K  L CV F+P G    V TSD +VLFF + +   +L+  C + +R 
Sbjct:   25 IESVPLRLAVAYESNERYNVTSCQFSPCGEYFAFVQSPYVVAVYPVEKLMSFCFMNIPISMPESHNPTGPLTREAPGTPTPWRVLSSELLSGDSVRVDLQPVCRIEAQGV-VQCLAFAHGDCSRCRLPHRSVKRRSV--VLQNSFVSLILIGLVTGYTEVYNLC-----DITLPMARI---PSLVLFADNLPIYRLYVATDDSLRIASVQLGGDVKLWDLWDDGNMYANLKSKFVFPSPDETARDMIRGEACTFAWQPHGSHICLAGQRGYGVVLMSEKPFGRVATLRSGHYNRISAATYTHDASLLITAAYDSSCVVWSVPEYAPLHHYWHMGRVPSLLLVGGANGHHLYDLCMSPDDLHFLTICEDRCVRLWPLAPNTSPVKTYYELALTQSTGPK--LRCVTFSPCGRLISVTTSDNRVLFFTTPSQLVTLTTQCLRVLRR 455          
BLAST of WD repeat and SOCS box-containing 1 vs. TrEMBL
Match: A0A075AJ34 (WD_REPEATS_REGION domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_01366 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.838e-50
Identity = 131/442 (29.64%), Postives = 203/442 (45.93%), Query Frame = 2
Query:   77 VSKIFMQNYLTYTTSSKTPIVACAISSCGYYLAFNSDS--------QTLKIVCLKSIR---------------------------STKLDKNETNLNDCLPILFESKMGSQIRCLDFGRGNVSNNRLPHRSSKRRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSI----IIPNS-------FRPSCC--AWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPV----DQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVRE 1246
            +  + ++  + Y ++ +  + +C  S CG Y AF            + L   C  SI                            S++L   ++   D  P+      G  ++CL F  G+ S  RLPHRS KRR          L+ +GL +G  ++Y+L      D + P+        L+L      +  +  + D SLR+AS+ + G + LWD+WDDGNMY ++    + P+         R   C  AW      IC+ G  G   +  SEKP   VATL   H+N ISA  Y+ D SLL T+++D+S V+W    Y P+   W  G  PSL+ +GGA+  ++ D   SPD ++ +++ +D  +R+W L    SPV    +      TG K  L CV F+P G    V TSD +VLFF + +   +L+  C + +R 
Sbjct:   25 IESVPLRLAVAYESNERYNVTSCQFSPCGEYFAFVQSPCVVAVYPVEKLMSFCFMSIPVSMPESYNPTGPLTSEAPGTPTPWRVLSSELLSGDSVRVDLQPVCRIEAQGV-VQCLAFAHGDCSRCRLPHRSVKRRSVVLQNSFVSLILIGLITGYTEVYNLC-----DITLPIARI---PSLVLFADNLPIYRLCVATDDSLRVASVQLGGDVKLWDLWDDGNMYANLKSKFVFPSPDETARDMIRGEACTFAWQPHGSHICLAGQRGYGVVLMSEKPFGRVATLRSGHFNRISAATYTHDASLLITAAYDSSCVVWSVPEYAPLHHYWHMGRVPSLLLVGGANGHHLYDLCMSPDDLHFLTICEDRCVRLWPLAPNTSPVKTYYELALTQSTGPK--LRCVSFSPCGRLISVTTSDNRVLFFTTPSQLATLTTQCLRVLRR 455          
BLAST of WD repeat and SOCS box-containing 1 vs. TrEMBL
Match: A0A1S8WUA9 (WD domain, G-beta repeat protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_06033 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 2.335e-50
Identity = 131/442 (29.64%), Postives = 203/442 (45.93%), Query Frame = 2
Query:   77 VSKIFMQNYLTYTTSSKTPIVACAISSCGYYLAFNSDS--------QTLKIVCLKSIR---------------------------STKLDKNETNLNDCLPILFESKMGSQIRCLDFGRGNVSNNRLPHRSSKRRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSI----IIPNS-------FRPSCC--AWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPV----DQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVRE 1246
            +  + ++  + Y ++ +  + +C  S CG Y AF            + L   C  SI                            S++L   ++   D  P+      G  ++CL F  G+ S  RLPHRS KRR          L+ +GL +G  ++Y+L      D + P+        L+L      +  +  + D SLR+AS+ + G + LWD+WDDGNMY ++    + P+         R   C  AW      IC+ G  G   +  SEKP   VATL   H+N ISA  Y+ D SLL T+++D+S V+W    Y P+   W  G  PSL+ +GGA+  ++ D   SPD ++ +++ +D  +R+W L    SPV    +      TG K  L CV F+P G    V TSD +VLFF + +   +L+  C + +R 
Sbjct:    1 IESVPLRLAVAYESNERYNVTSCQFSPCGEYFAFVQSPCVVAVYPVEKLMSFCFMSIPVSMPESYNPTGPLTSEAPGTPTPWRVLSSELLSGDSVRVDLQPVCRIEAQGV-VQCLAFAHGDCSRCRLPHRSVKRRSVVLQNSFVSLILIGLITGYTEVYNLC-----DITLPIARI---PSLVLFADNLPIYRLCVATDDSLRVASVQLGGDVKLWDLWDDGNMYANLKSKFVFPSPDETARDMIRGEACTFAWQPHGSHICLAGQRGYGVVLMSEKPFGRVATLRSGHFNRISAATYTHDASLLITAAYDSSCVVWSVPEYAPLHHYWHMGRVPSLLLVGGANGHHLYDLCMSPDDLHFLTICEDRCVRLWPLAPNTSPVKTYYELALTQSTGPK--LRCVSFSPCGRLISVTTSDNRVLFFTTPSQLATLTTQCLRVLRR 431          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Cavefish
Match: wsb1 (WD repeat and SOCS box containing 1 [Source:NCBI gene;Acc:103046821])

