5-demethoxyubiquinone hydroxylase, mitochondrial

Overview
Name5-demethoxyubiquinone hydroxylase, mitochondrial
Smed IDSMED30026668
Length (bp)690
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 5-demethoxyubiquinone hydroxylase, mitochondrial (SMED30026668) t-SNE clustered cells

Violin plots show distribution of expression levels for 5-demethoxyubiquinone hydroxylase, mitochondrial (SMED30026668) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 5-demethoxyubiquinone hydroxylase, mitochondrial (SMED30026668) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 5-demethoxyubiquinone hydroxylase, mitochondrial (SMED30026668) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026668

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026668h1SMcG0009344 SmedASXL_019430SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026668h1SMcG0009344 SmedASXL_019430SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30026668h1SMcG0009344 dd_Smed_v4_5987_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026668h1SMcG0009344 dd_Smed_v4_5987_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30026668h1SMcG0009344 SMED30026668smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026668h1SMcG0009344 SMED30026668smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30026668h1SMcG0009344 SMED_05817_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30026668h1SMcG0009344 SMED_05817_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Human
Match: COQ7 (coenzyme Q7, hydroxylase [Source:HGNC Symbol;Acc:HGNC:2244])

HSP 1 Score: 247.284 bits (630), Expect = 2.410e-83
Identity = 110/173 (63.58%), Postives = 138/173 (79.77%), Query Frame = 3
Query:   45 TRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            +RA +DR+ RV+HAGE+GANRIY GQ+A+L  T   P+IQ M DQEK HL+KF EL+  ++ RPT+LMP+WN+ GF LGAGTAL+GKE AMACTVAVE  I  HYN+QIRTL+E DPE ++EL+ +IKKFRDEELEHHD GL  +AE AP Y +L S I+ GC+ AI+LSER+
Sbjct:    7 SRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL 179          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Human
Match: COQ7 (coenzyme Q7, hydroxylase [Source:HGNC Symbol;Acc:HGNC:2244])

HSP 1 Score: 247.669 bits (631), Expect = 2.690e-83
Identity = 110/173 (63.58%), Postives = 138/173 (79.77%), Query Frame = 3
Query:   45 TRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            +RA +DR+ RV+HAGE+GANRIY GQ+A+L  T   P+IQ M DQEK HL+KF EL+  ++ RPT+LMP+WN+ GF LGAGTAL+GKE AMACTVAVE  I  HYN+QIRTL+E DPE ++EL+ +IKKFRDEELEHHD GL  +AE AP Y +L S I+ GC+ AI+LSER+
Sbjct:   22 SRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL 194          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Human
Match: COQ7 (coenzyme Q7, hydroxylase [Source:HGNC Symbol;Acc:HGNC:2244])

HSP 1 Score: 248.054 bits (632), Expect = 3.952e-83
Identity = 110/173 (63.58%), Postives = 138/173 (79.77%), Query Frame = 3
Query:   45 TRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            +RA +DR+ RV+HAGE+GANRIY GQ+A+L  T   P+IQ M DQEK HL+KF EL+  ++ RPT+LMP+WN+ GF LGAGTAL+GKE AMACTVAVE  I  HYN+QIRTL+E DPE ++EL+ +IKKFRDEELEHHD GL  +AE AP Y +L S I+ GC+ AI+LSER+
Sbjct:   45 SRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL 217          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Human
Match: COQ7 (coenzyme Q7, hydroxylase [Source:HGNC Symbol;Acc:HGNC:2244])

HSP 1 Score: 248.054 bits (632), Expect = 3.952e-83
Identity = 110/173 (63.58%), Postives = 138/173 (79.77%), Query Frame = 3
Query:   45 TRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            +RA +DR+ RV+HAGE+GANRIY GQ+A+L  T   P+IQ M DQEK HL+KF EL+  ++ RPT+LMP+WN+ GF LGAGTAL+GKE AMACTVAVE  I  HYN+QIRTL+E DPE ++EL+ +IKKFRDEELEHHD GL  +AE AP Y +L S I+ GC+ AI+LSER+
Sbjct:   45 SRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL 217          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Human
Match: COQ7 (coenzyme Q7, hydroxylase [Source:HGNC Symbol;Acc:HGNC:2244])

HSP 1 Score: 180.259 bits (456), Expect = 1.247e-57
Identity = 79/124 (63.71%), Postives = 100/124 (80.65%), Query Frame = 3
Query:   45 TRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELI 416
            +RA +DR+ RV+HAGE+GANRIY GQ+A+L  T   P+IQ M DQEK HL+KF EL+  ++ RPT+LMP+WN+ GF LGAGTAL+GKE AMACTVAVE  I  HYN+QIRTL+E DPE ++EL+
Sbjct:    7 SRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELL 130          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Celegans
Match: clk-1 (5-demethoxyubiquinone hydroxylase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P48376])

