Tropomyosin Tod p 1.0102

Overview
NameTropomyosin Tod p 1.0102
Smed IDSMED30026663
Length (bp)1311
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tropomyosin Tod p 1.0102 (SMED30026663) t-SNE clustered cells

Violin plots show distribution of expression levels for Tropomyosin Tod p 1.0102 (SMED30026663) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tropomyosin Tod p 1.0102 (SMED30026663) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tropomyosin Tod p 1.0102 (SMED30026663) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026663

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 29

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30026663SMESG000074053.1 dd_Smed_v4_405_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026663SMESG000074053.1 dd_Smed_v4_405_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026663SMESG000074053.1 dd_Smed_v4_405_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026663SMESG000074053.1 dd_Smed_v4_405_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30026663SMESG000074053.1 dd_Smed_v4_405_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026663SMESG000074053.1 dd_Smed_v4_405_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30026663SMESG000074053.1 dd_Smed_v4_405_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026663SMESG000074055.1 SMESG000074053.1 Contig19319newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026663SMESG000074055.1 SMESG000074053.1 Contig19319uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026663SMESG000074053.1 Contig25285newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026663SMESG000074053.1 Contig25285uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026663SMESG000074053.1 Contig22319newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026663SMESG000074053.1 Contig22319uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026663SMESG000074053.1 Contig22438newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026663SMESG000074053.1 Contig22438uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026663SMESG000074053.1 Contig22442newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026663SMESG000074053.1 Contig22442uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026663SMESG000074053.1 Contig26394newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026663SMESG000074053.1 Contig37337uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026663SMESG000074053.1 Contig37337newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026663SMESG000074053.1 Contig51672uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026663SMESG000074053.1 Contig51672newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30026663SMESG000074053.1 DN312526ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
gutSMED30026663SMESG000074053.1 DN312526ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
central nervous systemSMED30026663SMESG000074053.1 DN312526ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
musculature systemSMED30026663SMESG000074053.1 DN312526ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
musculature systemSMED30026663SMESG000074053.1 dd_Smed_v6_405_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30026663SMESG000074053.1 dd_Smed_v6_405_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30026663SMESG000074053.1 dd_Smed_v6_405_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Human
Match: TPM1 (tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010])

HSP 1 Score: 172.17 bits (435), Expect = 8.037e-50
Identity = 147/284 (51.76%), Postives = 200/284 (70.42%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  E+   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAEA+VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E+R+  D+EK+   E Q+KEAK+IAEDADRKY+EVARKL I E DLER E R E  E K  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ L+++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Human
Match: TPM1 (tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010])

HSP 1 Score: 171.785 bits (434), Expect = 9.823e-50
Identity = 147/284 (51.76%), Postives = 200/284 (70.42%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  E+   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAEA+VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E+R+  D+EK+   E Q+KEAK+IAEDADRKY+EVARKL I E DLER E R E  E K  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ L+++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Human
Match: TPM1 (tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010])

HSP 1 Score: 162.54 bits (410), Expect = 3.754e-46
Identity = 139/284 (48.94%), Postives = 199/284 (70.07%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  E+   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAEA+VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E+R+  D+EK+   E Q+KEAK+IAEDADRKY+EVARKL I E DLER E R E  E +  +LEE+L+++   +K+L  +E + +Q+E+ YE+ I+ L+++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Human
Match: TPM3 (tropomyosin 3 [Source:HGNC Symbol;Acc:HGNC:12012])

HSP 1 Score: 155.221 bits (391), Expect = 2.239e-43
Identity = 148/284 (52.11%), Postives = 203/284 (71.48%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            M+AIKKKM  +K++KENA D++   + + K+ EE   + ED +  +QK L+  + E D+  EAL +A  KLE  EK+A DAEAEVA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E DLERTE R E  ESK  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:    2 MEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDKYSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI 285          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Human
Match: TPM1 (tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010])

HSP 1 Score: 152.14 bits (383), Expect = 2.708e-42
Identity = 140/284 (49.30%), Postives = 191/284 (67.25%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  E+   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAEA+VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E+R+  D+EK+   E Q+KEAK+IAEDADRKY+EVARKL I E DLER E R E  E K  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ L+++LK AE RA  AER V+KL+  +D LE+ +   KE+  ++   LD    EL   
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEEKVAHAKEENLSMHQMLDQTLLELNNM 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Celegans
Match: lev-11 (Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Swiss-Prot;Acc:Q22866])

HSP 1 Score: 190.66 bits (483), Expect = 1.202e-57
Identity = 133/214 (62.15%), Postives = 169/214 (78.97%), Query Frame = 3
Query:  402 KLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            +LE   K+  DAEAEVAAL RRI L+E DLE+TE R + A++KLE+A+K A+E+++ RK +ETRS  D+E+   LE QV EAK IAEDADRKY+EVARKLA+ E DLER E R E  E+K +ELEEEL+VVGNN+KSLE+SE++A QRE+SYE+ IR ++ RLK AE RA  AER V KLQ EVDRLED+L+ EKE+YK +S+ELD+ F EL+G
Sbjct:   42 QLEEERKKREDAEAEVAALNRRIVLVEEDLERTEDRLKTATSKLEQATKAADEADRARKSMETRSQQDEERANFLETQVDEAKVIAEDADRKYEEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSSRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKTISEELDSTFQELSG 255          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Celegans
Match: lev-11 (Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Swiss-Prot;Acc:Q22866])

HSP 1 Score: 181.8 bits (460), Expect = 6.876e-54
Identity = 158/283 (55.83%), Postives = 213/283 (75.27%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            MDAIKKKM AMK+EK+NA D++ + + ++++  E+  + E+ +++ QK +     + D+AQE L+ A +KLE  EK   +AEAEVA+L RR+ L+E +LE+ E R + A+ KLEEA+ N +ESE+ RK +ETRS  D+E+   LE QV EAK IAEDADRKY+EVARKLA+ E DLER E R E  E+K +ELEEEL+VVGNN+KSLE+SE++A QRE+SYE+ IR ++ RLK AE RA  AER V KLQ EVDRLED+L+ EKE+YK +S+ELD+ F EL+G
Sbjct:    1 MDAIKKKMQAMKIEKDNALDRADAAEEKVRQITEKLERVEEELRDTQKKMTQTGDDLDKAQEDLSAATSKLEEKEKTVQEAEAEVASLNRRMTLLEEELERAEERLKIATEKLEEATHNVDESERARKSMETRSQQDEERANFLETQVDEAKVIAEDADRKYEEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSSRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKTISEELDSTFQELSG 283          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Celegans
Match: lev-11 (Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Swiss-Prot;Acc:Q22866])

HSP 1 Score: 181.8 bits (460), Expect = 6.876e-54
Identity = 154/283 (54.42%), Postives = 215/283 (75.97%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            MDAIKKKM AMK+EK+NA D++ + + ++++  E+  + E+ +++ QK +     + D+AQE L+ A +KLE  EK   +AEAEVA+L RR+ L+E +LE+ E R + A+ KLEEA+ N +ESE+ RK++E RS+ D+E+   +E Q+KEA+ +AE+ADRKYDEVARKLA+ E DLER E R E  E+K +ELEEEL+VVGNN+KSLE+SE++A QRE+SYE+ IR ++ RLK AE RA  AER V KLQ EVDRLED+L+ EKE+YK +S+ELD+ F EL+G
Sbjct:    1 MDAIKKKMQAMKIEKDNALDRADAAEEKVRQITEKLERVEEELRDTQKKMTQTGDDLDKAQEDLSAATSKLEEKEKTVQEAEAEVASLNRRMTLLEEELERAEERLKIATEKLEEATHNVDESERVRKVMENRSLQDEERANTVEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSSRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKTISEELDSTFQELSG 283          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Celegans
Match: lev-11 (Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Swiss-Prot;Acc:Q22866])