HSP 1 Score: 137.117 bits (344), Expect = 4.797e-35
Identity = 109/392 (27.81%), Postives = 184/392 (46.94%), Query Frame = 2
Query:  146 AISSCGYYLAFNSDSQTLKIV----CLKSIRSTKLDKNETNLNDCLPILFESKMGSQ------------IRCLDFGRGNVSNNRLPHRSSK----RRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQ 1261
            A +  G Y A++   + +++V    C+K+    K    E  +N   P    S+ GS             I C D   G    + +P + S+        +    +  LLA GL +G++KI+                  G   L L +H + +  ++F+ DGSL L S S D  L +WD+ DDGNM K ++  +     C A+   S  +C  G+     ++  +K   M+  L + H+ND+ +C++S D +LL T+S+DT +++W       +L++      PS IF GGA+++++R  AF  D  ++ S++DD ++R W++ D  SP  Q     T       C  F+ DG+     + DG V F++   +  SL  LCR ++R  L  Q
Sbjct:   41 AFAPDGSYFAWSQGHRIVRLVPWSKCIKNFSMRK----EERINGAGPRRL-SRQGSDVALVPGEPREHTIDCGDIVWGLAFGSSVPEKQSRCVNIEWHRFKFGQDQLLLATGLNNGRIKIWDAYT--------------GKLLLNLMDHTDIVRDLTFAPDGSLVLVSASRDKTLRVWDLKDDGNMVK-VLRGHQNWVYCSAFSPDSSVLCSVGAGKSVFLWNMDK-YTMIRKL-EGHHNDVVSCEFSPDGALLATASYDTRVIVWDPHMGTVLLELGHLFPPPSPIFAGGANDRWVRSVAFCHDGQHIASITDDRLVRFWSI-DEKSP--QAVASLTNGL----CCAFSTDGSVLAAGSRDGSVHFWSCPRSISSLQHLCRMALRRVLTTQ 403          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Cavefish
Match: wsb1 (WD repeat and SOCS box containing 1 [Source:NCBI gene;Acc:103046821])

HSP 1 Score: 135.961 bits (341), Expect = 1.147e-34
Identity = 102/387 (26.36%), Postives = 182/387 (47.03%), Query Frame = 2
Query:  146 AISSCGYYLAFNSDSQTLKIV-----------CLKSIRSTKLDKNETNLNDCLPILFESKMGSQIRCLDFGRGNVSNNRLPHRSSK----RRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQ 1261
            A +  G Y A++   + +++V           C +++ S+   +  +     + ++        I C D   G    + +P + S+        +    +  LLA GL +G++KI+                  G   L L +H + +  ++F+ DGSL L S S D  L +WD+ DDGNM K ++  +     C A+   S  +C  G+     ++  +K   M+  L + H+ND+ +C++S D +LL T+S+DT +++W       +L++      PS IF GGA+++++R  AF  D  ++ S++DD ++R W++ D  SP  Q     T       C  F+ DG+     + DG V F++   +  SL  LCR ++R  L  Q
Sbjct:   42 AFAPDGSYFAWSQGHRIVRLVPWSKCIKNFEHCTRTLSSSAGPRRLSRQGSDVALVPGEPREHTIDCGDIVWGLAFGSSVPEKQSRCVNIEWHRFKFGQDQLLLATGLNNGRIKIWDAYT--------------GKLLLNLMDHTDIVRDLTFAPDGSLVLVSASRDKTLRVWDLKDDGNMVK-VLRGHQNWVYCSAFSPDSSVLCSVGAGKSVFLWNMDK-YTMIRKL-EGHHNDVVSCEFSPDGALLATASYDTRVIVWDPHMGTVLLELGHLFPPPSPIFAGGANDRWVRSVAFCHDGQHIASITDDRLVRFWSI-DEKSP--QAVASLTNGL----CCAFSTDGSVLAAGSRDGSVHFWSCPRSISSLQHLCRMALRRVLTTQ 404          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Cavefish
Match: wsb2 (WD repeat and SOCS box-containing protein 2 [Source:NCBI gene;Acc:103039404])

HSP 1 Score: 63.5438 bits (153), Expect = 1.934e-10
Identity = 69/291 (23.71%), Postives = 119/291 (40.89%), Query Frame = 2
Query:  407 LLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLM--LHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGA------HNKYIRDFAFSPDCVNL-VSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKL 1252
            LLA GL +G +K++             LV  G   +LM  L  H   +  ++F+ +GSL L S S D  L +WD+   G     +  P ++   C    + S    V     K +++ S +   ++  L   H   + +C +S D +LL   SF ++   W        L +W       L  +          +  +   +FSP  VNL ++  D   +++W++E      D++ +     ++   C  F P G+       DG V F+       SL  LCR ++R  +
Sbjct:  123 LLATGLTNGVIKVW-------------LVSTG---RLMFSLTGHTSVVRDLAFAPNGSLTLVSASRDKTLRVWDLSKKGTPSHVLTGPKNWVFKCSISPDSSMMASVCNLDSKAYLW-SMRSYTLIRNLKYDHERTMVSCDFSLDGALLAIGSFHSTTGWW--------LDLWDPYTADQLTRVEDCDVCVYRKDNLLTALSFSP--VNLQLAFKDYRALQVWDMEQ-----DKLVLEADHNRVSGLCCAFHPQGSAIATGCRDGHVKFWRVPRLVPSLRNLCRTALRHSV 381          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Cavefish
Match: gnb2 (guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 [Source:NCBI gene;Acc:103031762])

HSP 1 Score: 58.9214 bits (141), Expect = 4.716e-9
Identity = 60/241 (24.90%), Postives = 106/241 (43.98%), Query Frame = 2
Query:  476 GSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIY--QSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFN 1192
            G  P+       +  L  H   +  + +  D  L L S S DGKL +WD +    M+ +I + +S+  +C A+      +  GG    C IY  ++ +  + V+     H   +S C++  D+ ++ TSS DT+  +W            +TG + +L F G  H+  +   + SPD    VS + D  I++W++ D+          FTG +  ++ V F P G+     + D     F+
Sbjct:   36 GLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRL-LVSASQDGKLIIWDSYTTNKMH-AIPLRSSWVMTC-AYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFIDDNQII-TSSGDTACALWDV----------ETGQQITL-FSG--HSGDVMSLSLSPDSRTFVSGACDASIKLWDIRDS-----MCRQTFTGHESDINAVCFFPSGSAFATGSDDATCRLFD 254          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Cavefish
Match: gnb2 (guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 [Source:NCBI gene;Acc:103031762])

