ribonucleoside diphosphate reductase subunit M2

Overview
Nameribonucleoside diphosphate reductase subunit M2 (AFJ24826.1)
Smed IDSMED30026659
Length (bp)947
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ribonucleoside diphosphate reductase subunit M2 (SMED30026659) t-SNE clustered cells

Violin plots show distribution of expression levels for ribonucleoside diphosphate reductase subunit M2 (SMED30026659) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ribonucleoside diphosphate reductase subunit M2 (SMED30026659) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ribonucleoside diphosphate reductase subunit M2 (SMED30026659) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026659

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026659SMESG000014842.1 SmedASXL_019191SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026659SMESG000014842.1 SmedASXL_019191SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30026659SMESG000014842.1 dd_Smed_v4_5862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026659SMESG000014842.1 Contig33712newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026659SMESG000014842.1 Contig33712uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymaSMED30026659SMESG000014842.1 Contig35213newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026659SMESG000014842.1 Contig35213uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30026659SMESG000014842.1 dd_Smed_v4_5862_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026659SMESG000014842.1 SMED_05893_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30026659SMESG000014842.1 SMED_05893_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Human
Match: RRM2B (ribonucleotide reductase regulatory TP53 inducible subunit M2B [Source:HGNC Symbol;Acc:HGNC:17296])

HSP 1 Score: 120.553 bits (301), Expect = 6.782e-31
Identity = 77/285 (27.02%), Postives = 146/285 (51.23%), Query Frame = 2
Query:   89 SEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLEN------------ESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            SEI    EPLL  + +RFV+FPIQY DI+  Y+   + F+  ++     +    N L   E+  I  IL +++  +    ++L+ + + ++Q+PEARCF+GFQI  +  H E++S+L+ +      K + + N IE +  + +              +FG R++ ++A+E +  S  +     L K   +  L    + +  D+  +  F  ++F++ +NKP+E +   II   V+ E EFL   +   +   N   + ++++F AD++     F ++++ ENPF
Sbjct:   25 SEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQAENPF 309          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Human
Match: RRM2B (ribonucleotide reductase regulatory TP53 inducible subunit M2B [Source:HGNC Symbol;Acc:HGNC:17296])

HSP 1 Score: 120.553 bits (301), Expect = 1.543e-30
Identity = 77/285 (27.02%), Postives = 146/285 (51.23%), Query Frame = 2
Query:   89 SEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLEN------------ESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            SEI    EPLL  + +RFV+FPIQY DI+  Y+   + F+  ++     +    N L   E+  I  IL +++  +    ++L+ + + ++Q+PEARCF+GFQI  +  H E++S+L+ +      K + + N IE +  + +              +FG R++ ++A+E +  S  +     L K   +  L    + +  D+  +  F  ++F++ +NKP+E +   II   V+ E EFL   +   +   N   + ++++F AD++     F ++++ ENPF
Sbjct:   82 SEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQAENPF 366          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Human
Match: RRM2 (ribonucleotide reductase regulatory subunit M2 [Source:HGNC Symbol;Acc:HGNC:10452])

HSP 1 Score: 114.005 bits (284), Expect = 3.056e-28
Identity = 73/279 (26.16%), Postives = 144/279 (51.61%), Query Frame = 2
Query:  107 NEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLENE------------SFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            +EPLL  N +RFV+FPI+Y+DI+  Y+   + F+  ++     +     SL   ER  I  +L +++  +    ++L+ + + ++QI EARCF+GFQI  +  H E++S+L+ +      + + + N IE +  + +              ++G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H ++KP+E +   II   V  E EFL   +   +   N + + ++++F AD++     F ++++ ENPF
Sbjct:   69 DEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPF 347          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Human
Match: RRM2 (ribonucleotide reductase regulatory subunit M2 [Source:HGNC Symbol;Acc:HGNC:10452])

HSP 1 Score: 114.005 bits (284), Expect = 3.056e-28
Identity = 73/279 (26.16%), Postives = 144/279 (51.61%), Query Frame = 2
Query:  107 NEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLENE------------SFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            +EPLL  N +RFV+FPI+Y+DI+  Y+   + F+  ++     +     SL   ER  I  +L +++  +    ++L+ + + ++QI EARCF+GFQI  +  H E++S+L+ +      + + + N IE +  + +              ++G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H ++KP+E +   II   V  E EFL   +   +   N + + ++++F AD++     F ++++ ENPF
Sbjct:   69 DEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPF 347          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Human
Match: RRM2 (ribonucleotide reductase regulatory subunit M2 [Source:HGNC Symbol;Acc:HGNC:10452])

HSP 1 Score: 113.235 bits (282), Expect = 9.718e-28
Identity = 73/279 (26.16%), Postives = 144/279 (51.61%), Query Frame = 2
Query:  107 NEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLENE------------SFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            +EPLL  N +RFV+FPI+Y+DI+  Y+   + F+  ++     +     SL   ER  I  +L +++  +    ++L+ + + ++QI EARCF+GFQI  +  H E++S+L+ +      + + + N IE +  + +              ++G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H ++KP+E +   II   V  E EFL   +   +   N + + ++++F AD++     F ++++ ENPF
Sbjct:  129 DEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPF 407          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Celegans
Match: rnr-2 (Ribonucleoside-diphosphate reductase small chain [Source:UniProtKB/Swiss-Prot;Acc:P42170])