HSP 1 Score: 170.629 bits (431), Expect = 1.100e-49
Identity = 150/283 (53.00%), Postives = 212/283 (74.91%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            MDAIKKKM AMK+EK+NA D++ + + ++++  E+  + E+ +++ QK +     + D+AQE L+ A +KLE  EK   +AEAEVA+L RR+ L+E +LE+ E R + A+ KLEEA+ N +ESE+ RK++E RS+ D+E+   +E Q+KEA+ +AE+ADRKYDEVARKLA+ E DLER E R E  E+K +ELEEEL+VVGNN+KSLE+SE++A ++E+ + + IR L  RLK AE RA  AER V KLQ EVDRLED+L+ EKE+YK +S+ELD+ F EL+G
Sbjct:    1 MDAIKKKMQAMKIEKDNALDRADAAEEKVRQITEKLERVEEELRDTQKKMTQTGDDLDKAQEDLSAATSKLEEKEKTVQEAEAEVASLNRRMTLLEEELERAEERLKIATEKLEEATHNVDESERVRKVMENRSLQDEERANTVEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLELSEEKALEKEDIFAEQIRQLDFRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKTISEELDSTFQELSG 283          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Celegans
Match: lev-11 (Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Swiss-Prot;Acc:Q22866])

HSP 1 Score: 170.244 bits (430), Expect = 1.432e-49
Identity = 154/283 (54.42%), Postives = 210/283 (74.20%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            MDAIKKKM AMK+EK+NA D++ + + ++++  E+  + E+ +++ QK +     + D+AQE L+ A +KLE  EK   +AEAEVA+L RR+ L+E +LE+ E R + A+ KLEEA+ N +ESE+ RK +ETRS  D+E+   LE QV EAK IAEDADRKY+EVARKLA+ E DLER E R E  E+K +ELEEEL+VVGNN+KSLE+SE++A ++E+ + + IR L  RLK AE RA  AER V KLQ EVDRLED+L+ EKE+YK +S+ELD+ F EL+G
Sbjct:    1 MDAIKKKMQAMKIEKDNALDRADAAEEKVRQITEKLERVEEELRDTQKKMTQTGDDLDKAQEDLSAATSKLEEKEKTVQEAEAEVASLNRRMTLLEEELERAEERLKIATEKLEEATHNVDESERARKSMETRSQQDEERANFLETQVDEAKVIAEDADRKYEEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLELSEEKALEKEDIFAEQIRQLDFRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKTISEELDSTFQELSG 283          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Fly
Match: Tm1 (gene:FBgn0003721 transcript:FBtr0305654)

HSP 1 Score: 210.69 bits (535), Expect = 6.850e-65
Identity = 144/238 (60.50%), Postives = 184/238 (77.31%), Query Frame = 3
Query:  324 QELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAEL 1037
            ++LQK +QT + E D+ QEAL     KLE   K   +AE+EVAAL RRIQL+E DLE++E R   A+AKL EAS+ A+ESE+ RKILE R++AD+E++  LE Q+KEA+++AE+AD+KYDEVARKLA+ E DLER E R E  E+K +ELEEEL+VVGNN+KSLE+SE++A QREE Y++ I+ L  RLK AE RA  AER V KLQ EVDRLEDDL+ EKE+YK + D+LDTAF EL
Sbjct:   44 RQLQKKIQTVENELDQTQEALTLVTGKLEEKNKALQNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVEL 281          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Fly
Match: Tm1 (gene:FBgn0003721 transcript:FBtr0089964)

HSP 1 Score: 210.69 bits (535), Expect = 6.850e-65
Identity = 144/238 (60.50%), Postives = 184/238 (77.31%), Query Frame = 3
Query:  324 QELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAEL 1037
            ++LQK +QT + E D+ QEAL     KLE   K   +AE+EVAAL RRIQL+E DLE++E R   A+AKL EAS+ A+ESE+ RKILE R++AD+E++  LE Q+KEA+++AE+AD+KYDEVARKLA+ E DLER E R E  E+K +ELEEEL+VVGNN+KSLE+SE++A QREE Y++ I+ L  RLK AE RA  AER V KLQ EVDRLEDDL+ EKE+YK + D+LDTAF EL
Sbjct:   44 RQLQKKIQTVENELDQTQEALTLVTGKLEEKNKALQNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVEL 281          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Fly
Match: Tm1 (gene:FBgn0003721 transcript:FBtr0089967)

HSP 1 Score: 210.69 bits (535), Expect = 6.850e-65
Identity = 144/238 (60.50%), Postives = 184/238 (77.31%), Query Frame = 3
Query:  324 QELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAEL 1037
            ++LQK +QT + E D+ QEAL     KLE   K   +AE+EVAAL RRIQL+E DLE++E R   A+AKL EAS+ A+ESE+ RKILE R++AD+E++  LE Q+KEA+++AE+AD+KYDEVARKLA+ E DLER E R E  E+K +ELEEEL+VVGNN+KSLE+SE++A QREE Y++ I+ L  RLK AE RA  AER V KLQ EVDRLEDDL+ EKE+YK + D+LDTAF EL
Sbjct:   44 RQLQKKIQTVENELDQTQEALTLVTGKLEEKNKALQNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVEL 281          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Fly
Match: Tm1 (gene:FBgn0003721 transcript:FBtr0301959)

HSP 1 Score: 210.69 bits (535), Expect = 6.850e-65
Identity = 144/238 (60.50%), Postives = 184/238 (77.31%), Query Frame = 3
Query:  324 QELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAEL 1037
            ++LQK +QT + E D+ QEAL     KLE   K   +AE+EVAAL RRIQL+E DLE++E R   A+AKL EAS+ A+ESE+ RKILE R++AD+E++  LE Q+KEA+++AE+AD+KYDEVARKLA+ E DLER E R E  E+K +ELEEEL+VVGNN+KSLE+SE++A QREE Y++ I+ L  RLK AE RA  AER V KLQ EVDRLEDDL+ EKE+YK + D+LDTAF EL
Sbjct:   44 RQLQKKIQTVENELDQTQEALTLVTGKLEEKNKALQNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVEL 281          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Fly
Match: Tm1 (gene:FBgn0003721 transcript:FBtr0333918)

HSP 1 Score: 200.29 bits (508), Expect = 7.020e-61
Identity = 142/238 (59.66%), Postives = 180/238 (75.63%), Query Frame = 3
Query:  324 QELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAEL 1037
            ++LQK +QT + E D+ QEAL     KLE   K   +AE+EVAAL RRIQL+E DLE++E R   A+AKL EAS+ A+ESE+ RK LE R+  +D+K+A LE Q+ +AK IAE+AD+KY+EVARKLA+ E DLER E R E  E+K +ELEEEL+VVGNN+KSLE+SE++A QREE Y++ I+ L  RLK AE RA  AER V KLQ EVDRLEDDL+ EKE+YK + D+LDTAF EL
Sbjct:   44 RQLQKKIQTVENELDQTQEALTLVTGKLEEKNKALQNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERIRKALENRTNMEDDKVALLENQLAQAKLIAEEADKKYEEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVEL 281          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Zebrafish
Match: tpm1 (tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-040426-854])

HSP 1 Score: 173.711 bits (439), Expect = 1.228e-50
Identity = 148/284 (52.11%), Postives = 201/284 (70.77%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  E+   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAE +VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E +LERTE R E  ESK  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L S+K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEGDKKAAEDRSKQLEDDLLALQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELNESKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSI 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Zebrafish
Match: tpm1 (tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-040426-854])

HSP 1 Score: 173.326 bits (438), Expect = 1.550e-50
Identity = 148/284 (52.11%), Postives = 201/284 (70.77%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  E+   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAE +VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E +LERTE R E  ESK  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L S+K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEGDKKAAEDRSKQLEDDLLALQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELNESKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSM 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Zebrafish
Match: tpm3 (tropomyosin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-16])

HSP 1 Score: 171.4 bits (433), Expect = 8.948e-50
Identity = 130/244 (53.28%), Postives = 178/244 (72.95%), Query Frame = 3
Query:  315 DAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            D + ++QK L+  + E D+  EAL +A  KLE +EK+A DAEAEVA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E +LERTE R E  ESK  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:   41 DELIQMQKKLKGTEDELDKYSEALKDAQEKLEISEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELAESKCAELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Zebrafish
Match: tpma (alpha-tropomyosin [Source:NCBI gene;Acc:30324])