HSP 1 Score: 58.5362 bits (140), Expect = 5.450e-9
Identity = 60/241 (24.90%), Postives = 106/241 (43.98%), Query Frame = 2
Query:  476 GSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIY--QSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFN 1192
            G  P+       +  L  H   +  + +  D  L L S S DGKL +WD +    M+ +I + +S+  +C A+      +  GG    C IY  ++ +  + V+     H   +S C++  D+ ++ TSS DT+  +W            +TG + +L F G  H+  +   + SPD    VS + D  I++W++ D+          FTG +  ++ V F P G+     + D     F+
Sbjct:   23 GLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRL-LVSASQDGKLIIWDSYTTNKMH-AIPLRSSWVMTC-AYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFIDDNQII-TSSGDTACALWDV----------ETGQQITL-FSG--HSGDVMSLSLSPDSRTFVSGACDASIKLWDIRDS-----MCRQTFTGHESDINAVCFFPSGSAFATGSDDATCRLFD 241          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Sea Lamprey
Match: wsb2 (WD repeat and SOCS box containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-26])

HSP 1 Score: 134.035 bits (336), Expect = 1.275e-34
Identity = 87/284 (30.63%), Postives = 141/284 (49.65%), Query Frame = 2
Query:  395 DNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVRE 1246
            D+A +LA GL SG++KI+ +    +               L L +H   +  ++F+ DGSL L S S D  L +WD+ DDGNM K ++  +    +  A+   +  +C  G+     +++ E   L+     + H ND+ AC++S D +LL T+S DT  ++W   T   +         PS IF GGA+  ++R  AFS D +++ S++DD ++R W++ D ++PV    VP         C  F+P+G   L    DG V  + +      L  LCR S+R 
Sbjct:  147 DDALVLATGLASGRIKIWDVFTGKFL--------------LYLMDHTAIVQDLTFAPDGSLMLVSASRDKTLRVWDLKDDGNMVK-VLKGHHKWVNASAFSLDASMLCSVGAGKSVLLWEMEHFTLL--RRLEGHLNDVVACEFSPDGALLATASHDTRCILWDPYTGTAVASFGHLFPAPSPIFAGGANYHWVRAVAFSRDGLHVASLADDGLLRFWHVGDDSAPVAVANVPNG------QCCAFSPNGHVLLAGRQDGGVGVWAAPRDVGPLQHLCRMSLRR 407          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Sea Lamprey
Match: mlst8 (MTOR associated protein, LST8 homolog (S. cerevisiae) [Source:NCBI gene;Acc:792689])

HSP 1 Score: 55.8398 bits (133), Expect = 8.823e-9
Identity = 42/183 (22.95%), Postives = 78/183 (42.62%), Query Frame = 2
Query:  602 GKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQ-----SEKPCLMVATLA-QVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKF 1132
            G + +WD+  D N  + +I       +C      +  +    S G+C+++       E+P  ++       H      C++S D +LL T S D +  IW    +  + ++      P+    G     ++ D AFS D   +V+ S DN  R+W++E       +I   +TG +  + C+ F
Sbjct:  152 GAIHIWDLKTDQN--EQLIPEQDVAMNCVHIDPDASYMAAVNSTGQCYVWNLTGGVREQPTHLIPKFKISAHKTYALKCRFSPDSTLLATCSSDQTCTIWRTANFTMLTELSIRSSNPAESSRG-----WMWDCAFSGDSQYMVTASSDNTARLWSVE-----TGEIKREYTGHQKAVVCLAF 322          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Sea Lamprey
Match: taf5l (TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor [Source:ZFIN;Acc:ZDB-GENE-030131-5987])

HSP 1 Score: 55.8398 bits (133), Expect = 1.742e-8
Identity = 34/137 (24.82%), Postives = 62/137 (45.26%), Query Frame = 2
Query:  797 HYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTA 1207
            H +D++  ++  + S + T S D ++ +W A          Q G   + +F G  H   +   AFSP    L S  +D  +R+W++   A     I     G    ++C+ F+PDG+     +SDG V  ++ +  +
Sbjct:  426 HVSDVNVVRFHPNGSYVATGSADRTVRLWSA----------QQG-SAARLFTG--HRGAVLALAFSPGGRLLASGGEDQRVRLWDIGSGA-----IVKELRGHSDDITCLSFSPDGSALASGSSDGSVRVWDVRGAS 544          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Sea Lamprey
Match: wdsub1 (WD repeat, sterile alpha motif and U-box domain containing 1 [Source:NCBI gene;Acc:777721])

HSP 1 Score: 51.2174 bits (121), Expect = 3.945e-7
Identity = 27/99 (27.27%), Postives = 48/99 (48.48%), Query Frame = 2
Query:  767 CLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDT 1063
            CL +    + H   +  C +SSD  +L + S D S+++W   T + +L I +             H +Y+   AF+P    L++ S D  +++W LE+T
Sbjct:  249 CLTLRFCLEGHTAPVLCCCFSSDGHVLASGSVDKSVILWNPITGEKLLSIME-------------HQRYVTSCAFTPGAPYLITGSMDKTVKLWRLENT 334          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 49.2914 bits (116), Expect = 1.534e-6
Identity = 53/230 (23.04%), Postives = 94/230 (40.87%), Query Frame = 2
Query:  530 HYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMY-----KSIIIPNSFRPS----CCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFN 1192
            H + + +V F+ +   +LAS S+D  L +W+       Y     K  ++   F PS      A  +K+ ++ V    G+  ++++             H   + +  +S+D   L T+S D SI +W     K +  + Q             H+ ++R   FSPD   +VS SDD  +R+W+     S   +    F      ++ V F P GT      +D  V  ++
Sbjct:   17 HRDTITSVDFNPNMK-QLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKA-------------HTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQ-------------HSNWVRSAKFSPDGRLIVSGSDDRTVRVWD-----SNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWD 214          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Yeast
Match: PFS2 (Integral subunit of the pre-mRNA CPF complex; the cleavage and polyadenylation factor (CPF) complex plays an essential role in mRNA 3'-end formation by bridging different processing factors and thereby promoting the assembly of the processing complex [Source:SGD;Acc:S000005261])

HSP 1 Score: 53.5286 bits (127), Expect = 5.016e-8
Identity = 32/123 (26.02%), Postives = 56/123 (45.53%), Query Frame = 2
Query:  692 WGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLED 1060
            W  + +++ V    G+  ++ +        TL Q H + ++  KYS D   +             +G    M++IWQ      +  +  AH + IRD AFS +    V+ SDDNI+++WN  +
Sbjct:  101 WTPEGRRLVVATYSGEFSLWNAS--SFTFETLMQAHDSAVTTMKYSHDSDWM------------ISGDADGMIKIWQPNFS-MVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSN 208          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Nematostella
Match: EDO44795 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR9])