HSP 1 Score: 87.4261 bits (215), Expect = 3.289e-19
Identity = 72/282 (25.53%), Postives = 137/282 (48.58%), Query Frame = 2
Query:   98 LDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILL----RSVNYKHDLMD---------NKIELLTNLLENE--SFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            LD +EP+L   + RFV+FP++++DI+  Y+   + F+  ++   G +      +   E+  I RIL +++  +    ++L  + +N++Q+ EAR F+GFQI  +  H E++S L+    R    ++ L +          K +     + ++  SF  RLI ++A+E I  S  +     L K   +  L    + +  D+  +  F  +L+     K  + + + IIK  V  E EFL   +   +   N   +S++++F AD +       ++YK +NPF
Sbjct:   58 LDADEPMLQDLDNRFVIFPLKHHDIWNFYKKAVASFWTVEEVDLGKDMNDWEKMNGDEQYFISRILAFFAASDGIVNENLCERFSNEVQVSEARFFYGFQIAIENIHSEMYSKLIETYIRDETERNTLFNAVDEFEFIKKKADWALRWISDKKASFAERLIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTHSNELISRDEGLHRDFACLLYSKLQKKLTQQRIYDIIKDAVAIEQEFLTEALPVDMIGMNCRLMSQYIEFVADHLLVELGCDKLYKSKNPF 339          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Fly
Match: RnrS (gene:FBgn0011704 transcript:FBtr0088046)

HSP 1 Score: 112.849 bits (281), Expect = 3.757e-28
Identity = 74/278 (26.62%), Postives = 143/278 (51.44%), Query Frame = 2
Query:  110 EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLL------------ENESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            EPLL  N +RFV+FPIQY+DI+  Y+   + F+  ++     +    + L   ER  I  +L +++  +    ++L+ + + ++QI EARCF+GFQI  +  H E++S+L+ +     ++ + + N IE +  +             ++ +FG R+I ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H + +P   +   II+  V  E EFL + +  ++   N   +S++++F AD++       +IY  +NPF
Sbjct:   74 EPLLRENPRRFVIFPIQYHDIWQMYKKAEASFWTVEEVDLSKDLTDWHRLKDDERHFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENVHSEMYSVLIDTYIRDPHQREYLFNAIETMPAVKRKADWALSWISSKSANFGERIIAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFAVLMFQHLVQRPKRERIIEIIRDAVAIEQEFLTDALPVNLIGMNCDLMSQYIEFVADRLLVELGVGKIYNTKNPF 351          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase M2 polypeptide [Source:NCBI gene;Acc:30733])

HSP 1 Score: 120.553 bits (301), Expect = 2.778e-31
Identity = 78/278 (28.06%), Postives = 143/278 (51.44%), Query Frame = 2
Query:  110 EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLE------------NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            EPLL  N  RFV+FPIQY+DI+  Y+   + F+  ++     +    +SL   ER  I  +L +++  +    ++L+ +   ++Q+ EARCF+GFQI  +  H E++S+L+ +    + + + + N IE +  + +            N  +G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H INKP+E     II   VE E EFL + +   +   N   + ++++F AD++     F ++Y+ ENPF
Sbjct:   15 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPF 292          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:100330864])

HSP 1 Score: 120.553 bits (301), Expect = 2.778e-31
Identity = 78/278 (28.06%), Postives = 143/278 (51.44%), Query Frame = 2
Query:  110 EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLE------------NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            EPLL  N  RFV+FPIQY+DI+  Y+   + F+  ++     +    +SL   ER  I  +L +++  +    ++L+ +   ++Q+ EARCF+GFQI  +  H E++S+L+ +    + + + + N IE +  + +            N  +G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H INKP+E     II   VE E EFL + +   +   N   + ++++F AD++     F ++Y+ ENPF
Sbjct:   15 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPF 292          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase M2 polypeptide [Source:NCBI gene;Acc:30733])

HSP 1 Score: 120.939 bits (302), Expect = 3.374e-31
Identity = 78/278 (28.06%), Postives = 143/278 (51.44%), Query Frame = 2
Query:  110 EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLE------------NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            EPLL  N  RFV+FPIQY+DI+  Y+   + F+  ++     +    +SL   ER  I  +L +++  +    ++L+ +   ++Q+ EARCF+GFQI  +  H E++S+L+ +    + + + + N IE +  + +            N  +G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H INKP+E     II   VE E EFL + +   +   N   + ++++F AD++     F ++Y+ ENPF
Sbjct:   38 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPF 315          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:100330864])

HSP 1 Score: 120.939 bits (302), Expect = 3.374e-31
Identity = 78/278 (28.06%), Postives = 143/278 (51.44%), Query Frame = 2
Query:  110 EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLE------------NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            EPLL  N  RFV+FPIQY+DI+  Y+   + F+  ++     +    +SL   ER  I  +L +++  +    ++L+ +   ++Q+ EARCF+GFQI  +  H E++S+L+ +    + + + + N IE +  + +            N  +G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H INKP+E     II   VE E EFL + +   +   N   + ++++F AD++     F ++Y+ ENPF
Sbjct:   38 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPF 315          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Zebrafish
Match: rrm2 (ribonucleotide reductase M2 polypeptide [Source:NCBI gene;Acc:30733])