HSP 1 Score: 201.06 bits (510), Expect = 1.947e-65
Identity = 87/180 (48.33%), Postives = 129/180 (71.67%), Query Frame = 3
Query:   24 ASRMSVKTRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
             +  +   +ALI+++ RV+HAGE GA+RIY GQLA+L+G+    +I+ M D+EK HL   E L  K+    T+  P++++A + LG G+AL+GKE AMACT+AVE +IG+HYNDQ++ LL +DPE+HKEL+ ++ + RDEEL HHDTG++ +  +AP Y  L   I+ GCK AI ++E+I
Sbjct:    8 GAHTAASRQALIEKIIRVDHAGELGADRIYAGQLAVLQGSSVGSVIKKMWDEEKEHLDTMERLAAKHNVPHTVFSPVFSVAAYALGVGSALLGKEGAMACTIAVEELIGQHYNDQLKELLADDPETHKELLKILTRLRDEELHHHDTGVEHDGMKAPAYSALKWIIQTGCKGAIAIAEKI 187          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Fly
Match: Coq7 (gene:FBgn0029502 transcript:FBtr0070963)

HSP 1 Score: 220.705 bits (561), Expect = 1.278e-72
Identity = 104/174 (59.77%), Postives = 132/174 (75.86%), Query Frame = 3
Query:   42 KTRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            +  AL D + RV+HAGE GA+RIY GQ+AIL        I HM +QEK H ++FE+LI +++ RPTI+ PIWN+AGFVLGAGTALMG++AAMACTVAVE+VI +HYNDQ+R ++E  P   KEL+  I KFRDEE EHHDTG+   AEQAPFYQ ++  IK GCK AI +S++I
Sbjct:   47 RPNALTDEIIRVDHAGELGADRIYAGQMAILGNGPLGKTIGHMWEQEKEHRKQFEQLIQQHRVRPTIMTPIWNVAGFVLGAGTALMGEKAAMACTVAVETVIVEHYNDQLRQIMEA-PNPDKELLATITKFRDEEQEHHDTGIDHGAEQAPFYQAMTEVIKFGCKTAIAISKKI 219          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Zebrafish
Match: coq7 (coenzyme Q7 homolog, ubiquinone (yeast) [Source:ZFIN;Acc:ZDB-GENE-070209-262])

HSP 1 Score: 240.35 bits (612), Expect = 3.188e-80
Identity = 104/172 (60.47%), Postives = 141/172 (81.98%), Query Frame = 3
Query:   48 RALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            +A++DR+ RV+HAGE+GANRIY GQ+A+L  T   P+IQHM DQEK+HL+KF E++ +++ RPT+L+P+WNIAGF LGA TAL+GKE AMACTVAVE  I +HYN QIRTL+E DP+ + EL+ +IK+FRD+E+EHHDTGL+ +AE  P Y +L + I+ GC AAI++S+RI
Sbjct:   52 KAMLDRMLRVDHAGEYGANRIYAGQMAVLGRTQTGPLIQHMWDQEKIHLEKFNEILGEHRVRPTLLLPLWNIAGFALGACTALLGKEGAMACTVAVEESISEHYNSQIRTLMEADPDRYTELLQLIKEFRDDEIEHHDTGLEHDAESVPGYMLLKTAIQAGCTAAIYISQRI 223          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Xenopus
Match: ccdc149 (coiled-coil domain containing 149 [Source:Xenbase;Acc:XB-GENE-995140])

HSP 1 Score: 249.595 bits (636), Expect = 1.285e-83
Identity = 109/172 (63.37%), Postives = 143/172 (83.14%), Query Frame = 3
Query:   48 RALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            +A++DR+ RV+HAGE+GANRIY GQ+A+L  +   PIIQHM DQEK HL+KF EL+  ++ RPT+LMP+WN+AGF LGAGTAL+GK+ AMACTVAVE+ I +H+N QIRTL+E+DPE H+ L+  IKK RD+ELEHHDTGL+ +AE AP Y +L + I++GC+AAIFLSER+
Sbjct:   51 KAVLDRIIRVDHAGEYGANRIYAGQMAVLGRSTVGPIIQHMWDQEKEHLKKFSELMVSHRVRPTVLMPLWNVAGFALGAGTALLGKKGAMACTVAVEASISEHFNSQIRTLMESDPEKHRALLQTIKKCRDDELEHHDTGLEHDAELAPGYFLLKNAIQLGCRAAIFLSERV 222          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Mouse
Match: Coq7 (demethyl-Q 7 [Source:MGI Symbol;Acc:MGI:107207])