HSP 1 Score: 60.4622 bits (145), Expect = 3.203e-10
Identity = 55/212 (25.94%), Postives = 97/212 (45.75%), Query Frame = 2
Query:  521 LHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQ-SEKPCLMVATLAQV---HYNDISACKYSSDDSLLGTSSFDTSIVIW-CAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPD 1141
            L  H + + +++FS +G  RL S+++D KL +WD+ + GN+  ++   + + P C  +      +   G+     I+  S   C M  T+  +   H + +    +SSD +LL + S D ++ +W CA   K         LK +       H++     A+S D + L S SDD  +R+W +E  A           G +  +  V F+PD
Sbjct:   67 LEGHEDRVTSLAFSKNGK-RLVSVALDKKLKVWDV-ESGNLLDTLTGHDGY-PVCLDFSPDGMLLASTGADSNVIIWDISTARCYMQGTIIALLGGHSDWVMDVAFSSDGALLTSGSRDRTVRVWDCAAAEK---------LKKARF-----HSERCWSVAYSDDGMWLASASDDFKVRLWAVEGYAQ-----VAAMEGHESEIRVVSFSPD 256          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Nematostella
Match: EDO30150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1K6])

HSP 1 Score: 58.5362 bits (140), Expect = 2.063e-9
Identity = 44/184 (23.91%), Postives = 84/184 (45.65%), Query Frame = 2
Query:  602 GKLCLWDMWDDGNMYKSIIIPNSFRPSCC-AWGNKSKQICVGGSIGKCHIYQ-----SEKPCLM-VATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKF 1132
            G + +WD+  D N     +IP++  P    +   ++  +    + G C+++      ++ P ++   T  + H      C++S D  LL T+S DT++ IW    +          LK +L        +++ D AFS D   LV+ S DN+ R+WN+E       ++   ++G +  + C+ F
Sbjct:  158 GAIHMWDLRTDHN---EQLIPDANSPVLSLSIDREASYMAAVNNKGNCYVWTLSGGTNDDPTMLHPKTKVEAHKRYALKCQFSPDSCLLATTSADTTVRIWQTADFS---------LKTTL---SDTSQRWVWDCAFSEDSQYLVTASSDNLARLWNVE-----AGEVVREYSGHQKAVVCLAF 321          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Nematostella
Match: EDO40174 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S816])

HSP 1 Score: 56.225 bits (134), Expect = 1.126e-8
Identity = 56/244 (22.95%), Postives = 105/244 (43.03%), Query Frame = 2
Query:  542 MATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQIC---VGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIW--CAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVL-CRKSVREKLV 1255
            + T  FS DG   ++   +D  +C+WD   DG + K +   +    +CC +     +IC   +  +     +   +     V      H N +S C +SSD+ +L T S+D +I +W    G Y+              I +   H   +    F+ D ++LVS S D  + +W+++++            G    ++  +F+ D    L C+ D  V  +N +++ D   VL  RK++  ++V
Sbjct:   63 VTTCHFSSDGKYVVSGNDLDYAVCVWDA-RDGKLIKKLF-NHRNTITCCRFSPLHNRICSTSMDNTTKIVDVRTFDTSSNNVTLSLGGHINIVSTCCFSSDEHMLATGSWDKNIQLWDVATGVYRTQ----------GPITLSKGHEGSVSSCHFTRDGISLVSSSYDETLVIWDVDNSCQK-----FALKGHAGWVNDCRFSDDQNWVLSCSKDKTVRLWNIESSDDIPVVLEHRKNIGLRIV 289          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Nematostella
Match: EDO25777 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVI2])

HSP 1 Score: 48.521 bits (114), Expect = 3.100e-7
Identity = 35/117 (29.91%), Postives = 56/117 (47.86%), Query Frame = 2
Query:  797 HYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSL-IFMGGAHNKYIRDFAFSPDCVN--LVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTP 1138
            H + + +C +S D SLL T+S D  I+IW               ++ ++ +F    H   I    FSPD +N  L S S D  +R+WNLE+ +    +I V    +  + +C +F P
Sbjct:    2 HKSFVESCSFSPDGSLLATASGDEKIIIW--------------NIEQAIELFALQGHRSTIWSCEFSPDSINPLLCSCSSDRTVRVWNLEERS----EIAVMRQHKNTVWTC-RFCP 99          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 51.2174 bits (121), Expect = 5.717e-7
Identity = 60/234 (25.64%), Postives = 98/234 (41.88%), Query Frame = 2
Query:  512 KLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQ-SEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASP------VDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFN 1192
            K  L  H + +++V FS +G   LAS S D  + +W  +D    ++  I  +    S  AW   S+ +          I+  +   CL      + H N +  C ++   +L+ + SFD S+ IW   T K +  +      P       AH+  +    F+ D   +VS S D + R+W   DTAS       +D    P       +S VKF+P+G   L  T D  +  ++
Sbjct:   58 KYTLTGHNKAVSSVKFSHNGEW-LASSSADKVIKIWGAYD--GKFEKTITGHKLGISDVAWSTDSRHLVSASDDKTLKIWDFATGKCLKTL---KGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTL------P-------AHSDPVTAVHFNRDGALIVSSSYDGLCRIW---DTASGQCLKTLIDDDNPP-------VSFVKFSPNGKYILAATLDNTLKLWD 262          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Medaka
Match: wsb1 (WD repeat and SOCS box containing 1 [Source:NCBI gene;Acc:101161074])