HSP 1 Score: 120.553 bits (301), Expect = 7.193e-31
Identity = 78/278 (28.06%), Postives = 143/278 (51.44%), Query Frame = 2
Query:  110 EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLE------------NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            EPLL  N  RFV+FPIQY+DI+  Y+   + F+  ++     +    +SL   ER  I  +L +++  +    ++L+ +   ++Q+ EARCF+GFQI  +  H E++S+L+ +    + + + + N IE +  + +            N  +G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H INKP+E     II   VE E EFL + +   +   N   + ++++F AD++     F ++Y+ ENPF
Sbjct:   67 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPF 344          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Xenopus
Match: col6a6 (collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-GENE-6051153])

HSP 1 Score: 116.701 bits (291), Expect = 1.031e-29
Identity = 74/282 (26.24%), Postives = 146/282 (51.77%), Query Frame = 2
Query:   98 LDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLE------------NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            L ++EPLL  N  RFV+FPIQY+DI+  Y+   + F+  ++     +     SL   E+  I  +L +++  +    ++L+ + + ++Q+ EARCF+GFQI  +  H E++S+L+ +      + + + N IE L  + +              ++G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H +NKP+E +   +I   V+ E EFL   +  ++   N + + ++++F AD++     F +++K  NPF
Sbjct:    1 LIQDEPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLRHWESLKAEEKYFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKKKADWALRWIGDKQATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSEERVVQLITDAVQIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLLLELGFNKVFKATNPF 282          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Xenopus
Match: col6a6 (collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-GENE-6051153])

HSP 1 Score: 116.701 bits (291), Expect = 1.259e-29
Identity = 73/280 (26.07%), Postives = 145/280 (51.79%), Query Frame = 2
Query:  104 RNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLE------------NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            ++EPLL  N  RFV+FPIQY+DI+  Y+   + F+  ++     +     SL   E+  I  +L +++  +    ++L+ + + ++Q+ EARCF+GFQI  +  H E++S+L+ +      + + + N IE L  + +              ++G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H +NKP+E +   +I   V+ E EFL   +  ++   N + + ++++F AD++     F +++K  NPF
Sbjct:   10 QDEPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLRHWESLKAEEKYFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKKKADWALRWIGDKQATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSEERVVQLITDAVQIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLLLELGFNKVFKATNPF 289          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Xenopus
Match: col6a6 (collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-GENE-6051153])

HSP 1 Score: 116.701 bits (291), Expect = 1.774e-29
Identity = 73/280 (26.07%), Postives = 145/280 (51.79%), Query Frame = 2
Query:  104 RNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLE------------NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            ++EPLL  N  RFV+FPIQY+DI+  Y+   + F+  ++     +     SL   E+  I  +L +++  +    ++L+ + + ++Q+ EARCF+GFQI  +  H E++S+L+ +      + + + N IE L  + +              ++G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H +NKP+E +   +I   V+ E EFL   +  ++   N + + ++++F AD++     F +++K  NPF
Sbjct:   31 QDEPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLRHWESLKAEEKYFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKKKADWALRWIGDKQATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSEERVVQLITDAVQIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLLLELGFNKVFKATNPF 310          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Xenopus
Match: col6a6 (collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-GENE-6051153])

HSP 1 Score: 116.316 bits (290), Expect = 2.027e-29
Identity = 73/280 (26.07%), Postives = 145/280 (51.79%), Query Frame = 2
Query:  104 RNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLE------------NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            ++EPLL  N  RFV+FPIQY+DI+  Y+   + F+  ++     +     SL   E+  I  +L +++  +    ++L+ + + ++Q+ EARCF+GFQI  +  H E++S+L+ +      + + + N IE L  + +              ++G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H +NKP+E +   +I   V+ E EFL   +  ++   N + + ++++F AD++     F +++K  NPF
Sbjct:   36 QDEPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLRHWESLKAEEKYFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKKKADWALRWIGDKQATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSEERVVQLITDAVQIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLLLELGFNKVFKATNPF 315          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Xenopus
Match: col6a6 (collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-GENE-6051153])

HSP 1 Score: 116.701 bits (291), Expect = 2.093e-29
Identity = 77/295 (26.10%), Postives = 150/295 (50.85%), Query Frame = 2
Query:   59 TNIRIHKDRRSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLE------------NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            T  +  KD R +    +EPLL  N  RFV+FPIQY+DI+  Y+   + F+  ++     +     SL   E+  I  +L +++  +    ++L+ + + ++Q+ EARCF+GFQI  +  H E++S+L+ +      + + + N IE L  + +              ++G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H +NKP+E +   +I   V+ E EFL   +  ++   N + + ++++F AD++     F +++K  NPF
Sbjct:   34 TKSKAPKDPRIQ----DEPLLKDNPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLRHWESLKAEEKYFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKKKADWALRWIGDKQATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSEERVVQLITDAVQIEQEFLTEALPVNLIGMNCTLMKQYIEFVADRLLLELGFNKVFKATNPF 324          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Mouse
Match: Rrm2b (ribonucleotide reductase M2 B (TP53 inducible) [Source:MGI Symbol;Acc:MGI:2155865])