HSP 1 Score: 246.899 bits (629), Expect = 8.830e-83
Identity = 111/173 (64.16%), Postives = 136/173 (78.61%), Query Frame = 3
Query:   45 TRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
             RA +DR+ RV+HAGE+GANRIY GQ+A+L  T   P+IQ M DQEK HL+KF EL+  ++ RPT+LMP+WN+AGF LGAGTAL+GKE AMACTVAVE  I  HYN+QIR L+E DPE ++EL+ VIK+FRDEELEHHDTGL  +AE AP Y +L   I+ GC AAI+LSER 
Sbjct:   45 NRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKNHLKKFNELMIAFRVRPTVLMPLWNVAGFALGAGTALLGKEGAMACTVAVEESIANHYNNQIRMLMEEDPEKYEELLQVIKQFRDEELEHHDTGLDHDAELAPAYALLKRIIQAGCSAAIYLSERF 217          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Mouse
Match: Coq7 (demethyl-Q 7 [Source:MGI Symbol;Acc:MGI:107207])

HSP 1 Score: 216.083 bits (549), Expect = 1.244e-70
Identity = 97/147 (65.99%), Postives = 119/147 (80.95%), Query Frame = 3
Query:   45 TRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAE 485
             RA +DR+ RV+HAGE+GANRIY GQ+A+L  T   P+IQ M DQEK HL+KF EL+  ++ RPT+LMP+WN+AGF LGAGTAL+GKE AMACTVAVE  I  HYN+QIR L+E DPE ++EL+ VIK+FRDEELEHHDTGL  +AE
Sbjct:   45 NRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKNHLKKFNELMIAFRVRPTVLMPLWNVAGFALGAGTALLGKEGAMACTVAVEESIANHYNNQIRMLMEEDPEKYEELLQVIKQFRDEELEHHDTGLDHDAE 191          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Mouse
Match: Coq7 (demethyl-Q 7 [Source:MGI Symbol;Acc:MGI:107207])

HSP 1 Score: 219.55 bits (558), Expect = 2.190e-70
Identity = 102/157 (64.97%), Postives = 125/157 (79.62%), Query Frame = 3
Query:   45 TRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSS 515
             RA +DR+ RV+HAGE+GANRIY GQ+A+L  T   P+IQ M DQEK HL+KF EL+  ++ RPT+LMP+WN+AGF LGAGTAL+GKE AMACTVAVE  I  HYN+QIR L+E DPE ++EL+ VIK+FRDEELEHHDTGL  +AE  PF Q L+S
Sbjct:   45 NRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKNHLKKFNELMIAFRVRPTVLMPLWNVAGFALGAGTALLGKEGAMACTVAVEESIANHYNNQIRMLMEEDPEKYEELLQVIKQFRDEELEHHDTGLDHDAE-LPF-QCLNS 199          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q99807|COQ7_HUMAN (5-demethoxyubiquinone hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=COQ7 PE=1 SV=3)

HSP 1 Score: 248.054 bits (632), Expect = 1.898e-82
Identity = 110/173 (63.58%), Postives = 138/173 (79.77%), Query Frame = 3
Query:   45 TRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            +RA +DR+ RV+HAGE+GANRIY GQ+A+L  T   P+IQ M DQEK HL+KF EL+  ++ RPT+LMP+WN+ GF LGAGTAL+GKE AMACTVAVE  I  HYN+QIRTL+E DPE ++EL+ +IKKFRDEELEHHD GL  +AE AP Y +L S I+ GC+ AI+LSER+
Sbjct:   45 SRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL 217          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. UniProt/SwissProt
Match: sp|P97478|COQ7_MOUSE (5-demethoxyubiquinone hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Coq7 PE=1 SV=3)

HSP 1 Score: 246.899 bits (629), Expect = 6.177e-82
Identity = 111/173 (64.16%), Postives = 136/173 (78.61%), Query Frame = 3
Query:   45 TRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
             RA +DR+ RV+HAGE+GANRIY GQ+A+L  T   P+IQ M DQEK HL+KF EL+  ++ RPT+LMP+WN+AGF LGAGTAL+GKE AMACTVAVE  I  HYN+QIR L+E DPE ++EL+ VIK+FRDEELEHHDTGL  +AE AP Y +L   I+ GC AAI+LSER 
Sbjct:   45 NRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKNHLKKFNELMIAFRVRPTVLMPLWNVAGFALGAGTALLGKEGAMACTVAVEESIANHYNNQIRMLMEEDPEKYEELLQVIKQFRDEELEHHDTGLDHDAELAPAYALLKRIIQAGCSAAIYLSERF 217          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q2TBW2|COQ7_BOVIN (5-demethoxyubiquinone hydroxylase, mitochondrial OS=Bos taurus OX=9913 GN=COQ7 PE=2 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 3.286e-81
Identity = 110/173 (63.58%), Postives = 136/173 (78.61%), Query Frame = 3
Query:   45 TRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
             R  +DR+ RV+HAGE+GANRIY GQ+A+L  T   P+IQ M DQEK HL+KF EL+  ++ RPT+LMP WN+ GF LGAGTAL+GKE AMACTVAVE  I  HYN+QIRTL+E +PE ++EL+ VIKKFRDEELEHHD GL+ +AE AP Y +L S I+ GCK AI+LSER+
Sbjct:   45 NREAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSIGPVIQKMWDQEKDHLKKFNELMVAFRVRPTVLMPFWNVVGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEKEPEKYEELLQVIKKFRDEELEHHDIGLEHDAELAPAYVVLKSVIQAGCKVAIYLSERL 217          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q63619|COQ7_RAT (5-demethoxyubiquinone hydroxylase, mitochondrial (Fragment) OS=Rattus norvegicus OX=10116 GN=Coq7 PE=2 SV=3)