HSP 1 Score: 170.629 bits (431), Expect = 2.149e-49
Identity = 147/284 (51.76%), Postives = 199/284 (70.07%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  EE   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAE +VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E +LERTE R E  E K  ELEEELK V NNMKSLE   ++ + +E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAETDKKAAEERSKQLEDDLVALQKKLKATEDELDKYSEALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELNEGKCSELEEELKTVTNNMKSLEAQAEKYSAKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Zebrafish
Match: tpm1 (tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-040426-854])

HSP 1 Score: 155.221 bits (391), Expect = 1.186e-43
Identity = 141/284 (49.65%), Postives = 195/284 (68.66%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  E+   + ED + +L+K L+  + E D+  E       KL   E+ AT AE +VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E +LERTE R E  ESK  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L S+K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEGDKKAAEDRSKQLEDELIQLEKRLRVTEDERDKVLEEYQSVEEKLLTAEEVATKAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELNESKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSM 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Xenopus
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:448541])

HSP 1 Score: 172.94 bits (437), Expect = 3.064e-50
Identity = 148/284 (52.11%), Postives = 201/284 (70.77%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  EE+  + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAE +VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E DLER E R E  ESK  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKGAEEKSKQLEDELVALQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAEERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Xenopus
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:448541])

HSP 1 Score: 172.94 bits (437), Expect = 5.041e-50
Identity = 148/284 (52.11%), Postives = 201/284 (70.77%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  EE+  + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAE +VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E DLER E R E  ESK  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:   13 MDAIKKKMQMLKLDKENALDRAEQAEADKKGAEEKSKQLEDELVALQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAEERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSM 296          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Xenopus
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:448541])

HSP 1 Score: 157.532 bits (397), Expect = 1.892e-44
Identity = 141/284 (49.65%), Postives = 196/284 (69.01%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  EE+  + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAE +VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E DLE   +      S+   LEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKGAEEKSKQLEDELVALQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLELCFSSF----SEINTLEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSM 280          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Xenopus
Match: gucy2d (guanylate cyclase 2D, membrane (retina-specific) [Source:Xenbase;Acc:XB-GENE-1014102])

HSP 1 Score: 150.984 bits (380), Expect = 7.902e-42
Identity = 143/283 (50.53%), Postives = 200/283 (70.67%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            M+AIKKKM  +K++KENA D++   +   K  E++  + ED +  LQK L+  + E D+  EAL +A  KLE  +K+ATDAE EVAAL RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E +LER E R E  E K  +LEEELK V NN+KSLE   ++ +++E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T 
Sbjct:    1 MEAIKKKMQMLKLDKENAIDRAEQAEADKKAAEDKCKQVEDELVALQKKLKGTEDELDKYSEALKDAQEKLEQADKKATDAEGEVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQELQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCSDLEEELKNVTNNLKSLEAQSEKYSEKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTS 283          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Xenopus
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:448541])

HSP 1 Score: 149.443 bits (376), Expect = 7.850e-41
Identity = 123/243 (50.62%), Postives = 165/243 (67.90%), Query Frame = 3
Query:  315 DAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            D +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAE +VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E DLER E R E  ESK  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LE+ +   KE+   +   LD    EL  
Sbjct:   90 DELVALQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAEERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEEKVTHAKEENLNMHQMLDQTLLELNN 332          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Mouse
Match: Tpm1 (tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98809])

HSP 1 Score: 172.555 bits (436), Expect = 4.193e-50
Identity = 147/284 (51.76%), Postives = 200/284 (70.42%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  E+   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAEA+VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E+R+  D+EK+   E Q+KEAK+IAEDADRKY+EVARKL I E DLER E R E  E K  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ L+++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Mouse
Match: Tpm1 (tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98809])

HSP 1 Score: 172.17 bits (435), Expect = 5.071e-50
Identity = 147/284 (51.76%), Postives = 200/284 (70.42%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  E+   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAEA+VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E+R+  D+EK+   E Q+KEAK+IAEDADRKY+EVARKL I E DLER E R E  E K  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ L+++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Mouse
Match: Tpm1 (tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98809])

HSP 1 Score: 162.925 bits (411), Expect = 1.784e-46
Identity = 139/284 (48.94%), Postives = 199/284 (70.07%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  E+   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAEA+VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E+R+  D+EK+   E Q+KEAK+IAEDADRKY+EVARKL I E DLER E R E  E +  +LEE+L+++   +K+L  +E + +Q+E+ YE+ I+ L+++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Mouse
Match: Tpm1 (tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98809])

HSP 1 Score: 157.147 bits (396), Expect = 2.538e-44
Identity = 142/280 (50.71%), Postives = 193/280 (68.93%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAE 1034
            MDAIKKKM  +K++KENA D++   +   K  E+   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAEA+VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E+R+  D+EK+   E Q+KEAK+IAEDADRKY+EVARKL I E DLER E R E  E K  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ L+++LK AE RA  AER V+KL+  +D LED L  + E+ + L++EL  A  E
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDQLYHQLEQNRRLTNELKLALNE 280          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Mouse
Match: Tpm3 (tropomyosin 3, gamma [Source:MGI Symbol;Acc:MGI:1890149])

HSP 1 Score: 156.377 bits (394), Expect = 5.658e-44
Identity = 132/244 (54.10%), Postives = 176/244 (72.13%), Query Frame = 3
Query:  315 DAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            D +  +QK L+  + E D+  EAL +A  KLE  EK+A DAEAEVA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E DLERTE R E  ESK  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+SDELD A  ++T  
Sbjct:   41 DELATMQKKLKGTEDELDKYSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISDELDHALNDMTSI 284          
BLAST of Tropomyosin Tod p 1.0102 vs. UniProt/SwissProt
Match: sp|P42637|TPM1_SCHMA (Tropomyosin-1 OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 3.606e-87
Identity = 184/239 (76.99%), Postives = 204/239 (85.36%), Query Frame = 3
Query:  327 ELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            EL   ++ AQ +CDEAQE L E   KLE T+KRAT+AEAEVAA+TRRI+L+E DLE + SR  E   KLEEASK AEESE+ RK LE RSIADDE+L QLE+Q KEAKYIAEDADRKYDE ARKLAIAEVD ER EARLE  ESK +ELEEEL+VVGNNMK+LEISEQE+AQREESYE+TIRDLTERLKAAEQRATEAERQVSKLQ+EVD LEDDLL+EKE+YKALS ELD  FAELTG
Sbjct:   45 ELNNKMKQAQIDCDEAQETLQEQMNKLEETDKRATNAEAEVAAMTRRIRLLEEDLEVSSSRLTETLTKLEEASKTAEESERGRKDLEIRSIADDERLNQLEDQQKEAKYIAEDADRKYDEAARKLAIAEVDFERAEARLEAAESKIVELEEELRVVGNNMKALEISEQESAQREESYEETIRDLTERLKAAEQRATEAERQVSKLQNEVDHLEDDLLAEKERYKALSGELDQTFAELTG 283          
BLAST of Tropomyosin Tod p 1.0102 vs. UniProt/SwissProt
Match: sp|O16127|TPM_ECHGR (Tropomyosin A (Fragment) OS=Echinococcus granulosus OX=6210 PE=2 SV=3)