HSP 1 Score: 120.168 bits (300), Expect = 6.210e-31
Identity = 76/278 (27.34%), Postives = 143/278 (51.44%), Query Frame = 2
Query:  110 EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLEN------------ESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            EPLL  + +RFV+FPIQY DI+  Y+   + F+  ++     +    N L   E+  I  IL +++  +    ++L+ + + ++Q+PEARCF+GFQI  +  H E++S+L+ +      K + + N IE +  + +              +FG R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F++ +NKP+E +   II   V+ E EFL   +   +   N   + ++++F AD++     F +I++ ENPF
Sbjct:   32 EPLLRKSSRRFVIFPIQYPDIWRMYKQAQASFWTAEEVDLSKDLPHWNKLKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEDRVREIIADAVQIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLGELGFSKIFQAENPF 309          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Mouse
Match: Rrm2 (ribonucleotide reductase M2 [Source:MGI Symbol;Acc:MGI:98181])

HSP 1 Score: 113.235 bits (282), Expect = 3.490e-28
Identity = 72/279 (25.81%), Postives = 143/279 (51.25%), Query Frame = 2
Query:  107 NEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLENE------------SFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            +EPLL  N +RFV+FPI+Y+DI+  Y+   + F+  ++     +     +L   ER  I  +L +++  +    ++L+ + + ++Q+ EARCF+GFQI  +  H E++S+L+ +      + + + N IE +  + +              ++G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H ++KP E +   II   V  E EFL   +   +   N + + ++++F AD++     F +I++ ENPF
Sbjct:   70 DEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPAEQRVREIITNAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFRVENPF 348          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Mouse
Match: Rrm2b (ribonucleotide reductase M2 B (TP53 inducible) [Source:MGI Symbol;Acc:MGI:2155865])

HSP 1 Score: 98.2117 bits (243), Expect = 3.430e-23
Identity = 54/205 (26.34%), Postives = 106/205 (51.71%), Query Frame = 2
Query:  314 QSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLEN------------ESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            ++L+ + + ++Q+PEARCF+GFQI  +  H E++S+L+ +      K + + N IE +  + +              +FG R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F++ +NKP+E +   II   V+ E EFL   +   +   N   + ++++F AD++     F +I++ ENPF
Sbjct:   53 ENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEDRVREIIADAVQIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLGELGFSKIFQAENPF 257          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Mouse
Match: Rrm2 (ribonucleotide reductase M2 [Source:MGI Symbol;Acc:MGI:98181])

HSP 1 Score: 67.0106 bits (162), Expect = 1.385e-12
Identity = 48/179 (26.82%), Postives = 96/179 (53.63%), Query Frame = 2
Query:  107 NEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLEN------------ESFGGRLITYSAMESICIS----SLYILK 571
            +EPLL  N +RFV+FPI+Y+DI+  Y+   + F+  ++     +     +L   ER  I  +L +++  +    ++L+ + + ++Q+ EARCF+GFQI  +  H E++S+L+ +      + + + N IE +  + +              ++G R++ ++A+E I  S    S++ LK
Sbjct:   39 DEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWEALKPDERHFISHVLAFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLK 217          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Mouse
Match: Rrm2b (ribonucleotide reductase M2 B (TP53 inducible) [Source:MGI Symbol;Acc:MGI:2155865])