HSP 1 Score: 242.662 bits (618), Expect = 6.992e-81
Identity = 109/173 (63.01%), Postives = 135/173 (78.03%), Query Frame = 3
Query:   45 TRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
             RA +DR+ RV+HAGE+GANRIY GQ+A+L  T   P+IQ M DQEK HL+KF EL+  ++ RPT+LMP+WN+AGF LGAGTAL+GKE  MACTVAVE  I  HYN+QIR L+E D E ++EL+ VIK+FRDEELEHHDTGL+ +AE AP Y +L   I+ GC AAI+LSER 
Sbjct:    7 NRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKNHLKKFNELMVAFRVRPTVLMPLWNVAGFALGAGTALLGKEGGMACTVAVEESIAHHYNNQIRMLMEEDAEKYEELLQVIKQFRDEELEHHDTGLEHDAELAPAYTLLKRLIQAGCSAAIYLSERF 179          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q54VB3|COQ7_DICDI (5-demethoxyubiquinone hydroxylase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=coq7 PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.245e-64
Identity = 102/173 (58.96%), Postives = 126/173 (72.83%), Query Frame = 3
Query:   48 RALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPE-SHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            R +I+R+ RV+HAGEFGA RIYEGQLA+L  T   P+I+ M DQEK H  KF +LI + + RPTIL PIWN+AGF LG  +ALMGKEAAMA TVAVE+VI  HYNDQ+R L  ND     KEL + IKKFRD+ELEH   G++ +AE AP Y+  S  +K+G K AI+LS R+
Sbjct:   47 RQIIERIIRVDHAGEFGAARIYEGQLAVLANTKEGPLIREMADQEKEHQAKFNQLIYEKRVRPTILSPIWNVAGFGLGYVSALMGKEAAMAVTVAVETVISDHYNDQLRQL--NDAGIDDKELKETIKKFRDDELEHMHIGIEHDAELAPLYKPFSELVKVGTKTAIWLSTRV 217          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. TrEMBL
Match: C3XVM9 (5-demethoxyubiquinone hydroxylase, mitochondrial OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_61824 PE=3 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 4.620e-85
Identity = 118/177 (66.67%), Postives = 146/177 (82.49%), Query Frame = 3
Query:   33 MSVKTRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            MS +++ ++DR  RV+HAGE GAN IY GQ+A+L  T+   +IQ M DQEK H+ KFEELIP+++ RPT+L+PIWN+AGFVLGAGTAL+GKE AMACTVAVE  I +HYN QIR L+E+DPE HKEL++VIKKFRDEELEHHD GL+ +AE AP YQ L++ IK GCKAAI+LSERI
Sbjct:    1 MSTESKRMVDRFIRVDHAGEVGANYIYRGQMAVLGNTEVGRVIQRMWDQEKEHMAKFEELIPQHRVRPTVLLPIWNVAGFVLGAGTALLGKEGAMACTVAVEDSIVEHYNSQIRALIEDDPEKHKELLEVIKKFRDEELEHHDMGLEHDAEAAPAYQTLTNVIKGGCKAAIWLSERI 177          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. TrEMBL
Match: H3A8N6 (5-demethoxyubiquinone hydroxylase, mitochondrial OS=Latimeria chalumnae OX=7897 GN=COQ7 PE=3 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 3.761e-84
Identity = 114/174 (65.52%), Postives = 146/174 (83.91%), Query Frame = 3
Query:   42 KTRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            + +AL+DR+ RV+HAGE+GANRIYEGQ+ +L  T   P+IQ M DQEK HLQKF EL+ +++ RPTIL+P WN+ GF LGAGTAL+GKE AMACTVAVE  I +HYN+QIRTL+E DPE +KEL+++IKKFRDEE+EHHDTGL+ +AE AP Y +L +TI++GCKAAI+LSER+