HSP 1 Score: 269.24 bits (687), Expect = 7.600e-87
Identity = 175/242 (72.31%), Postives = 206/242 (85.12%), Query Frame = 3
Query:  321 MQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            M +    ++  QTE D  QE+L EA +KLE TEKRAT+AEAEVAA+TRRI+L+E D EQ+  R  E S KL++ASK AEESE+NRK LETRSI+DDE++AQLEEQVKEAKYIAEDA+RKYDE AR+LA+ EVDLER E+RLE  ESK +ELEEEL++VGNNMKSLE+SEQE+ QREESYE+TIRDLTERLK AEQRA EAERQVSKLQ+EVDRLED+LLSEKE+Y+A+S ELDT FAELT  
Sbjct:   37 MNDWLSKVKNIQTEVDTVQESLQEAISKLEETEKRATNAEAEVAAMTRRIRLLEEDFEQSSGRLTETSTKLDDASKAAEESERNRKTLETRSISDDERMAQLEEQVKEAKYIAEDAERKYDEAARRLAVTEVDLERAESRLETSESKIVELEEELRIVGNNMKSLEVSEQESLQREESYEETIRDLTERLKTAEQRAAEAERQVSKLQNEVDRLEDELLSEKERYRAISGELDTTFAELTSF 278          
BLAST of Tropomyosin Tod p 1.0102 vs. UniProt/SwissProt
Match: sp|Q95PU1|TPM_ECHMU (Tropomyosin OS=Echinococcus multilocularis OX=6211 PE=2 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 9.342e-87
Identity = 175/242 (72.31%), Postives = 206/242 (85.12%), Query Frame = 3
Query:  321 MQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            M +    ++  QTE D  QE+L EA +KLE TEKRAT+AEAEVAA+TRRI+L+E D EQ+  R  E S KL++ASK AEESE+NRK LETRSI+DDE++AQLEEQVKEAKYIAEDA+RKYDE AR+LA+ EVDLER E+RLE  ESK +ELEEEL++VGNNMKSLE+SEQE+ QREESYE+TIRDLTERLK AEQRA EAERQVSKLQ+EVDRLED+LLSEKE+Y+A+S ELDT FAELT  
Sbjct:   43 MNDWLSKVKNIQTEVDTVQESLQEAISKLEETEKRATNAEAEVAAMTRRIRLLEEDFEQSSGRLTETSTKLDDASKAAEESERNRKTLETRSISDDERMAQLEEQVKEAKYIAEDAERKYDEAARRLAVTEVDLERAESRLETSESKIVELEEELRIVGNNMKSLEVSEQESLQREESYEETIRDLTERLKTAEQRAAEAERQVSKLQNEVDRLEDELLSEKERYRAISGELDTTFAELTSF 284          
BLAST of Tropomyosin Tod p 1.0102 vs. UniProt/SwissProt
Match: sp|Q26519|TPM_SCHJA (Tropomyosin OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.052e-86
Identity = 183/241 (75.93%), Postives = 204/241 (84.65%), Query Frame = 3
Query:  321 MQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            + EL   ++ AQ +CDE QE L E   KLE TEKRAT+AEA+VAA+TRRI+L+E DLE + SR  E   KLEEASK AEESE+ RK LE RSIADDE+L QLE+Q KEAKYIAEDADRKYDE ARKLAIAEVD ER EARLE  ESK +ELEEEL+VVGNNMK+LEISEQE+AQREESYE+TIRDLTERLKAAEQRATEAERQVSKLQ+EVD LEDDLL+EKE+YKALS ELD  FAELTG
Sbjct:   43 ISELNTKMKQAQIDCDEVQETLQEQMNKLEETEKRATNAEAQVAAMTRRIRLLEEDLEVSSSRLTETLTKLEEASKTAEESERGRKDLEIRSIADDERLNQLEDQQKEAKYIAEDADRKYDEAARKLAIAEVDFERAEARLEAAESKIVELEEELRVVGNNMKALEISEQESAQREESYEETIRDLTERLKAAEQRATEAERQVSKLQNEVDHLEDDLLAEKERYKALSGELDQTFAELTG 283          
BLAST of Tropomyosin Tod p 1.0102 vs. UniProt/SwissProt
Match: sp|Q26503|TPM_SCHHA (Tropomyosin OS=Schistosoma haematobium OX=6185 PE=2 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 9.872e-86
Identity = 181/239 (75.73%), Postives = 203/239 (84.94%), Query Frame = 3
Query:  327 ELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            EL   ++ AQ +CDE QE L E   KLE T+KRAT+AEAEVAA+TRRI+L+E DLE + SR  E   KLEEASK AEESE+ RK LE RSIADDE+L QLE+Q KEAKYIAEDADRKYDE ARKLAIAEVD +R EARLE  ESK +ELEEEL+V+GNNMK+LEISEQE+AQREESYE+TIRDLTERLKAAEQRATEAERQVSKLQ+EVD LEDDLL+EKE+YKALS ELD  FAELTG
Sbjct:   45 ELNTKMKQAQIDCDEVQETLQEQMNKLEETDKRATNAEAEVAAMTRRIRLLEEDLEVSSSRLTETLTKLEEASKTAEESERGRKDLEIRSIADDERLNQLEDQQKEAKYIAEDADRKYDEAARKLAIAEVDFKRAEARLEAAESKIVELEEELRVIGNNMKALEISEQESAQREESYEETIRDLTERLKAAEQRATEAERQVSKLQNEVDHLEDDLLAEKERYKALSGELDQTFAELTG 283          
BLAST of Tropomyosin Tod p 1.0102 vs. TrEMBL
Match: A0A267FJJ9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001652g1 PE=4 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.362e-89
Identity = 213/283 (75.27%), Postives = 244/283 (86.22%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            MDAIKKKMLAMK++KENA D++  ++ +LKEKE+E  K+E+ M ELQK     Q E D AQE+LA ANT LEATEKRA DAEAEV ALTRRI+LIE DLEQTE+R  EA+ KLEEASK A+ESE+ RK+LE RSIADDE++  LEEQ+KEAKYIAEDADRKYDE ARKLAI E DLER E+RLE+ ESK LELEEEL+VVG+NMKSLEISEQEAAQREESYE+TIRDL+ERLK AEQRATEAERQV+KLQSEVDRLED+LLSEKE+YK +S+ELD  FAELTG
Sbjct:    1 MDAIKKKMLAMKLDKENAMDRADQVETKLKEKEDEMTKKEEEMGELQKKFSQLQQELDTAQESLAGANTNLEATEKRANDAEAEVQALTRRIRLIEEDLEQTETRLTEATQKLEEASKAADESERGRKVLENRSIADDERINTLEEQLKEAKYIAEDADRKYDEAARKLAITEGDLERAESRLESAESKILELEEELRVVGSNMKSLEISEQEAAQREESYEETIRDLSERLKTAEQRATEAERQVAKLQSEVDRLEDELLSEKERYKGISEELDQTFAELTG 283          
BLAST of Tropomyosin Tod p 1.0102 vs. TrEMBL
Match: A0A267GDX8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001652g4 PE=4 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 5.816e-89
Identity = 212/283 (74.91%), Postives = 244/283 (86.22%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            MDAIKKKMLAMK++KENA D++  ++ +LKEKE+E  K+E+ M ELQK     Q E D AQE+LA ANT LEATEKRA DAEAEV ALTRRI+LIE DLEQTE+R  EA+ KLEEASK A+ESE+ RK+LE RSIADDE++  LEEQ+KEAKYIAEDADRKYDE ARKLAI E DLER E+RLE+ ESK LELEEEL+VVG+NMKSLEISEQEAAQREESYE+TIR+L+ERLK AEQRATEAERQV+KLQSEVDRLED+LLSEKE+YK +S+ELD  FAELTG
Sbjct:    1 MDAIKKKMLAMKLDKENAMDRADQVETKLKEKEDEMTKKEEEMGELQKKFSQLQQELDTAQESLAGANTNLEATEKRANDAEAEVQALTRRIRLIEEDLEQTETRLTEATQKLEEASKAADESERGRKVLENRSIADDERINTLEEQLKEAKYIAEDADRKYDEAARKLAITEGDLERAESRLESAESKILELEEELRVVGSNMKSLEISEQEAAQREESYEETIRNLSERLKTAEQRATEAERQVAKLQSEVDRLEDELLSEKERYKGISEELDQTFAELTG 283          
BLAST of Tropomyosin Tod p 1.0102 vs. TrEMBL
Match: A0A267FWC7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001499g1 PE=4 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 2.932e-87
Identity = 184/239 (76.99%), Postives = 208/239 (87.03%), Query Frame = 3
Query:  327 ELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            E+QK  Q  Q + D AQE+L   NT LE TEKRA+DAEAEV ALTRRI+LIE DLEQTE R QEA+ KLEEASK A+ESE+ RK+LETRSIAD+E++  LEEQ+KEAK+IAEDADRKYDE ARKLAI EVDLER E+RLE  ESK LELEEEL+VVG+NMKSLEISEQEAAQREESYE+TIRDL+ERLKAAEQRA EAERQVSKLQSEVDRLED+LLSEK++YK +S+ELD  FAELTG
Sbjct:   45 EMQKKFQQLQQDLDTAQESLTTTNTNLEGTEKRASDAEAEVQALTRRIRLIEEDLEQTEGRLQEATQKLEEASKAADESERGRKVLETRSIADEERVNTLEEQLKEAKFIAEDADRKYDEAARKLAITEVDLERAESRLEAAESKILELEEELRVVGSNMKSLEISEQEAAQREESYEETIRDLSERLKAAEQRAQEAERQVSKLQSEVDRLEDELLSEKDRYKGISEELDQTFAELTG 283          
BLAST of Tropomyosin Tod p 1.0102 vs. TrEMBL
Match: A0A267E821 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014037g1 PE=4 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 5.320e-87
Identity = 184/241 (76.35%), Postives = 209/241 (86.72%), Query Frame = 3
Query:  321 MQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            M E+QK  Q  Q + D AQE+ +  NT LE TEKRA+DAEAEV ALTRRI+LIE DLEQTE R QEA+ KLEEASK A+ESE+ RK+LETRSIAD+E++  LEEQ+KEAK+IAEDADRKYDE ARKLAI EVDLER E+RLE  ESK LELEEEL+VVG+NMKSLEISEQEAAQREESYE+TIRDL+ERLKAAEQRA EAERQVSKLQSEVDRLED+LLSEK++YK +S+ELD  FAELTG
Sbjct:    8 MGEMQKKFQQLQQDLDTAQES-SHTNTNLEGTEKRASDAEAEVQALTRRIRLIEEDLEQTEGRLQEATQKLEEASKAADESERGRKVLETRSIADEERVNTLEEQLKEAKFIAEDADRKYDEAARKLAITEVDLERAESRLEAAESKILELEEELRVVGSNMKSLEISEQEAAQREESYEETIRDLSERLKAAEQRAQEAERQVSKLQSEVDRLEDELLSEKDRYKGISEELDQTFAELTG 247          
BLAST of Tropomyosin Tod p 1.0102 vs. TrEMBL
Match: E3TF21 (Tropomyosin OS=Ictalurus punctatus OX=7998 GN=TPM PE=2 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 1.176e-85
Identity = 172/242 (71.07%), Postives = 209/242 (86.36%), Query Frame = 3
Query:  321 MQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            M E+Q  ++T Q E D  QE+L EA +KLE TEKRAT+AEAEVAA+TRRI+L+E DLEQ+  R  + S+KL++ASK AEESE++RK LETRSI+DDE++AQLE+QVKEAKYIAEDA+RKYDE AR+LA+ EVDLER E+RLE  ESK +ELEEEL++VGNNMKSLE+SEQE+AQREESYE+TIRDLTERLK AEQRA EA+RQVSKLQ+EVDRLED+LLSEKE+++ +  ELDT FAELT  
Sbjct:   43 MNEMQTKVKTIQAEVDTVQESLQEATSKLEETEKRATNAEAEVAAMTRRIRLLEEDLEQSGGRLTDTSSKLDDASKAAEESERSRKTLETRSISDDERMAQLEDQVKEAKYIAEDAERKYDEAARRLAVTEVDLERAESRLETSESKIVELEEELRIVGNNMKSLEVSEQESAQREESYEETIRDLTERLKLAEQRAAEADRQVSKLQNEVDRLEDELLSEKERFRGIGGELDTTFAELTSF 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Cavefish
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:103046255])