HSP 1 Score: 56.6102 bits (135), Expect = 1.691e-9
Identity = 27/92 (29.35%), Postives = 50/92 (54.35%), Query Frame = 2
Query:  614 RIDAVLNDKSE--YTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            R +A   +K E  +  F  ++F++ +NKP+E +   II   V+ E EFL   +   +   N   + ++++F AD++     F +I++ ENPF
Sbjct:    6 RPEAARPEKGEGLHCDFACLMFQYLVNKPSEDRVREIIADAVQIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLGELGFSKIFQAENPF 97          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. UniProt/SwissProt
Match: sp|Q7LG56|RIR2B_HUMAN (Ribonucleoside-diphosphate reductase subunit M2 B OS=Homo sapiens OX=9606 GN=RRM2B PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 3.257e-30
Identity = 77/285 (27.02%), Postives = 146/285 (51.23%), Query Frame = 2
Query:   89 SEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLEN------------ESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            SEI    EPLL  + +RFV+FPIQY DI+  Y+   + F+  ++     +    N L   E+  I  IL +++  +    ++L+ + + ++Q+PEARCF+GFQI  +  H E++S+L+ +      K + + N IE +  + +              +FG R++ ++A+E +  S  +     L K   +  L    + +  D+  +  F  ++F++ +NKP+E +   II   V+ E EFL   +   +   N   + ++++F AD++     F ++++ ENPF
Sbjct:   25 SEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQAENPF 309          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. UniProt/SwissProt
Match: sp|Q4R741|RIR2B_MACFA (Ribonucleoside-diphosphate reductase subunit M2 B OS=Macaca fascicularis OX=9541 GN=RRM2B PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 3.394e-30
Identity = 78/285 (27.37%), Postives = 146/285 (51.23%), Query Frame = 2
Query:   89 SEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLEN------------ESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            +EI    EPLL  + +RFV+FPIQY DI+  Y+   + F+  ++     +    N L   E+  I  IL +++  +    ++L+ + + ++Q+PEARCF+GFQI  +  H E++S+L+ +      K + + N IE +  + +              +FG R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F++ +NKP+E +   II   V+ E EFL   +   +   N   + ++++F AD++     F +I++ ENPF
Sbjct:   25 NEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVQIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKIFQAENPF 309          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. UniProt/SwissProt
Match: sp|Q6PEE3|RIR2B_MOUSE (Ribonucleoside-diphosphate reductase subunit M2 B OS=Mus musculus OX=10090 GN=Rrm2b PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 4.344e-30
Identity = 76/278 (27.34%), Postives = 143/278 (51.44%), Query Frame = 2
Query:  110 EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLEN------------ESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            EPLL  + +RFV+FPIQY DI+  Y+   + F+  ++     +    N L   E+  I  IL +++  +    ++L+ + + ++Q+PEARCF+GFQI  +  H E++S+L+ +      K + + N IE +  + +              +FG R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F++ +NKP+E +   II   V+ E EFL   +   +   N   + ++++F AD++     F +I++ ENPF
Sbjct:   32 EPLLRKSSRRFVIFPIQYPDIWRMYKQAQASFWTAEEVDLSKDLPHWNKLKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEDRVREIIADAVQIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLGELGFSKIFQAENPF 309          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. UniProt/SwissProt
Match: sp|P79733|RIR2_DANRE (Ribonucleoside-diphosphate reductase subunit M2 OS=Danio rerio OX=7955 GN=rrm2 PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 5.430e-30
Identity = 78/278 (28.06%), Postives = 143/278 (51.44%), Query Frame = 2
Query:  110 EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLE------------NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            EPLL  N  RFV+FPIQY+DI+  Y+   + F+  ++     +    +SL   ER  I  +L +++  +    ++L+ +   ++Q+ EARCF+GFQI  +  H E++S+L+ +    + + + + N IE +  + +            N  +G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H INKP+E     II   VE E EFL + +   +   N   + ++++F AD++     F ++Y+ ENPF
Sbjct:   67 EPLLKENPHRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWDSLKDEERYFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREFLFNAIETMPCVKKKADWALNWIGDKNARYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLINKPSEETVKKIIMNAVEIEQEFLTDALPVKLIGMNCDLMKQYIEFVADRLLLELGFDKVYRVENPF 344          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. UniProt/SwissProt
Match: sp|Q5R9G0|RIR2B_PONAB (Ribonucleoside-diphosphate reductase subunit M2 B OS=Pongo abelii OX=9601 GN=RRM2B PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.095e-29
Identity = 76/285 (26.67%), Postives = 146/285 (51.23%), Query Frame = 2
Query:   89 SEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLEN------------ESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            +EI    EPLL  + +RFV+FPIQY DI+  Y+   + F+  ++     +    N L   E+  I  IL +++  +    ++L+ + + ++Q+PEARCF+GFQI  +  H E++S+L+ +      K + + N IE +  + +              +FG R++ ++A+E +  S  +     L K   +  L    + +  D+  +  F  ++F++ +NKP+E +   II   V+ E EFL   +   +   N   + ++++F AD++     F ++++ ENPF
Sbjct:   25 NEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEARCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLVELGFSKVFQAENPF 309          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. TrEMBL
Match: I1ZIH2 (Ribonucleoside diphosphate reductase subunit M2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 282/282 (100.00%), Postives = 282/282 (100.00%), Query Frame = 2