HSP 1 Score: 144.05 bits (362), Expect = 2.097e-37
Identity = 109/405 (26.91%), Postives = 184/405 (45.43%), Query Frame = 2
Query:  140 ACAISSCGYYLAFNSDSQTLKIV----CLKSIRSTKLDKNETNLN-----------------DCLPILFESKMGSQIRCLDFGRGNVSNNRLPHRSSK----RRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSI------IIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQ 1261
            + A S  G Y A++   + ++++    CLKS      D+    LN                 D  P       G  +  L FG      + +P + S+        +    N  LLA GL +G++KI+ +                G   L L +H + +  ++F+ DGSL L S S D  L +WD+ DDGNM K +      +  ++F P        S  +C  G+     ++  +K  L+     + H+ND+ +C++S D +LL T+S+DT +++W       +L++      PS IF GGA+++++R  +FSPD  ++ S++DD +IR W++E+ A       + F    L   C  F+ DG      T DG V F+    +  SL  +CR ++R  +  Q
Sbjct:   39 SVAFSPNGSYFAWSQGHRIVRLIPWTKCLKSFSMNHGDEETVALNPWNLSRHNSDRSQTITVDDDPREHTLDCGDIVWSLAFG------SSVPEKESRCVNIEWHHFKFGQNHLLLATGLNNGRIKIWDVYT--------------GKLLLNLMDHTDVVRDLTFAPDGSLMLVSASRDKSLRVWDLKDDGNMVKVLRGHQNWVYSSAFSPD-------SSILCSVGAGKAVFLWNMDKYTLIQKL--EGHHNDVVSCEFSPDGALLATASYDTRVIVWDHHNATILLELGHLFPPPSPIFAGGANDRWVRSVSFSPDGRHIASITDDRLIRFWSIEEKAPQA----IAFLSNGL---CCSFSTDGKVLAAGTRDGSVHFWECPRSIASLQHVCRMALRRIMTTQ 407          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Medaka
Match: wsb1 (WD repeat and SOCS box containing 1 [Source:NCBI gene;Acc:101161074])

HSP 1 Score: 143.665 bits (361), Expect = 2.804e-37
Identity = 109/405 (26.91%), Postives = 184/405 (45.43%), Query Frame = 2
Query:  140 ACAISSCGYYLAFNSDSQTLKIV----CLKSIRSTKLDKNETNLN-----------------DCLPILFESKMGSQIRCLDFGRGNVSNNRLPHRSSK----RRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSI------IIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQ 1261
            + A S  G Y A++   + ++++    CLKS      D+    LN                 D  P       G  +  L FG      + +P + S+        +    N  LLA GL +G++KI+ +                G   L L +H + +  ++F+ DGSL L S S D  L +WD+ DDGNM K +      +  ++F P        S  +C  G+     ++  +K  L+     + H+ND+ +C++S D +LL T+S+DT +++W       +L++      PS IF GGA+++++R  +FSPD  ++ S++DD +IR W++E+ A       + F    L   C  F+ DG      T DG V F+    +  SL  +CR ++R  +  Q
Sbjct:   39 SVAFSPNGSYFAWSQGHRIVRLIPWTKCLKSFSMNHGDEETVALNPWNLSRHNSDRSQTITVDDDPREHTLDCGDIVWSLAFG------SSVPEKESRCVNIEWHHFKFGQNHLLLATGLNNGRIKIWDVYT--------------GKLLLNLMDHTDVVRDLTFAPDGSLMLVSASRDKSLRVWDLKDDGNMVKVLRGHQNWVYSSAFSPD-------SSILCSVGAGKAVFLWNMDKYTLIQKL--EGHHNDVVSCEFSPDGALLATASYDTRVIVWDHHNATILLELGHLFPPPSPIFAGGANDRWVRSVSFSPDGRHIASITDDRLIRFWSIEEKAPQA----IAFLSNGL---CCSFSTDGKVLAAGTRDGSVHFWECPRSIASLQHVCRMALRRIMTTQ 407          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Medaka
Match: wsb2 (WD repeat and SOCS box containing 2 [Source:NCBI gene;Acc:101165065])

HSP 1 Score: 69.3218 bits (168), Expect = 3.696e-12
Identity = 73/293 (24.91%), Postives = 118/293 (40.27%), Query Frame = 2
Query:  407 LLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYN--DISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKY----IRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILS--CVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQ 1261
            LLA GL++G +KI+++L               G+A   L  H   +  + F  +G+L L S S D  L +WD+   G   + +     +  SCC   + S    VG       ++       +       H     +S+C +S D ++L T++F  S      G Y   + +W       L  +    + Y    I    FSP  ++L  V+DD  +R+W       P ++     T R    +  C  + P G      T DG V F+ +  T  SL  LCR ++R  +  Q
Sbjct:  162 LLATGLENGVIKIWNVLT--------------GHAVFDLRGHEGVVRDLVFPQNGTLTLISASRDKTLRIWDLAHKGKKVQVLSGHKDWINSCCVSPDCSMMASVGRFDRMVCLWSLRSYTFIRNLTGGAHKTLCLLSSCDFSPDGAVLATAAFSGS------GWY---IDLWDPYTSEKLATLADYFDVYGKNQISAIQFSPSGLHLAIVTDDRALRIWE------PGERRMTMQTRRDRDSNGLCCNYHPQGGVVATGTRDGHVRFWRAPVTVPSLCHLCRSALRFSVSTQ 425          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Medaka
Match: gnb2 (guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 [Source:NCBI gene;Acc:101175500])

HSP 1 Score: 56.225 bits (134), Expect = 3.534e-8
Identity = 60/257 (23.35%), Postives = 109/257 (42.41%), Query Frame = 2
Query:  476 GSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIY--QSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSV 1240
            G  P+       +  L  H   +  + +  D  L L S S DGKL +WD     N   +I + +S+  +C A+      +  GG    C IY  ++ +  + V+     H   +S C++  D+ ++ TSS DT+  +W   T +            + +F G  H   +   + SPD    VS + D  +++W++ D+          FTG +  ++   F P+G+     + D     F+ +   + LSV C  ++
Sbjct:   36 GLDPVGRIQMRTRRTLRGHLAKIYAMHWGSDSRL-LVSASQDGKLIVWDS-HTTNKIHAIPLRSSWVMTC-AYAPSGNYVACGGLDNICSIYCLKTREGNVRVSRELPGHTGYLSCCRFIDDNQII-TSSGDTTCAMWDIETSQQ-----------TTVFSG--HTGDVMSLSLSPDLRTFVSGACDASVKLWDIRDS-----MCRQTFTGHESDINATCFFPNGSAFATGSDDATCRLFDLRADQE-LSVYCHDNI 269          
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Medaka
Match: ol-gb1 (guanine nucleotide-binding protein beta subunit [Source:NCBI gene;Acc:100049498])