HSP 1 Score: 169.859 bits (429), Expect = 2.777e-49
Identity = 146/284 (51.41%), Postives = 200/284 (70.42%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  E+   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAE +VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E +LERTE R E  ESK  ELEEELK V N +KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEGDKKAAEDRSKQLEDDLVALQKKLKATEDELDKYSEALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELSESKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Cavefish
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:103046255])

HSP 1 Score: 169.859 bits (429), Expect = 2.777e-49
Identity = 146/284 (51.41%), Postives = 200/284 (70.42%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  E+   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAE +VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E +LERTE R E  ESK  ELEEELK V N +KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEGDKKAAEDRSKQLEDDLVALQKKLKATEDELDKYSEALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELSESKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Cavefish
Match: tpma (tropomyosin alpha-1 chain [Source:NCBI gene;Acc:103040917])

HSP 1 Score: 168.318 bits (425), Expect = 1.295e-48
Identity = 146/284 (51.41%), Postives = 199/284 (70.07%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   +   K  E+   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAE +VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E +LERTE R E  E K  ELEEELK V N +KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L S+K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAEGDKKAAEDRSKQLEDDLVALQKKLKATEDELDKYSEALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELNEGKCSELEEELKTVTNLLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSI 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Cavefish
Match: tpm2 (tropomyosin 2 (beta) [Source:ZFIN;Acc:ZDB-GENE-040625-114])

HSP 1 Score: 164.081 bits (414), Expect = 4.896e-47
Identity = 127/237 (53.59%), Postives = 173/237 (73.00%), Query Frame = 3
Query:  330 LQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELT 1040
            LQK L+  + E D+  E+L +A  KLE  EK+ATDAEAEVA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R+  D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E DLER+E R E  E+K+ +LEEELK V NN+KSLE   ++ + +E+ YE+ I+ LTE+LK AE RA  AER V+KL+  +D LED++ ++K K KALS+ELD A  ++T
Sbjct:   46 LQKKLKGVEDELDKYSESLKDAQEKLEQAEKKATDAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRATKDEEKMELQEMQLKEAKHIAEEADRKYEEVARKLVILEGDLERSEERAEVAEAKSGDLEEELKNVTNNLKSLEAQAEKYSTKEDKYEEEIKVLTEKLKEAETRAEFAERSVAKLEKTIDDLEDEVYAQKLKGKALSEELDLALNDMT 282          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Cavefish
Match: tpm4a (tropomyosin alpha-1 chain [Source:NCBI gene;Acc:103036175])

HSP 1 Score: 149.443 bits (376), Expect = 3.233e-41
Identity = 125/243 (51.44%), Postives = 174/243 (71.60%), Query Frame = 3
Query:  315 DAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            D +  LQK L+  + E D+  EAL +A  KLE +EK+A DAE +VAAL RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E +LER E R E  E K  +LEEELK V NN+KSLE   ++ +++E+ YE+ I+ L+++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T 
Sbjct:   70 DELMALQKKLKQTEDELDKYSEALKDAQEKLELSEKKAADAEGDVAALNRRIQLVEEELDRAQERLTTALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSECKASDLEEELKNVTNNLKSLEAQAEKYSEKEDKYEEEIKVLSDKLKEAETRAEFAERTVAKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTS 312          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Sea Lamprey
Match: TPM4 (tropomyosin 4 [Source:HGNC Symbol;Acc:HGNC:12013])

HSP 1 Score: 144.821 bits (364), Expect = 2.441e-41
Identity = 109/204 (53.43%), Postives = 155/204 (75.98%), Query Frame = 3
Query:  435 AEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            AEA+VA+L RRIQL+E +L++ + R   A  KLEEA+K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E +LERTE R E  E++  +LEEEL+V+  NMKSL ++E++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L S+K KYKA+S+ELD A  ++T  
Sbjct:    3 AEADVASLNRRIQLVEEELDRAQERLATALQKLEEATKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGELERTEERAEVGETRVRQLEEELRVMDQNMKSLLVAEEQYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTAI 206          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Sea Lamprey
Match: tpm3 (tropomyosin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-16])

HSP 1 Score: 139.813 bits (351), Expect = 1.709e-39
Identity = 109/204 (53.43%), Postives = 151/204 (74.02%), Query Frame = 3
Query:  435 AEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            AEA+VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R+  D+EK+   E Q+KEAK+IAE++DRKY+EVARKL I E DLERTE R E  ++K  ELEEELKVV NN+KSLE    + +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED++ ++K KYK++S+ELD A  ++T  
Sbjct:    2 AEADVASLNRRIQLVEEELDRAQERLSTALQKLEEAEKAADESERGMKVIENRASKDEEKMELQEIQLKEAKHIAEESDRKYEEVARKLVILEGDLERTEERAEVADAKCSELEEELKVVTNNLKSLEAQSDKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKSIDDLEDEVYAQKLKYKSVSEELDLALNDMTSI 205          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Sea Lamprey
Match: TPM4 (tropomyosin 4 [Source:HGNC Symbol;Acc:HGNC:12013])