Query:   41 MSLSDITNIRIHKDRRSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQFGTETYSLNSLPIGXXXXXXXXXXYWSYYNEQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSVNYKHDLMDNKIELLTNLLENESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPFK 886
            MSLSDITNIRIHKDRRSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQFGTETYSLNSLPIGEREIIERILLYWSYYNEQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSVNYKHDLMDNKIELLTNLLENESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPFK
Sbjct:    1 MSLSDITNIRIHKDRRSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQFGTETYSLNSLPIGEREIIERILLYWSYYNEQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSVNYKHDLMDNKIELLTNLLENESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPFK 282          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. TrEMBL
Match: A0A137NXH3 (Ribonucleotide reductase OS=Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) OX=796925 GN=CONCODRAFT_42941 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.162e-31
Identity = 85/281 (30.25%), Postives = 147/281 (52.31%), Query Frame = 2
Query:  101 DRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLL------------ENESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            ++ EPLL  N  RFVLFPIQYNDI+A Y+   + F+  ++     +    N+L  GE+  +  IL +++  +    ++L+ + +ND+QIPEARCF+GFQI  +  H E++S+L+ +      + D + N IE +  +             +N SF  RL+ ++A+E I  S  +     L K  ++  L    + +  D+  +  F  +LF+H  NKP++   + II + V  E EFL   +  S+   N   + +++++ AD++       + Y  ENPF
Sbjct:   14 EKEEPLLQENPNRFVLFPIQYNDIWAMYKKAVASFWTCEEVDLSKDMNHWNTLNDGEKHFVSHILAFFAASDGIVNENLVERFSNDVQIPEARCFYGFQIMIENIHSEMYSLLIDTYVKDPAQRDHLFNAIETIPCIKRKADWALRWISDKNVSFAERLLAFAAVEGIFFSGAFASIFWLKKRGKMPGLTFSNELISRDEGLHCDFACLLFKHLKNKPSQQLIYKIITEAVAIEQEFLSEALPVSLIGMNAVLMGQYIEYVADRLLVSLDCDKYYNAENPF 294          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. TrEMBL
Match: A0A1I7RNM7 (Uncharacterized protein OS=Bursaphelenchus xylophilus OX=6326 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 5.016e-31
Identity = 86/283 (30.39%), Postives = 156/283 (55.12%), Query Frame = 2
Query:   98 LDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQFGTETY--SLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRS----VNYKHDLMD---------NKIELLTNLLENE--SFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLN-DKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            LD +EPLL  +  RF LFP++Y+DI+  Y+   + F++P++   E      + L   ER  I R+L +++  +    ++LI + N ++++PEARCF+GFQI  +  H E++SIL+ +    V  KH + +          K +     + +E  SFG RL+ ++A+E I  S  +   +  LKS  L   + + + +++ D+  +  F  ILF+H  ++P +++ H+II++ VE E EFLV+ +   +   N   + +++++ AD + +      IYK  NPF
Sbjct:   11 LDADEPLLYDDPGRFTLFPLKYHDIFGYYKKAVNCFWVPEEVKLEDDLDDWHKLKEEERFFISRVLAFFAASDGIVNENLIERFNAEVKLPEARCFYGFQIMMENIHSEMYSILIDTYISDVAEKHKMFNAIQEFEFIKKKADWAMKWISDERSSFGTRLVAFAAVEGIFFSGSFA-SIFWLKSRGLMPGLAQSNELISRDEGLHRDFACILFKHLKHRPTQAEVHAIIREAVEIEKEFLVDALPCKMIGMNSDRMCQYIEYVADHLLEELDLPIIYKSSNPF 292          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. TrEMBL
Match: A0A183SWT0 (Ribonucleoside-diphosphate reductase subunit M2 OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS8679 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 5.643e-31
Identity = 79/290 (27.24%), Postives = 154/290 (53.10%), Query Frame = 2
Query:   77 KDRRSEILDRN----EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSVNYKHDLMDNKIELLTNLLEN------------ESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            +D  S I  +N    EP+L+ N +RFV+ PIQY+DI+  Y+   + F+  ++     +     SL  GE+  I  +L +++  +    ++L+ + + ++QIPEARCF+GFQI  +  H E++S+L+ +     D + N ++ L  + +              +F  RL+ ++A+E +  S  +     L K   +  L    + +  D+  +T F  +LF+H  NKP++ +   I+++ V+ E+EFL + +   +   N   ++++++F AD++     F++IY+  NPF
Sbjct:   12 RDTDSSIPSKNPITDEPILVVNPRRFVIMPIQYHDIWQFYKKAVASFWTVEEVDLAKDLGDWESLKDGEKHFISYVLAFFAASDGIVNENLVERFSQEVQIPEARCFYGFQIAIENIHSEMYSLLIDT-----DFLFNAVQTLPCVKKKADWALKWIGDSKSTFPERLVAFAAVEGVFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHTDFACLLFKHIRNKPSKERVEKIMREAVDIEVEFLTDALPVDLIGMNCRLMAQYIRFVADRLLTELGFEKIYRATNPF 296          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. TrEMBL
Match: A0A0L7QU82 (Ribonucleoside-diphosphate reductase subunit M2 OS=Habropoda laboriosa OX=597456 GN=WH47_05211 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 7.060e-31
Identity = 85/299 (28.43%), Postives = 155/299 (51.84%), Query Frame = 2
Query:   50 SDITNIRI-HKDRRSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLL------------ENESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            +++T  ++  K + SE     EPLL  N +RFV+FPIQ+ DI+  Y+   + F+  ++     + +  NSL I E++ I  +L +++  +    ++L+ + + ++QI EARCF+GFQ+  +  H E++S+L+ +      + D + N IE L  +             E  +F  R+I ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H I KP+  +  SIIK  V+ E EFL + +   +   N   + ++++F AD++      Q+ YK ENPF
Sbjct:   33 NEVTKTKVTRKMKESEFSPELEPLLKENPRRFVVFPIQWPDIWQMYKKAEASFWTVEEVDLSKDLFDWNSLTISEKKFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQVAMENVHSEMYSLLIDTYIADAKERDFLFNAIENLPCVARKANWALNWINHETATFPERVIAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHIIQKPSNERVTSIIKDAVQIEQEFLTDALPVEMIGMNCKLMCQYIEFVADRLLVELGCQKFYKSENPF 331          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Cavefish
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:103024314])