HSP 1 Score: 52.373 bits (124), Expect = 6.226e-7
Identity = 54/229 (23.58%), Postives = 98/229 (42.79%), Query Frame = 2
Query:  512 KLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIY--QSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFN 1192
            +  L  H   +  + +  D  L L S S DGKL +WD +   N   +I + +S+  + CA+      +  GG    C IY  ++ +  + V+     H   +S C++  D+ ++ TSS DTS  +W            +TG + +  F G  H   +   + +PD    VS + D   ++W++ +           FTG +  ++ + F P+G      + D     F+
Sbjct:   48 RRTLRGHLAKIYAMHWGTDSRL-LVSASQDGKLIIWDSYTT-NKVHAIPLRSSWVMT-CAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIV-TSSGDTSCALWDI----------ETG-QQTTTFAG--HTGDVMSLSLAPDTRLFVSGACDASAKLWDIRE-----GMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254          
BLAST of WD repeat and SOCS box-containing 1 vs. Planmine SMEST
Match: SMESG000032294.1 (SMESG000032294.1)

HSP 1 Score: 1007.67 bits (2604), Expect = 0.000e+0
Identity = 486/486 (100.00%), Postives = 486/486 (100.00%), Query Frame = 2
Query:   92 MQNYLTYTTSSKTPIVACAISSCGYYLAFNSDSQTLKIVCLKSIRSTKLDKNETNLNDCLPILFESKMGSQIRCLDFGRGNVSNNRLPHRSSKRRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQLHNLTTNDFNDHQQTEPKPLSLIEMQTPSNRRRSMSDVFSAKENRQSINFNHVVNELPIPGMLKSYLQYGLNSSKLVENIDPRPVRMQSSRNMSIY 1549
            MQNYLTYTTSSKTPIVACAISSCGYYLAFNSDSQTLKIVCLKSIRSTKLDKNETNLNDCLPILFESKMGSQIRCLDFGRGNVSNNRLPHRSSKRRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQLHNLTTNDFNDHQQTEPKPLSLIEMQTPSNRRRSMSDVFSAKENRQSINFNHVVNELPIPGMLKSYLQYGLNSSKLVENIDPRPVRMQSSRNMSIY
Sbjct:    1 MQNYLTYTTSSKTPIVACAISSCGYYLAFNSDSQTLKIVCLKSIRSTKLDKNETNLNDCLPILFESKMGSQIRCLDFGRGNVSNNRLPHRSSKRRITYPVMDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQLHNLTTNDFNDHQQTEPKPLSLIEMQTPSNRRRSMSDVFSAKENRQSINFNHVVNELPIPGMLKSYLQYGLNSSKLVENIDPRPVRMQSSRNMSIY 486          
BLAST of WD repeat and SOCS box-containing 1 vs. Planmine SMEST
Match: SMESG000071620.1 (SMESG000071620.1)

HSP 1 Score: 53.9138 bits (128), Expect = 2.178e-7
Identity = 63/242 (26.03%), Postives = 102/242 (42.15%), Query Frame = 2
Query:  512 KLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNM----YKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLM--VATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMG--GAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADS 1213
            +L+   H +D+ +VS   D  L + S   DGK+ +W + D   +      SI++ N    S C    K K I V  SI  C    S K   +   +  ++ H N IS  + + + SLL T S D ++ +W   +YK             LI  G    H + I    FS     L++ S D +I++W++E      D  +     R +      F  +  + + C SDG ++ +N     DS
Sbjct:  158 QLVHGGHSKDITSVSVFSD-RLHIVSGGKDGKVSIWQVEDSAKLRLKLITSIVVENDIVSSVCV-DRKGKFIYVHYSIEDCLAVLSLKGNKLNRKSCFSKPHSNIISTMEMNINSSLLATGSKDKNVKLW---SYKSK--------SKELIIKGVLKGHKRCISSVKFSDTEQLLLTASLDKVIKLWSVESLTCLQDFKSPTAVHRAM------FYNNEKQIISCHSDGTMIVWNRDTGKDS 380          
BLAST of WD repeat and SOCS box-containing 1 vs. Planmine SMEST
Match: SMESG000008519.1 (SMESG000008519.1)

HSP 1 Score: 52.373 bits (124), Expect = 2.249e-7
Identity = 34/133 (25.56%), Postives = 58/133 (43.61%), Query Frame = 2
Query:  797 HYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNS 1195
            H  +ISA  ++ D + + T+S D SI            +IW   +    +F    H   + D  F      + S   DN +R+W+++D + P    +  F G +  +S V F P GT  L  ++D     +N+
Sbjct:   66 HDAEISAAVFNFDGTYVATASMDKSI------------KIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKP----SFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNT 182          
BLAST of WD repeat and SOCS box-containing 1 vs. Planmine SMEST
Match: SMESG000071620.1 (SMESG000071620.1)

HSP 1 Score: 53.9138 bits (128), Expect = 2.945e-7
Identity = 63/242 (26.03%), Postives = 102/242 (42.15%), Query Frame = 2
Query:  512 KLMLHNHYEDMATVSFSLDGSLRLASISIDGKLCLWDMWDDGNM----YKSIIIPNSFRPSCCAWGNKSKQICVGGSIGKCHIYQSEKPCLM--VATLAQVHYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMG--GAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNSKNTADS 1213
            +L+   H +D+ +VS   D  L + S   DGK+ +W + D   +      SI++ N    S C    K K I V  SI  C    S K   +   +  ++ H N IS  + + + SLL T S D ++ +W   +YK             LI  G    H + I    FS     L++ S D +I++W++E      D  +     R +      F  +  + + C SDG ++ +N     DS
Sbjct:  382 QLVHGGHSKDITSVSVFSD-RLHIVSGGKDGKVSIWQVEDSAKLRLKLITSIVVENDIVSSVCV-DRKGKFIYVHYSIEDCLAVLSLKGNKLNRKSCFSKPHSNIISTMEMNINSSLLATGSKDKNVKLW---SYKSK--------SKELIIKGVLKGHKRCISSVKFSDTEQLLLTASLDKVIKLWSVESLTCLQDFKSPTAVHRAM------FYNNEKQIISCHSDGTMIVWNRDTGKDS 604          
BLAST of WD repeat and SOCS box-containing 1 vs. Planmine SMEST
Match: SMESG000008519.1 (SMESG000008519.1)