HSP 1 Score: 108.997 bits (271), Expect = 1.987e-28
Identity = 91/177 (51.41%), Postives = 130/177 (73.45%), Query Frame = 3
Query:  435 AEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLE 965
            AEA+VA+L RRIQL+E +L++ + R   A  KLE+A K A+ESE+  K++E R+  D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E DLERTE R E  E++  ++E+EL+ V   ++SL  SE++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LE
Sbjct:    2 AEADVASLNRRIQLVEEELDRAQERLTTALQKLEDAEKAADESERGMKVIENRAGKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAEISETRVRQMEDELRHVQEELRSLFASEEQYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLE 178          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009404.1 (pep scaffold:Pmarinus_7.0:GL481466:589:9607:1 gene:ENSPMAG00000008509.1 transcript:ENSPMAT00000009404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 1.146e-11
Identity = 52/120 (43.33%), Postives = 77/120 (64.17%), Query Frame = 3
Query:  684 EVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            +VARKL + E DLER E R ++ E+K   LEE+LK + N++KSL    +E +Q+E+ +E+ I+ L+E+LK  EQRA  AER V KL++ +D LE+ L   KE+   ++  LD    EL  
Sbjct:    2 QVARKLIVLESDLERAEERADHAETKCSALEEDLKNMTNDLKSLMAQNEEYSQKEDKFEEEIKVLSEKLKEVEQRAEYAERTVVKLENSIDDLEEQLARAKEENLGINQVLDQTLLELNN 121          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003430.1 (pep scaffold:Pmarinus_7.0:GL477772:12496:42818:-1 gene:ENSPMAG00000003137.1 transcript:ENSPMAT00000003430.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 2.379e-11
Identity = 49/157 (31.21%), Postives = 96/157 (61.15%), Query Frame = 3
Query:  576 KILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            +++E+R++ + ++L + E+Q++EAK IAE+ADRK++E   K    E ++++ +   ++ E +  +LEEEL++    ++SL+  E++   +E   ED ++ L  +L+  E RA   +R V+KL+ +VD +E+ L+  KE+   ++  LD    EL   
Sbjct:   81 RVIESRAVKELQRLGRQEDQLREAKMIAENADRKFEEATNKFVHLESEMDKLDDHAKHSEFRAKQLEEELRLKSAQLQSLKAGEKKYVLKENKCEDELKMLRSKLREYENRADVGQRNVTKLEQQVDYMEEQLIKAKEENMEINRVLDQTLNELNSI 237          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Nematostella
Match: EDO37230 (Predicted protein; Tropomyosin [Source:UniProtKB/TrEMBL;Acc:Q6S5G5])

HSP 1 Score: 95.5153 bits (236), Expect = 1.234e-22
Identity = 97/240 (40.42%), Postives = 166/240 (69.17%), Query Frame = 3
Query:  321 MQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELT 1040
            M+ ++K + T +   ++A+   A+A  +L+    RA  AE EVAALT+++Q +E DL+  ES+  +   +L EA K A+ESE+ RK+LE R  +D+E+LA LE Q  +A    E+A+++Y+E++ +L   E +LE  E + +  E++  ELEEE+ +VGNN++SLEISE +A++RE++YE+ IR+L  +L+ AE+RA +AE++V +L+++ + +E +L   KE+Y+ + +ELD+  AEL+
Sbjct:    1 METIKKKMATLRQTLEDAEARAAKAEDELKNANDRADSAETEVAALTKQLQQLEDDLDAAESKLADTQGQLTEAEKQADESERARKVLENRGASDEERLASLERQYNDALERTEEAEKQYEEISERLQELENELEEAEQKADAAEARVKELEEEVTLVGNNLRSLEISEGKASEREDTYENQIRELETKLQDAEERAEKAEQKVQELEAQAEAMEAELEKAKEQYEKVKEELDSTLAELS 240          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Nematostella
Match: EDO39668 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9G3])

HSP 1 Score: 46.595 bits (109), Expect = 6.411e-6
Identity = 50/163 (30.67%), Postives = 86/163 (52.76%), Query Frame = 3
Query:  405 LEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLK 893
            L+  E+RA   E+++ ++ +RI L+  DL++T   ++E  A+L+   +  E      + LE+  +  DE+LA+LEE+ KEA       +    E+ +K+ + E +L +   RLE        LE  ++    NM SLE  + +A+Q E   E+ I  L E+LK
Sbjct:   29 LKDAEERAYQHESDLDSMQKRINLLSEDLDKTLEAYEEKKARLDSLEEKQESDGTVVRELESVELEGDERLAELEEKTKEAVATVNQKEHDNTEINQKIVVTETELSKVNERLERALETIERLEATIEEESTNMASLEQKDTDASQWEIEVEEKIGFLNEQLK 191          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Medaka
Match: ENSORLT00000015429.2 (tropomyosin alpha-1 chain [Source:NCBI gene;Acc:101164789])

HSP 1 Score: 174.866 bits (442), Expect = 4.212e-51
Identity = 148/284 (52.11%), Postives = 201/284 (70.77%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   ++  K  E+   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAE +VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E DLERTE R E  E K  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L S+K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAESDKKASEDRSKQLEDDLVALQKKLKATEDELDKYSEALKDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESERGMKVIENRAMKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKCSELEEELKTVQNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSI 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Medaka
Match: TPM1 (tropomyosin 1 [Source:NCBI gene;Acc:101168205])

HSP 1 Score: 171.4 bits (433), Expect = 9.210e-50
Identity = 147/284 (51.76%), Postives = 201/284 (70.77%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKM  +K++KENA D++   ++  K  E+   + ED +  LQK L+  + E D+  EAL +A  KLE  EK+ATDAE++VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E DLERTE R E  E K  ELEEELK V NN+KSLE   ++ + +E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L S+K KYKA+S+ELD A  ++T  
Sbjct:    1 MDAIKKKMQMLKLDKENALDRAEQAESDKKAAEDRSKQLEDDLVALQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAESDVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSLKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSI 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Medaka
Match: tpm4a (tropomyosin 4 [Source:NCBI gene;Acc:101160801])

HSP 1 Score: 166.392 bits (420), Expect = 2.996e-47
Identity = 126/239 (52.72%), Postives = 171/239 (71.55%), Query Frame = 3
Query:  330 LQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            LQK L+  + E D+  E L +A  KLE  EK+A DAE +VAAL RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E DLER E R E  ESK  +LEEELK V NN+KSLE   ++ +++E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:  103 LQKKLKQTEDELDKFSEGLKDAQEKLELAEKKAADAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGDLERAEERAEVSESKASDLEEELKNVTNNLKSLEAQAEKYSEKEDKYEEEIKVLTDKLKEAETRAEFAERTVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSL 341          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Medaka
Match: ENSORLT00000013757.2 (tropomyosin 3 [Source:NCBI gene;Acc:101175579])

HSP 1 Score: 149.058 bits (375), Expect = 2.462e-41
Identity = 145/285 (50.88%), Postives = 205/285 (71.93%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKI-LETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            M+AIKKKML +K++KENA D++   +   K  E+   + ED + ++QK L++ + E D+  EAL +A  KLE  +K+A DAEAEVA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+ ++I +E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E +LERTE R E  E+K  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L ++K KYKA+S+ELD A  ++T  
Sbjct:    1 MEAIKKKMLMLKLDKENALDQAEQAEADRKAAEDRSKQHEDELLQMQKKLKSTEDELDKYSEALKDAQEKLEVADKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERRKEIVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELAEAKCAELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSM 285          
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Medaka
Match: ENSORLT00000046199.1 (tropomyosin alpha-1 chain [Source:NCBI gene;Acc:101164789])

HSP 1 Score: 147.517 bits (371), Expect = 3.129e-41
Identity = 119/243 (48.97%), Postives = 168/243 (69.14%), Query Frame = 3
Query:  318 AMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            +++ ++K +++ Q + D A+E  A+    L         AE +VA+L RRIQL+E +L++ + R   A  KLEEA K A+ESE+  K++E R++ D+EK+   E Q+KEAK+IAE+ADRKY+EVARKL I E DLERTE R E  E K  ELEEELK V NN+KSLE   ++ +Q+E+ YE+ I+ LT++LK AE RA  AER V+KL+  +D LED+L S+K KYKA+S+ELD A  ++T  
Sbjct:    6 SLEAVKKKIKSLQEQADAAEERAAQLQRDLNQERSAREAAEGDVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESERGMKVIENRAMKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKCSELEEELKTVQNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSI 248          
BLAST of Tropomyosin Tod p 1.0102 vs. Planmine SMEST
Match: SMESG000074053.1 (SMESG000074053.1)