Sbjct:   51 QNKALLDRIIRVDHAGEYGANRIYEGQMVVLGKTAVGPVIQEMWDQEKDHLQKFNELMVEHRVRPTILLPFWNVVGFALGAGTALLGKEGAMACTVAVEESISEHYNNQIRTLMEEDPEKYKELLEMIKKFRDEEMEHHDTGLEHDAELAPAYSVLKNTIQLGCKAAIYLSERV 224          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. TrEMBL
Match: A0A0P4WA62 (5-demethoxyubiquinone hydroxylase, mitochondrial OS=Scylla olivacea OX=85551 PE=3 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 4.675e-84
Identity = 118/181 (65.19%), Postives = 145/181 (80.11%), Query Frame = 3
Query:   21 MASRMSVKTRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            + S  +  T+  IDR+ RV+HAGE GA+RIY GQ+A+L  T   P+IQHM DQEK H  KFEEL+PKY+ RPT+L+PIWN+AGFVLGAGTAL+G+EAAMACTVAVESVI  HYN Q+R L+    E +KELI+VIKKFRD+E++HHDTGL  +AEQAP Y  LS+ IK GCKAA++LSERI
Sbjct:   14 LYSTKAAHTKQAIDRIIRVDHAGELGADRIYAGQMAVLGKTSVGPVIQHMWDQEKEHKAKFEELVPKYRVRPTVLLPIWNVAGFVLGAGTALLGREAAMACTVAVESVITDHYNSQLRELINLGEEENKELIEVIKKFRDDEMDHHDTGLANDAEQAPAYTALSNVIKTGCKAAVWLSERI 194          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. TrEMBL
Match: A0A3S0ZTP1 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_006663 PE=3 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 1.125e-83
Identity = 114/174 (65.52%), Postives = 146/174 (83.91%), Query Frame = 3
Query:   42 KTRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            KTRAL+D++ RV+HAGEFGA+RIY GQLA+LK T   P+I+ M D+EK H + FE LI + + RPT+L+P+WNIAGF LGAGTALMGKEAAMACTVAVE VIG HYN+QIR L+E+DP  HKEL++++KKFRD+E+ HHD GL+ +AE+APFY+ L+  IKIGCK A+++SERI
Sbjct:   56 KTRALLDKIIRVDHAGEFGADRIYAGQLAVLKNTSVGPMIKEMWDEEKHHRETFERLIREKRVRPTVLLPLWNIAGFALGAGTALMGKEAAMACTVAVEDVIGDHYNNQIRELMEDDPVQHKELLEIVKKFRDDEMHHHDIGLEHDAEKAPFYKALTQVIKIGCKGAVWVSERI 229          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. TrEMBL
Match: A0A423T7L5 (5-demethoxyubiquinone hydroxylase, mitochondrial OS=Penaeus vannamei OX=6689 GN=C7M84_009200 PE=3 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 1.228e-83
Identity = 116/181 (64.09%), Postives = 146/181 (80.66%), Query Frame = 3
Query:   21 MASRMSVKTRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            + S  + + R  ++R+ RV+HAGE GA+RIY GQ+A+L  T   P+IQHM DQEK H  KFEELIPKY+ RPT+L+PIWN+AGF LGAGTAL+GKEAAMACTVAVESVI  HYN Q+R L+ N  E HKELI+VIKKFRD+E++HHDTGL  +AE AP Y+ +S+ IK+GCKAA+++SERI
Sbjct:   50 LYSTKAARNRQALERIIRVDHAGELGADRIYAGQMAVLGKTSVGPVIQHMWDQEKEHKAKFEELIPKYRVRPTVLVPIWNVAGFALGAGTALLGKEAAMACTVAVESVITDHYNSQLRELIHNGEEEHKELIEVIKKFRDDEMDHHDTGLAHDAELAPAYKTMSNVIKMGCKAAVWISERI 230          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Cavefish
Match: coq7 (coenzyme Q7, hydroxylase [Source:NCBI gene;Acc:103039596])