HSP 1 Score: 120.553 bits (301), Expect = 6.285e-31
Identity = 79/278 (28.42%), Postives = 143/278 (51.44%), Query Frame = 2
Query:  110 EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLE------------NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            EPLL  N +RFV+FPIQY+DI+  Y+   + F+  ++     +     SL   ER  I  +L +++  +    ++L+ +   ++Q+ EARCF+GFQI  +  H E++S+L+ +    + + + + N +E L  + +            N  +G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H +NKP+ES    II   V+ E EFL   +   +   N   + ++++F AD++     F +IYK ENPF
Sbjct:   67 EPLLKENPRRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWESLKDEERYFISHVLAFFAASDGIVNENLVERFMQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREYLFNAVETLPCVKKKADWALNWIGNKNAKYGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLMNKPSESTVKKIIMNAVQIEQEFLTQALPVKLIGMNCDLMKQYIEFVADRLMLELGFSKIYKVENPF 344          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Cavefish
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:103024314])

HSP 1 Score: 120.553 bits (301), Expect = 6.285e-31
Identity = 79/278 (28.42%), Postives = 143/278 (51.44%), Query Frame = 2
Query:  110 EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLE------------NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            EPLL  N +RFV+FPIQY+DI+  Y+   + F+  ++     +     SL   ER  I  +L +++  +    ++L+ +   ++Q+ EARCF+GFQI  +  H E++S+L+ +    + + + + N +E L  + +            N  +G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H +NKP+ES    II   V+ E EFL   +   +   N   + ++++F AD++     F +IYK ENPF
Sbjct:   67 EPLLKENPRRFVIFPIQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWESLKDEERYFISHVLAFFAASDGIVNENLVERFMQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDSKEREYLFNAVETLPCVKKKADWALNWIGNKNAKYGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLMNKPSESTVKKIIMNAVQIEQEFLTQALPVKLIGMNCDLMKQYIEFVADRLMLELGFSKIYKVENPF 344          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Cavefish
Match: rrm2b (ribonucleoside-diphosphate reductase subunit M2 B-like [Source:NCBI gene;Acc:103028967])

HSP 1 Score: 118.627 bits (296), Expect = 1.737e-30
Identity = 82/292 (28.08%), Postives = 147/292 (50.34%), Query Frame = 2
Query:   74 HKDRRSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSVNYKHDLMD-----NKIELLTNLLE------------NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            HKD   +  + +EPLL  N++RFV+FPIQY DI+  Y+   + F+  ++     +      L  GER  I  +L +++  +    ++L+ + + ++Q+PEAR F+GFQI  +  H E++S+L+ +  Y  DL +     N IE +  +              N +FG RLI ++A+E I  S  +     L K   +  L    + +  D+  +  F  +++ + + KP+  +   II + V  E EFL   +   +   N S + ++++F AD++       ++YK ENPF
Sbjct:   19 HKDVDPQSTE-DEPLLRENKRRFVIFPIQYPDIWKMYKQAQASFWTVEEVDLSKDLVHWEKLKPGERHFISHVLAFFAASDGIVNENLVQRFSQEVQLPEARSFYGFQILIESVHSEMYSMLINT--YIRDLKERDYLFNAIETMPCVKRKADWALQWISDRNSTFGERLIAFAAVEGIFFSGSFAAIYWLKKRGLMPGLTYSNELISRDEGLHCNFACLMYSYLVKKPSADRVRDIITKAVSIEQEFLTEALPVDLIGINCSLMKQYIEFVADRLLTDLAMPKVYKAENPF 307          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Sea Lamprey
Match: rrm2 (ribonucleotide reductase regulatory subunit M2 [Source:NCBI gene;Acc:100330864])

HSP 1 Score: 119.783 bits (299), Expect = 9.470e-32
Identity = 78/301 (25.91%), Postives = 150/301 (49.83%), Query Frame = 2
Query:   41 MSLSDITNIRIHKDRRSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLTNLLE------------NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            M  ++   +R+   R  E     EPLL  N +RFV+FPI+Y DI+  Y+   + F+  ++     +      L   E+  I  +L +++  +    ++L+ + + ++QI EARCF+GFQI  +  H E++S+L+ +      + + + N IE L  + +            N +FG R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++FRH ++KP E++   I+   V  E EFL + +  ++   N   + ++++F AD++       ++Y+ ENPF
Sbjct:    1 MDTTEAGVVRLRDPRAQE-----EPLLRDNPRRFVIFPIEYPDIWQMYKKAEASFWTAEEVDLSKDQQHWERLKPEEQHFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPTQREFLFNAIETLPCVKKKADWALRWISDSNATFGERVLAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFRHLVHKPEEARVQQIVMDAVIIEQEFLTDALPVNLIGMNCDLMKQYIEFVADRLLGELGCAKVYRAENPF 296          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Yeast
Match: RNR2 (Ribonucleotide-diphosphate reductase (RNR), small subunit; the RNR complex catalyzes the rate-limiting step in dNTP synthesis and is regulated by DNA replication and DNA damage checkpoint pathways via localization of the small subunits; RNR2 has a paralog, RNR4, that arose from the whole genome duplication [Source:SGD;Acc:S000003563])

HSP 1 Score: 106.686 bits (265), Expect = 9.816e-27
Identity = 76/293 (25.94%), Postives = 154/293 (52.56%), Query Frame = 2
Query:   68 RIHKDRRSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNS-LPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRS-----------VNYKHDL--MDNKIELLTNLLENES--FGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            ++H+ +  E +++ EPLL  +++R VLFPI+Y++I+ AY+   + F+  ++     + +  N+ +   ER  I R+L +++  +    ++L+   + ++QIPEA+ F+GFQI  +  H E +S+L+ +            N  H +  +  K E     +++    FG RL+ ++++E +  S  +     L K   +  L    + +  D+  +T F  +LF H  NKP+ +    I+ + VE E  + ++ +  ++   N   ++++V+F AD++   F  ++ YK ENPF
Sbjct:   63 QVHRHKLKE-MEKEEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIHDWNNRMNENERFFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHSETYSLLIDTYIKDPKESEFLFNAIHTIPEIGEKAEWALRWIQDADALFGERLVAFASIEGVFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDPAIVEKIVTEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKVENPF 354          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Yeast
Match: RNR4 (Ribonucleotide-diphosphate reductase (RNR) small subunit; the RNR complex catalyzes the rate-limiting step in dNTP synthesis and is regulated by DNA replication and DNA damage checkpoint pathways via localization of the small subunits; relocalizes from nucleus to cytoplasm upon DNA replication stress; RNR4 has a paralog, RNR2, that arose from the whole genome duplication [Source:SGD;Acc:S000003412])