HSP 1 Score: 394.045 bits (1011), Expect = 9.123e-137
Identity = 284/284 (100.00%), Postives = 284/284 (100.00%), Query Frame = 3
Query:  195 MDAIXXXXXXXXXXXXNAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            MDAIKKKMLAMKMEKENAGDKSRSLKNQLKEKEEEKVKQEDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQEASAKLEEASKNAEESEKNRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTLELEEELKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKAAEQRATEAERQVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC
Sbjct:    1 MDAIKKKMLAMKMEKENAGDKSRSLKNQLKEKEEEKVKQEDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQEASAKLEEASKNAEESEKNRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTLELEEELKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKAAEQRATEAERQVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 284          
BLAST of Tropomyosin Tod p 1.0102 vs. Planmine SMEST
Match: SMESG000074053.1 (SMESG000074053.1)

HSP 1 Score: 389.808 bits (1000), Expect = 3.782e-135
Identity = 268/268 (100.00%), Postives = 268/268 (100.00%), Query Frame = 3
Query:  243 NAGDKSRSXXXXXXXXXXXXXXXXDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            NAGDKSRSLKNQLKEKEEEKVKQEDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQEASAKLEEASKNAEESEKNRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTLELEEELKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKAAEQRATEAERQVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC
Sbjct:   10 NAGDKSRSLKNQLKEKEEEKVKQEDAMQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQEASAKLEEASKNAEESEKNRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTLELEEELKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKAAEQRATEAERQVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 277          
BLAST of Tropomyosin Tod p 1.0102 vs. Planmine SMEST
Match: SMESG000000190.1 (SMESG000000190.1)

HSP 1 Score: 280.411 bits (716), Expect = 4.196e-92
Identity = 180/241 (74.69%), Postives = 213/241 (88.38%), Query Frame = 3
Query:  321 MQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 1043
            MQELQK LQ  QT+C+ A+EAL E N+ LEATEKRA +AE EV A+T+R +L+E DLEQTE+R QEA+ K EEASK A+ESE+ RK+LETRSIAD+E+LAQLEEQ+KEAKYIAEDADRKYDE ARKLAI EVDLER E+RLE+ ++K LELEEEL+VVGNNMKSLEISEQEA QREE YE+TIRD T++LK+ EQRATEAERQV+ LQ+EVDR+ED+LL+EKEKYK LS+ELD+AFAELTG
Sbjct:   43 MQELQKKLQQVQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVLELEEELRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 283          
BLAST of Tropomyosin Tod p 1.0102 vs. Planmine SMEST
Match: SMESG000066854.1 (SMESG000066854.1)

HSP 1 Score: 258.84 bits (660), Expect = 6.771e-84
Identity = 169/234 (72.22%), Postives = 196/234 (83.76%), Query Frame = 3
Query:  345 QTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            Q  Q ECD+ Q AL+E N+K E TEKRATDAE+EVAAL RR+ L++ D+EQTE+RFQEAS KLE ASK A+ +EK RK +E +S  +DEKL  LE+QVKEAKYIAEDADRKY+E ARKLAI+ VDLERTE RLE+CE KT ELEEEL ++G NMK+LEISEQEA +REESYEDTIRD+TERLK +EQRA EAERQV+KL+SEVDRLEDDLL E E+YK LS ELD AFAELT C
Sbjct:   44 QIRQQECDKVQLALSEVNSKCEETEKRATDAESEVAALARRMVLLQTDIEQTENRFQEASEKLETASKLADINEKARKEIEVKSCLEDEKLNHLEQQVKEAKYIAEDADRKYEEAARKLAISAVDLERTETRLESCELKTAELEEELAIMGRNMKALEISEQEAMRREESYEDTIRDITERLKTSEQRAAEAERQVAKLESEVDRLEDDLLCEMERYKGLSGELDFAFAELTNC 277          
BLAST of Tropomyosin Tod p 1.0102 vs. Planmine SMEST
Match: SMESG000066854.1 (SMESG000066854.1)