HSP 1 Score: 240.35 bits (612), Expect = 3.708e-80
Identity = 104/172 (60.47%), Postives = 142/172 (82.56%), Query Frame = 3
Query:   48 RALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            +A++D + RV+HAGE+GANRIY GQ+A+L  T + PIIQ+M DQEK+HLQKF E++ + + RPT+L+P+WN+AGF+LGA TAL+GKE AMACTVAVE  I +HYN QIR L+E DPE ++EL+ +IK+FRD+ELEHHDTGL+ +AE  P Y +L + I+ GCKAAI++S+R+
Sbjct:   53 KAMLDSMLRVDHAGEYGANRIYAGQMAVLGRTQSGPIIQNMWDQEKMHLQKFNEILGENRVRPTLLLPLWNVAGFLLGASTALLGKEGAMACTVAVEESISEHYNSQIRALMEEDPERYRELLQLIKEFRDDELEHHDTGLEHDAESVPGYLLLKTVIQAGCKAAIYVSQRV 224          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Sea Lamprey
Match: coq7 (coenzyme Q7 homolog, ubiquinone (yeast) [Source:ZFIN;Acc:ZDB-GENE-070209-262])

HSP 1 Score: 243.047 bits (619), Expect = 6.174e-82
Identity = 109/176 (61.93%), Postives = 143/176 (81.25%), Query Frame = 3
Query:   51 ALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVL--GAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDV---IKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            AL++R+ RV+HAGE+GA+RIY GQLA+L G+   P+I+ M DQEK HL KFEELI +++ RPT L+P+WN+AGF+L  GAG+AL+GKE AMACTVAVE  I +HYN+QIRTL+E DPE H EL++V   ++KFRD+E+EHHDTGLQ NAE AP Y +L S I++GCK A++ SER+
Sbjct:   53 ALLERIIRVDHAGEYGADRIYAGQLAVLGGSSVAPVIKRMWDQEKEHLAKFEELISRHRVRPTALLPLWNVAGFLLAPGAGSALLGKEGAMACTVAVEESISEHYNNQIRTLVEEDPEKHAELLEVPLALRKFRDDEMEHHDTGLQHNAELAPAYALLKSAIQVGCKVAVYASERV 228          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Yeast
Match: CAT5 (Protein required for ubiquinone (Coenzyme Q) biosynthesis; localizes to the matrix face of the mitochondrial inner membrane in a large complex with ubiquinone biosynthetic enzymes; required for gluconeogenic gene activation [Source:SGD;Acc:S000005651])

HSP 1 Score: 152.91 bits (385), Expect = 1.278e-46
Identity = 79/184 (42.93%), Postives = 111/184 (60.33%), Query Frame = 3
Query:   51 ALIDRVTRVNHAGEFGANRIYEGQLAIL--KGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTL-----------LENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            A +DRV RV+ AGE GA+ IY GQ  +L  +    +P+++H+ DQE  H   F  L  K + RP++L P+W    F +GAGTAL+  EAAMACT AVE+VIG HYN Q+R L            +   E  K L   I++FRD+ELEH DT ++ ++  A  Y +++  IK  C+ AI+ +ERI
Sbjct:   50 AFLDRVIRVDQAGELGADYIYAGQYFVLAHRYPHLKPVLKHIWDQEIHHHNTFNNLQLKRRVRPSLLTPLWKAGAFAMGAGTALISPEAAMACTEAVETVIGGHYNGQLRNLANQFNLERTDGTKGPSEEIKSLTSTIQQFRDDELEHLDTAIKHDSYMAVPYTVITEGIKTICRVAIWSAERI 233          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Nematostella
Match: EDO44870 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUK7])

HSP 1 Score: 210.69 bits (535), Expect = 1.175e-69
Identity = 96/174 (55.17%), Postives = 136/174 (78.16%), Query Frame = 3
Query:   54 LIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLL--ENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQ--APFYQILSSTIKIGCKAAIFLSERI 563
            +IDR+ RV+HAGE GA+RIY GQ+A+L  ++  P+I+ M +QEK+HLQ FE +I + + RPT+L P+WN AGF+LGAGTA++GKEAAMACT A+E VIG+HY+ Q+R LL  E   E HK+L+  +++FRDEEL+H +TGL+  AEQ  AP Y+ L + I+ GC+AAI+++ER+
Sbjct:    1 VIDRIIRVDHAGELGADRIYAGQMAVLGKSNIGPLIKEMQEQEKLHLQTFESMIHERRVRPTLLTPLWNSAGFLLGAGTAMLGKEAAMACTEAIEEVIGEHYDSQLRELLSEEGAMEKHKDLLQTLQQFRDEELQHLETGLENGAEQAMAPMYKTLKNVIQTGCRAAIWVAERV 174          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Medaka
Match: coq7 (coenzyme Q7, hydroxylase [Source:NCBI gene;Acc:101164460])

HSP 1 Score: 231.106 bits (588), Expect = 6.803e-77
Identity = 103/172 (59.88%), Postives = 134/172 (77.91%), Query Frame = 3
Query:   48 RALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            + ++ R+ RV+HAGEFGANRIY GQ+A+L  +   P+IQ M DQEK HL KF E++ + + RPT L+P WNIAGFVLGA TAL+GKE AMACTVAVE  I +HYN QIR L+E DPE + EL+ VIK+FRD+E+EHHDTGL+ +AE  P + +L + I++GCKAAI +SER+
Sbjct:   29 KEMVHRILRVDHAGEFGANRIYAGQMAVLGRSKIGPLIQQMWDQEKKHLAKFNEILSENRVRPTALLPFWNIAGFVLGASTALLGKEGAMACTVAVEESISEHYNSQIRVLMEKDPERYTELLQVIKEFRDDEMEHHDTGLEHDAESVPGFWLLKNVIQLGCKAAISISERV 200          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Medaka
Match: coq7 (coenzyme Q7, hydroxylase [Source:NCBI gene;Acc:101164460])