HSP 1 Score: 51.9878 bits (123), Expect = 5.514e-7
Identity = 34/133 (25.56%), Postives = 58/133 (43.61%), Query Frame = 2
Query:  797 HYNDISACKYSSDDSLLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAFSPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPDGTKCLVCTSDGKVLFFNS 1195
            H  +ISA  ++ D + + T+S D SI            +IW   +    +F    H   + D  F      + S   DN +R+W+++D + P    +  F G +  +S V F P GT  L  ++D     +N+
Sbjct:  140 HDAEISAAVFNFDGTYVATASMDKSI------------KIWDLRMGARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVKDFSKP----SFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNT 256          
The following BLAST results are available for this feature:
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WSB15.526e-3528.97WD repeat and SOCS box containing 1 [Source:HGNC S... [more]
WSB13.466e-3332.57WD repeat and SOCS box containing 1 [Source:HGNC S... [more]
WSB22.382e-2127.72WD repeat and SOCS box containing 2 [Source:HGNC S... [more]
WSB22.423e-2127.72WD repeat and SOCS box containing 2 [Source:HGNC S... [more]
WSB22.769e-2127.91WD repeat and SOCS box containing 2 [Source:HGNC S... [more]
back to top
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lin-535.952e-624.47Probable histone-binding protein lin-53 [Source:U... [more]
back to top
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wds2.271e-626.61gene:FBgn0040066 transcript:FBtr0308566[more]
wds2.271e-626.61gene:FBgn0040066 transcript:FBtr0070438[more]
Caf1-557.988e-621.39gene:FBgn0263979 transcript:FBtr0301845[more]
Gbeta13F8.222e-624.45gene:FBgn0001105 transcript:FBtr0331597[more]
Gbeta13F8.222e-624.45gene:FBgn0001105 transcript:FBtr0074110[more]
back to top
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wsb16.126e-3728.17WD repeat and SOCS box containing 1 [Source:NCBI g... [more]
wsb26.767e-1021.97WD repeat and SOCS box containing 2 [Source:ZFIN;A... [more]
gnb21.349e-723.65guanine nucleotide binding protein (G protein), be... [more]
gnb21.349e-723.65guanine nucleotide binding protein (G protein), be... [more]
gnb21.349e-723.65guanine nucleotide binding protein (G protein), be... [more]
back to top
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wsb16.001e-3728.39WD repeat and SOCS box containing 1 [Source:NCBI g... [more]
wsb16.497e-3728.53WD repeat and SOCS box containing 1 [Source:NCBI g... [more]
wsb23.642e-2528.21WD repeat and SOCS box containing 2 [Source:NCBI g... [more]
hs3st57.583e-825.36heparan sulfate-glucosamine 3-sulfotransferase 5 [... [more]
APAF13.228e-725.69apoptotic peptidase activating factor 1 [Source:NC... [more]
back to top
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wsb11.127e-3528.17WD repeat and SOCS box-containing 1 [Source:MGI Sy... [more]
Wsb21.386e-2229.07WD repeat and SOCS box-containing 2 [Source:MGI Sy... [more]
Wsb21.666e-2229.07WD repeat and SOCS box-containing 2 [Source:MGI Sy... [more]
Gnb22.348e-724.02guanine nucleotide binding protein (G protein), be... [more]
Gnb22.419e-724.02guanine nucleotide binding protein (G protein), be... [more]
back to top
BLAST of WD repeat and SOCS box-containing 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P1V3|WSB1_XENTR3.179e-3628.39WD repeat and SOCS box-containing protein 1 OS=Xen... [more]
sp|Q7T2F6|WSB1_DANRE4.624e-3628.17WD repeat and SOCS box-containing protein 1 OS=Dan... [more]
sp|O54927|WSB1_MOUSE7.885e-3528.17WD repeat and SOCS box-containing protein 1 OS=Mus... [more]
sp|Q9Y6I7|WSB1_HUMAN2.654e-3428.97WD repeat and SOCS box-containing protein 1 OS=Hom... [more]
sp|Q9W5Z5|WSB1_TAKRU2.890e-3330.88WD repeat and SOCS box-containing protein 1 OS=Tak... [more]
back to top
BLAST of WD repeat and SOCS box-containing 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YKW71.096e-5130.11WD repeat and SOCS box-containing protein 1 OS=Fas... [more]
G7YP227.855e-5129.73WD repeat and SOCS box-containing protein 1 OS=Clo... [more]
A0A419PFW68.613e-5129.73WD repeat and SOCS box-containing protein 1 OS=Clo... [more]
A0A075AJ341.838e-5029.64WD_REPEATS_REGION domain-containing protein OS=Opi... [more]
A0A1S8WUA92.335e-5029.64WD domain, G-beta repeat protein (Fragment) OS=Opi... [more]
back to top
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wsb14.797e-3527.81WD repeat and SOCS box containing 1 [Source:NCBI g... [more]
wsb11.147e-3426.36WD repeat and SOCS box containing 1 [Source:NCBI g... [more]
wsb21.934e-1023.71WD repeat and SOCS box-containing protein 2 [Sourc... [more]
gnb24.716e-924.90guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
gnb25.450e-924.90guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
back to top
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wsb21.275e-3430.63WD repeat and SOCS box containing 2 [Source:ZFIN;A... [more]
mlst88.823e-922.95MTOR associated protein, LST8 homolog (S. cerevisi... [more]
taf5l1.742e-824.82TAF5-like RNA polymerase II, p300/CBP-associated f... [more]
wdsub13.945e-727.27WD repeat, sterile alpha motif and U-box domain co... [more]
POC1A1.534e-623.04POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PFS25.016e-826.02Integral subunit of the pre-mRNA CPF complex; the ... [more]
back to top
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO447953.203e-1025.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301502.063e-923.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401741.126e-822.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO257773.100e-729.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO332975.717e-725.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat and SOCS box-containing 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wsb12.097e-3726.91WD repeat and SOCS box containing 1 [Source:NCBI g... [more]
wsb12.804e-3726.91WD repeat and SOCS box containing 1 [Source:NCBI g... [more]
wsb23.696e-1224.91WD repeat and SOCS box containing 2 [Source:NCBI g... [more]
gnb23.534e-823.35guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
ol-gb16.226e-723.58guanine nucleotide-binding protein beta subunit [S... [more]
back to top
BLAST of WD repeat and SOCS box-containing 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032294.10.000e+0100.00SMESG000032294.1[more]
SMESG000071620.12.178e-726.03SMESG000071620.1[more]
SMESG000008519.12.249e-725.56SMESG000008519.1[more]
SMESG000071620.12.945e-726.03SMESG000071620.1[more]
SMESG000008519.15.514e-725.56SMESG000008519.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026669 ID=SMED30026669|Name=WD repeat and SOCS box-containing 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1609bp
CCGAGACCTAGATAGTATTTAATTACAAAATTGTCGTATTTAATTATAAA
ATATTTTGATTTAAATATATATTACTGTTAGCAAAATATTTATGCAAAAC
TATTTAACTTACACTACTTCAAGCAAAACACCTATTGTGGCATGTGCAAT
TAGTTCATGTGGTTACTATTTAGCTTTTAATTCTGATTCTCAGACGTTGA
AAATTGTGTGTTTAAAGTCTATCAGGTCTACAAAACTTGATAAAAATGAA
ACAAATCTAAACGATTGTCTCCCAATTTTATTTGAATCCAAAATGGGTTC
ACAGATCCGTTGTTTAGATTTTGGGCGTGGCAATGTCAGTAACAATAGAT
TACCACATAGATCAAGTAAAAGGCGAATAACCTATCCAGTGATGGACAAT
GCTTGTTTATTAGCAGTCGGTTTGAAATCTGGCCAAGTAAAGATCTATTC
TTTATTGCCAAGCTCATACTATGATGGTTCTCAACCTCTGGTGGAAAACG
GAGGTAACGCTAAATTGATGTTACATAACCATTATGAAGACATGGCCACA
GTTTCATTTTCTCTTGATGGGTCTTTGAGACTTGCATCAATAAGTATTGA
CGGAAAGTTGTGCCTATGGGATATGTGGGATGATGGAAACATGTATAAAT
CTATTATTATTCCAAATAGTTTCCGGCCCAGTTGTTGTGCGTGGGGGAAT
AAAAGCAAACAAATCTGTGTTGGTGGAAGCATCGGAAAGTGCCATATTTA
TCAATCAGAAAAGCCTTGTTTAATGGTAGCAACATTAGCTCAAGTTCATT
ACAATGATATTAGTGCTTGTAAATATTCTTCAGATGATTCACTTTTAGGA
ACTTCTTCATTCGATACCAGCATTGTGATCTGGTGTGCTGGTACATACAA
GCCGATGCTTCAAATATGGCAAACTGGATTAAAACCATCTTTAATATTCA
TGGGTGGAGCTCACAATAAATATATTCGCGATTTTGCTTTCTCACCGGAC
TGTGTAAATCTTGTATCGGTATCTGATGACAACATTATTCGAATGTGGAA
TCTCGAAGATACAGCATCACCGGTAGATCAAATCACTGTACCATTTACCG
GAAGAAAACTCATTTTGAGCTGTGTAAAATTTACTCCAGATGGAACAAAA
TGTTTAGTTTGCACATCTGACGGAAAAGTTTTGTTCTTCAATTCCAAAAA
CACTGCAGACTCATTGTCTGTTTTATGCCGCAAATCTGTACGAGAGAAAT
TAGTGGTTCAGTTGCACAATCTTACCACCAACGATTTCAATGACCATCAG
CAAACTGAACCGAAACCGTTATCCTTAATAGAAATGCAAACGCCTAGCAA
TCGTCGACGAAGCATGTCGGATGTATTTTCAGCGAAAGAAAACAGACAAT
CTATTAATTTCAATCACGTTGTCAATGAATTGCCGATTCCTGGAATGCTG
AAATCGTACTTACAATATGGACTGAACAGTTCAAAGTTGGTAGAAAATAT
TGACCCTAGACCAGTGAGAATGCAAAGTTCCAGAAATATGTCCATCTACT
GATATTGTTGTTGATCTGAATTTGTTTTTTTCATGAATTACATTTTATCA
TTGAAAAAA
back to top