HSP 1 Score: 259.225 bits (661), Expect = 7.140e-84
Identity = 169/234 (72.22%), Postives = 196/234 (83.76%), Query Frame = 3
Query:  345 QTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQXXXXXXXXXXXXXXXXXXXRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTXXXXXXXKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKXXXXXXXXXXXXVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC 1046
            Q  Q ECD+ Q AL+E N+K E TEKRATDAE+EVAAL RR+ L++ D+EQTE+RFQEAS KLE ASK A+ +EK RK +E +S  +DEKL  LE+QVKEAKYIAEDADRKY+E ARKLAI+ VDLERTE RLE+CE KT ELEEEL ++G NMK+LEISEQEA +REESYEDTIRD+TERLK +EQRA EAERQV+KL+SEVDRLEDDLL E E+YK LS ELD AFAELT C
Sbjct:   51 QIRQQECDKVQLALSEVNSKCEETEKRATDAESEVAALARRMVLLQTDIEQTENRFQEASEKLETASKLADINEKARKEIEVKSCLEDEKLNHLEQQVKEAKYIAEDADRKYEEAARKLAISAVDLERTETRLESCELKTAELEEELAIMGRNMKALEISEQEAMRREESYEDTIRDITERLKTSEQRAAEAERQVAKLESEVDRLEDDLLCEMERYKGLSGELDFAFAELTNC 284          
The following BLAST results are available for this feature:
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPM18.037e-5051.76tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010][more]
TPM19.823e-5051.76tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010][more]
TPM13.754e-4648.94tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010][more]
TPM32.239e-4352.11tropomyosin 3 [Source:HGNC Symbol;Acc:HGNC:12012][more]
TPM12.708e-4249.30tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010][more]
back to top
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lev-111.202e-5762.15Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Sw... [more]
lev-116.876e-5455.83Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Sw... [more]
lev-116.876e-5454.42Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Sw... [more]
lev-111.100e-4953.00Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Sw... [more]
lev-111.432e-4954.42Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Sw... [more]
back to top
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tm16.850e-6560.50gene:FBgn0003721 transcript:FBtr0305654[more]
Tm16.850e-6560.50gene:FBgn0003721 transcript:FBtr0089964[more]
Tm16.850e-6560.50gene:FBgn0003721 transcript:FBtr0089967[more]
Tm16.850e-6560.50gene:FBgn0003721 transcript:FBtr0301959[more]
Tm17.020e-6159.66gene:FBgn0003721 transcript:FBtr0333918[more]
back to top
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm11.228e-5052.11tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
tpm11.550e-5052.11tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
tpm38.948e-5053.28tropomyosin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-16][more]
tpma2.149e-4951.76alpha-tropomyosin [Source:NCBI gene;Acc:30324][more]
tpm11.186e-4349.65tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm13.064e-5052.11tropomyosin 1 [Source:NCBI gene;Acc:448541][more]
tpm15.041e-5052.11tropomyosin 1 [Source:NCBI gene;Acc:448541][more]
tpm11.892e-4449.65tropomyosin 1 [Source:NCBI gene;Acc:448541][more]
gucy2d7.902e-4250.53guanylate cyclase 2D, membrane (retina-specific) [... [more]
tpm17.850e-4150.62tropomyosin 1 [Source:NCBI gene;Acc:448541][more]
back to top
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tpm14.193e-5051.76tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98... [more]
Tpm15.071e-5051.76tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98... [more]
Tpm11.784e-4648.94tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98... [more]
Tpm12.538e-4450.71tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98... [more]
Tpm35.658e-4454.10tropomyosin 3, gamma [Source:MGI Symbol;Acc:MGI:18... [more]
back to top
BLAST of Tropomyosin Tod p 1.0102 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P42637|TPM1_SCHMA3.606e-8776.99Tropomyosin-1 OS=Schistosoma mansoni OX=6183 PE=2 ... [more]
sp|O16127|TPM_ECHGR7.600e-8772.31Tropomyosin A (Fragment) OS=Echinococcus granulosu... [more]
sp|Q95PU1|TPM_ECHMU9.342e-8772.31Tropomyosin OS=Echinococcus multilocularis OX=6211... [more]
sp|Q26519|TPM_SCHJA1.052e-8675.93Tropomyosin OS=Schistosoma japonicum OX=6182 PE=2 ... [more]
sp|Q26503|TPM_SCHHA9.872e-8675.73Tropomyosin OS=Schistosoma haematobium OX=6185 PE=... [more]
back to top
BLAST of Tropomyosin Tod p 1.0102 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FJJ91.362e-8975.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GDX85.816e-8974.91Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FWC72.932e-8776.99Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E8215.320e-8776.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
E3TF211.176e-8571.07Tropomyosin OS=Ictalurus punctatus OX=7998 GN=TPM ... [more]
back to top
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm12.777e-4951.41tropomyosin 1 [Source:NCBI gene;Acc:103046255][more]
tpm12.777e-4951.41tropomyosin 1 [Source:NCBI gene;Acc:103046255][more]
tpma1.295e-4851.41tropomyosin alpha-1 chain [Source:NCBI gene;Acc:10... [more]
tpm24.896e-4753.59tropomyosin 2 (beta) [Source:ZFIN;Acc:ZDB-GENE-040... [more]
tpm4a3.233e-4151.44tropomyosin alpha-1 chain [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPM42.441e-4153.43tropomyosin 4 [Source:HGNC Symbol;Acc:HGNC:12013][more]
tpm31.709e-3953.43tropomyosin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-16][more]
TPM41.987e-2851.41tropomyosin 4 [Source:HGNC Symbol;Acc:HGNC:12013][more]
ENSPMAT00000009404.11.146e-1143.33pep scaffold:Pmarinus_7.0:GL481466:589:9607:1 gene... [more]
ENSPMAT00000003430.12.379e-1131.21pep scaffold:Pmarinus_7.0:GL477772:12496:42818:-1 ... [more]
back to top
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO372301.234e-2240.42Predicted protein; Tropomyosin [Source:UniProtKB/... [more]
EDO396686.411e-630.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tropomyosin Tod p 1.0102 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000015429.24.212e-5152.11tropomyosin alpha-1 chain [Source:NCBI gene;Acc:10... [more]
TPM19.210e-5051.76tropomyosin 1 [Source:NCBI gene;Acc:101168205][more]
tpm4a2.996e-4752.72tropomyosin 4 [Source:NCBI gene;Acc:101160801][more]
ENSORLT00000013757.22.462e-4150.88tropomyosin 3 [Source:NCBI gene;Acc:101175579][more]
ENSORLT00000046199.13.129e-4148.97tropomyosin alpha-1 chain [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Tropomyosin Tod p 1.0102 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074053.19.123e-137100.00SMESG000074053.1[more]
SMESG000074053.13.782e-135100.00SMESG000074053.1[more]
SMESG000000190.14.196e-9274.69SMESG000000190.1[more]
SMESG000066854.16.771e-8472.22SMESG000066854.1[more]
SMESG000066854.17.140e-8472.22SMESG000066854.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026663 ID=SMED30026663|Name=Tropomyosin Tod p 1.0102|organism=Schmidtea mediterranea sexual|type=transcript|length=1311bp
CTTTCAGGTGCAAATATCTGATCCGATGTGTGCACACTGCCGATGGATCA
ACATAAACTGCGAGATTTAGTATTTTTATTTAAATATATTTGTGCTTGAA
AACAAAAATTTCAGCAAGTCAACAATATCCATAATTGATTTTTGATTCCA
ACTACTTCTGCTTTTGTTTCGATTAAGATTTTTACTTTCTCAATATGGAT
GCTATCAAGAAAAAGATGTTGGCAATGAAGATGGAGAAAGAAAATGCTGG
AGACAAGTCTAGATCACTGAAAAATCAGTTAAAAGAAAAAGAAGAGGAAA
AGGTCAAGCAAGAAGATGCCATGCAAGAACTACAAAAAGCATTACAGACT
GCGCAAACAGAATGTGATGAAGCTCAAGAAGCGCTTGCTGAGGCAAACAC
TAAACTTGAAGCAACTGAAAAACGAGCCACAGACGCTGAAGCAGAAGTAG
CCGCTTTAACTAGAAGAATTCAACTGATTGAAGCAGATCTTGAACAAACT
GAATCAAGATTTCAAGAAGCTTCAGCAAAACTAGAAGAAGCAAGCAAGAA
TGCAGAAGAAAGCGAAAAGAATAGAAAAATTTTGGAAACTCGATCAATTG
CTGATGATGAAAAATTAGCCCAATTAGAGGAGCAAGTAAAAGAAGCGAAG
TACATAGCTGAAGATGCTGATAGAAAATATGATGAAGTTGCTAGAAAATT
AGCAATTGCTGAAGTTGATTTAGAAAGAACCGAGGCTCGACTTGAAAACT
GTGAAAGTAAAACTCTTGAGTTGGAGGAAGAATTAAAAGTTGTTGGAAAC
AACATGAAATCCCTTGAAATATCGGAGCAAGAAGCTGCACAAAGAGAAGA
AAGTTATGAAGACACAATTCGTGACTTAACCGAAAGATTAAAAGCAGCTG
AACAGAGGGCCACCGAAGCCGAAAGACAAGTTTCCAAACTGCAGAGTGAA
GTTGATAGATTAGAAGATGATTTATTATCAGAAAAAGAAAAGTACAAGGC
TCTTAGTGACGAGCTTGACACTGCATTCGCAGAACTTACAGGATGTTAAT
ATCTGGAATACTCGAGGATGTGGAAATATGAAAACTGGGATAATAATATT
GTTGTATCGTTTGTTTGGTTGCTTGAGTTAGTTATTCTAATAAAATTTTT
AGTCATACCTAATGCCTTTACCCAATATTTGCTTGTCAAATAAAAATTGT
TTATTATAAAATGCTCTAGTGTTATCAAATACAATTTATTCTATTTGAAA
TTCATTGAAAATAGCATGAAATAGTTAGTAGAATATATATTTTTTTTTAT
TTCAAAAAAAA
back to top

protein sequence of SMED30026663-orf-1

>SMED30026663-orf-1 ID=SMED30026663-orf-1|Name=SMED30026663-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=285bp
MDAIKKKMLAMKMEKENAGDKSRSLKNQLKEKEEEKVKQEDAMQELQKAL
QTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLE
QTESRFQEASAKLEEASKNAEESEKNRKILETRSIADDEKLAQLEEQVKE
AKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTLELEEELKVV
GNNMKSLEISEQEAAQREESYEDTIRDLTERLKAAEQRATEAERQVSKLQ
SEVDRLEDDLLSEKEKYKALSDELDTAFAELTGC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006937regulation of muscle contraction
GO:0008150biological_process
Vocabulary: molecular function
TermDefinition
GO:0042803protein homodimerization activity
GO:0003674molecular_function
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000019muscle progenitor cell
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR000533Tropomyosin
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 141..203
NoneNo IPR availableCOILSCoilCoilcoord: 15..133
NoneNo IPR availableCOILSCoilCoilcoord: 211..273
NoneNo IPR availableGENE3DG3DSA:1.20.5.340coord: 94..139
e-value: 4.3E-5
score: 25.5
coord: 159..259
e-value: 2.3E-18
score: 68.0
NoneNo IPR availableGENE3DG3DSA:1.20.5.340coord: 1..93
e-value: 5.6E-26
score: 92.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 12..38
NoneNo IPR availablePANTHERPTHR19269TROPOMYOSINcoord: 1..282
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 1..283
IPR000533TropomyosinPRINTSPR00194TROPOMYOSINcoord: 120..140
score: 50.35
coord: 84..101
score: 59.82
coord: 145..173
score: 74.69
coord: 231..256
score: 60.19
coord: 175..198
score: 62.42
IPR000533TropomyosinPFAMPF00261Tropomyosincoord: 49..283
e-value: 1.8E-86
score: 289.4
IPR000533TropomyosinPROSITEPS00326TROPOMYOSINcoord: 232..240