HSP 1 Score: 231.491 bits (589), Expect = 8.289e-77
Identity = 103/172 (59.88%), Postives = 134/172 (77.91%), Query Frame = 3
Query:   48 RALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            + ++ R+ RV+HAGEFGANRIY GQ+A+L  +   P+IQ M DQEK HL KF E++ + + RPT L+P WNIAGFVLGA TAL+GKE AMACTVAVE  I +HYN QIR L+E DPE + EL+ VIK+FRD+E+EHHDTGL+ +AE  P + +L + I++GCKAAI +SER+
Sbjct:   49 KEMVHRILRVDHAGEFGANRIYAGQMAVLGRSKIGPLIQQMWDQEKKHLAKFNEILSENRVRPTALLPFWNIAGFVLGASTALLGKEGAMACTVAVEESISEHYNSQIRVLMEKDPERYTELLQVIKEFRDDEMEHHDTGLEHDAESVPGFWLLKNVIQLGCKAAISISERV 220          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Medaka
Match: coq7 (coenzyme Q7, hydroxylase [Source:NCBI gene;Acc:101164460])

HSP 1 Score: 170.244 bits (430), Expect = 2.385e-52
Identity = 76/127 (59.84%), Postives = 95/127 (74.80%), Query Frame = 3
Query:   54 LIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKF 434
            ++ R+ RV+HAGEFGANRIY GQ+A+L  +   P+IQ M DQEK HL KF E++ + + RPT L+P WNIAGFVLGA TAL+GKE AMACTVAVE  I +HYN QIR L+E DPE + EL+ +   F
Sbjct:   51 MVHRILRVDHAGEFGANRIYAGQMAVLGRSKIGPLIQQMWDQEKKHLAKFNEILSENRVRPTALLPFWNIAGFVLGASTALLGKEGAMACTVAVEESISEHYNSQIRVLMEKDPERYTELLQMNCSF 177          
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Planmine SMEST
Match: SMESG000079448.1 (SMESG000079448.1)