protein sequence of SMED30026669-orf-1

>SMED30026669-orf-1 ID=SMED30026669-orf-1|Name=SMED30026669-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=487bp
MQNYLTYTTSSKTPIVACAISSCGYYLAFNSDSQTLKIVCLKSIRSTKLD
KNETNLNDCLPILFESKMGSQIRCLDFGRGNVSNNRLPHRSSKRRITYPV
MDNACLLAVGLKSGQVKIYSLLPSSYYDGSQPLVENGGNAKLMLHNHYED
MATVSFSLDGSLRLASISIDGKLCLWDMWDDGNMYKSIIIPNSFRPSCCA
WGNKSKQICVGGSIGKCHIYQSEKPCLMVATLAQVHYNDISACKYSSDDS
LLGTSSFDTSIVIWCAGTYKPMLQIWQTGLKPSLIFMGGAHNKYIRDFAF
SPDCVNLVSVSDDNIIRMWNLEDTASPVDQITVPFTGRKLILSCVKFTPD
GTKCLVCTSDGKVLFFNSKNTADSLSVLCRKSVREKLVVQLHNLTTNDFN
DHQQTEPKPLSLIEMQTPSNRRRSMSDVFSAKENRQSINFNHVVNELPIP
GMLKSYLQYGLNSSKLVENIDPRPVRMQSSRNMSIY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000136whole organism
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 281..320
e-value: 2.2E-4
score: 30.6
coord: 2..40
e-value: 140.0
score: 3.5
coord: 225..265
e-value: 0.061
score: 22.5
coord: 328..367
e-value: 1.1
score: 16.7
coord: 182..221
e-value: 230.0
score: 2.1
coord: 56..120
e-value: 390.0
score: 0.7
coord: 137..177
e-value: 0.13
score: 21.4
IPR001680WD40 repeatPFAMPF00400WD40coord: 289..320
e-value: 3.8E-4
score: 21.2
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 144..178
score: 8.804
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 233..264
score: 9.372
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 288..322
score: 11.645
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 186..400
e-value: 6.6E-24
score: 86.9
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 1..185
e-value: 5.6E-11
score: 44.4
NoneNo IPR availablePANTHERPTHR15622WD40 REPEAT PROTEINcoord: 17..387
NoneNo IPR availableSUPERFAMILYSSF63829Calcium-dependent phosphotriesterasecoord: 10..213
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 307..321
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 164..178
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 144..376
score: 17.218
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 138..373