HSP 1 Score: 373.629 bits (958), Expect = 1.199e-133
Identity = 179/181 (98.90%), Postives = 180/181 (99.45%), Query Frame = 3
Query:   21 MASRMSVKTRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 563
            MASR+SVKTRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVH QKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI
Sbjct:    1 MASRISVKTRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHMLDQEKVHFQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMACTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGLQQNAEQAPFYQILSSTIKIGCKAAIFLSERI 181          
The following BLAST results are available for this feature:
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COQ72.410e-8363.58coenzyme Q7, hydroxylase [Source:HGNC Symbol;Acc:H... [more]
COQ72.690e-8363.58coenzyme Q7, hydroxylase [Source:HGNC Symbol;Acc:H... [more]
COQ73.952e-8363.58coenzyme Q7, hydroxylase [Source:HGNC Symbol;Acc:H... [more]
COQ73.952e-8363.58coenzyme Q7, hydroxylase [Source:HGNC Symbol;Acc:H... [more]
COQ71.247e-5763.71coenzyme Q7, hydroxylase [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
clk-11.947e-6548.335-demethoxyubiquinone hydroxylase, mitochondrial ... [more]
back to top
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Coq71.278e-7259.77gene:FBgn0029502 transcript:FBtr0070963[more]
back to top
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
coq73.188e-8060.47coenzyme Q7 homolog, ubiquinone (yeast) [Source:ZF... [more]
back to top
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1491.285e-8363.37coiled-coil domain containing 149 [Source:Xenbase;... [more]
back to top
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Coq78.830e-8364.16demethyl-Q 7 [Source:MGI Symbol;Acc:MGI:107207][more]
Coq71.244e-7065.99demethyl-Q 7 [Source:MGI Symbol;Acc:MGI:107207][more]
Coq72.190e-7064.97demethyl-Q 7 [Source:MGI Symbol;Acc:MGI:107207][more]
back to top
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99807|COQ7_HUMAN1.898e-8263.585-demethoxyubiquinone hydroxylase, mitochondrial O... [more]
sp|P97478|COQ7_MOUSE6.177e-8264.165-demethoxyubiquinone hydroxylase, mitochondrial O... [more]
sp|Q2TBW2|COQ7_BOVIN3.286e-8163.585-demethoxyubiquinone hydroxylase, mitochondrial O... [more]
sp|Q63619|COQ7_RAT6.992e-8163.015-demethoxyubiquinone hydroxylase, mitochondrial (... [more]
sp|Q54VB3|COQ7_DICDI1.245e-6458.965-demethoxyubiquinone hydroxylase, mitochondrial O... [more]
back to top
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3XVM94.620e-8566.675-demethoxyubiquinone hydroxylase, mitochondrial O... [more]
H3A8N63.761e-8465.525-demethoxyubiquinone hydroxylase, mitochondrial O... [more]
A0A0P4WA624.675e-8465.195-demethoxyubiquinone hydroxylase, mitochondrial O... [more]
A0A3S0ZTP11.125e-8365.52Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
A0A423T7L51.228e-8364.095-demethoxyubiquinone hydroxylase, mitochondrial O... [more]
back to top
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
coq73.708e-8060.47coenzyme Q7, hydroxylase [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
coq76.174e-8261.93coenzyme Q7 homolog, ubiquinone (yeast) [Source:ZF... [more]
back to top
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CAT51.278e-4642.93Protein required for ubiquinone (Coenzyme Q) biosy... [more]
back to top
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO448701.175e-6955.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
coq76.803e-7759.88coenzyme Q7, hydroxylase [Source:NCBI gene;Acc:101... [more]
coq78.289e-7759.88coenzyme Q7, hydroxylase [Source:NCBI gene;Acc:101... [more]
coq72.385e-5259.84coenzyme Q7, hydroxylase [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of 5-demethoxyubiquinone hydroxylase, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000079448.11.199e-13398.90SMESG000079448.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026668 ID=SMED30026668|Name=5-demethoxyubiquinone hydroxylase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=690bp
TTTAAATAATCGAAATTTAAATGGCATCTAGAATGTCTGTTAAGACAAGA
GCTCTAATTGACAGAGTAACTAGGGTTAATCATGCTGGGGAATTTGGTGC
TAATAGAATATATGAAGGACAACTTGCTATTTTAAAAGGAACTGATGCAG
AGCCTATAATTCAACATATGTTAGATCAAGAAAAGGTTCATTTGCAAAAA
TTTGAAGAATTAATACCAAAGTACAAAACCAGACCAACAATATTAATGCC
TATTTGGAATATAGCCGGTTTCGTTTTAGGAGCAGGGACAGCATTAATGG
GCAAAGAAGCTGCAATGGCATGCACTGTTGCTGTGGAGTCAGTTATTGGT
AAACATTATAACGATCAAATCAGAACGTTATTAGAAAATGATCCTGAATC
TCACAAAGAATTGATAGATGTTATTAAAAAATTCCGCGATGAAGAACTTG
AACATCATGACACTGGCTTACAGCAGAATGCTGAACAGGCACCATTTTAT
CAAATCCTATCATCAACGATTAAGATTGGTTGTAAAGCTGCAATTTTTCT
TTCAGAAAGGATTTAATTGGATATAAATTTTAATATTTTATGTTATAAAT
GTCTCTGTTTATGATATGCTGTATTTTCTGACTTTATTTTAGCACATTAA
TGTTCTCTGTTTTTACAAATCCATACATTTTAAAATCCAC
back to top

protein sequence of SMED30026668-orf-1

>SMED30026668-orf-1 ID=SMED30026668-orf-1|Name=SMED30026668-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=182bp
MASRMSVKTRALIDRVTRVNHAGEFGANRIYEGQLAILKGTDAEPIIQHM
LDQEKVHLQKFEELIPKYKTRPTILMPIWNIAGFVLGAGTALMGKEAAMA
CTVAVESVIGKHYNDQIRTLLENDPESHKELIDVIKKFRDEELEHHDTGL
QQNAEQAPFYQILSSTIKIGCKAAIFLSERI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR011566Ubq_synth_Coq7
IPR012347Ferritin-like
IPR009078Ferritin-like_SF
Vocabulary: biological process
TermDefinition
GO:0006744ubiquinone biosynthetic process
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0004497monooxygenase activity
GO:0016491oxidoreductase activity
GO:0016709oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
GO:0031314extrinsic component of mitochondrial inner membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011566Ubiquinone biosynthesis protein Coq7PFAMPF03232COQ7coord: 13..181
e-value: 3.6E-74
score: 248.2
IPR011566Ubiquinone biosynthesis protein Coq7PANTHERPTHR11237COENZYME Q10 BIOSYNTHESIS PROTEIN 7coord: 7..181
IPR011566Ubiquinone biosynthesis protein Coq7CDDcd01042DMQHcoord: 13..180
e-value: 9.40896E-85
score: 245.129
NoneNo IPR availablePANTHERPTHR11237:SF45-DEMETHOXYUBIQUINONE HYDROXYLASE, MITOCHONDRIALcoord: 7..181
IPR009078Ferritin-like superfamilySUPERFAMILYSSF47240Ferritin-likecoord: 21..152