HSP 1 Score: 88.1965 bits (217), Expect = 2.575e-20
Identity = 69/295 (23.39%), Postives = 125/295 (42.37%), Query Frame = 2
Query:  101 DRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQF--------------GTETYSLNSLPIGXXXXXXXXXXYWSYYNEQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV-----------------NYKHDLMDNKIELLTNLLENES--FGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPFK 886
            +++E LL+ N +RFV+FPI+Y++I+AAY+ + + F+  ++                 +TY  N L +                  + LI   +  +Q PE + F+GFQI  +  + E++S+++ +                    KH     K   +   + N+   +  RL+ ++A E I  +  Y     L     +  L +    +  D+  YT F  +LF H   KPN      II + VE E E+  N +       +   +  +++F AD +   F  ++ Y   NPF+
Sbjct:   22 EKDEILLMENSRRFVMFPIKYHEIWAAYKKVEASFWTAEEIELAKDTEDFQKLTDDQKTYIGNLLALSISSDNLV---------NKYLIENFSAQLQNPEGKSFYGFQIMMENIYSEVYSMMVDAFFKDPKNIPLFKEIANLPEVKH-----KAAFIERWISNDDSLYAERLVAFAAKEGIFQAGNYASMFWLTDKKIMPGLAMANRNICRDRGAYTDFSCLLFAHLRTKPNPKIIEKIITEAVEIEKEYYSNSLPVEKFGMDLKSIHTYIEFVADGLLQGFGNEKYYNAVNPFE 302          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Nematostella
Match: EDO42117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2C2])

HSP 1 Score: 118.627 bits (296), Expect = 5.805e-31
Identity = 81/299 (27.09%), Postives = 154/299 (51.51%), Query Frame = 2
Query:   47 LSDITNIRIHKDRRSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRS-VNYKHDLMD--NKIELLTNLL------------ENESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            +SD T ++  +  +S     +EPLL  N  RFV+ PIQY +I+  Y+   + F+  ++     +++    L   ER  +  +L +++  +    ++L+   + ++QIPEARCF+GFQI  +  H E++S+L+ S +  K + ++  N IE +  ++            +  SFG R+I ++A+E I  S  +     L K   +  L    + +  D+  +  F  +++++ +NKP+E     IIK  V  E EFL + +   +   N + + ++++F AD++      Q++Y  ENPF
Sbjct:    2 VSDRTPLKKSR-AKSRFNTEDEPLLRENPHRFVILPIQYPEIWQMYKKAEASFWTAEEVDLSKDSHDFAKLNDDERMFVSHVLAFFAASDGIVNENLVECFSQEVQIPEARCFYGFQIAIENIHSEMYSLLIESLIKDKAEKVNLFNAIETMPCVMKKAHWALNWINPQRASFGERIIAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMYKYLVNKPDEETVRGIIKDAVVIEQEFLTSALPVKLIGMNCALMRQYIEFVADRLLVALNCQKVYNVENPF 299          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Nematostella
Match: EDO42116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2C0])

HSP 1 Score: 118.627 bits (296), Expect = 1.259e-30
Identity = 78/286 (27.27%), Postives = 146/286 (51.05%), Query Frame = 2
Query:   86 RSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRS-VNYKHDLMD--NKIELLTNLL------------ENESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            +S     +EPLL  N  RFV+ PIQY +I+  Y+   + F+  ++     +++    L   ER  +  +L +++  +    ++L+     ++QIPEARCF+GFQI  +  H E++S+L+ S +  K + ++  N IE +  ++            +  SFG R+I ++A+E I  S  +     L K   +  L    + +  D+  +  F  +++++ +NKP+E     IIK  V  E EFL + +   +   N + + ++++F AD++      Q++Y  ENPF
Sbjct:   57 KSRFNTEDEPLLRENPHRFVILPIQYTEIWQMYKKAEASFWTAEEVDLSKDSHDFAKLNDHERMFVSHVLAFFAASDGIVNENLVECFCQEVQIPEARCFYGFQIAIENIHSEMYSLLIESLIKDKAEKVNLFNAIETMPCVMKKAHWALNWINPQRASFGERIIAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMYKYLVNKPDEETVRGIIKDAVVIEQEFLTSALPVKLIGMNCALMRQYIEFVADRLLVALNCQKVYNAENPF 342          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Nematostella
Match: EDO42087 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2C1])

HSP 1 Score: 116.316 bits (290), Expect = 7.167e-30
Identity = 78/286 (27.27%), Postives = 146/286 (51.05%), Query Frame = 2
Query:   86 RSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRS-VNYKHDLMD--NKIELLTNLL------------ENESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            +S     +EPLL  N  RFV+ PIQY +I+  Y+   + F+  ++     +++    L   ER  +  +L +++  +    ++L+     ++QIPEARCF+GFQI  +  H E++S+L+ S +  K + ++  N IE +  ++            +  SFG R+I ++A+E I  S  +     L K   +  L    + +  D+  +  F  +++++ +NKP+E     IIK  V  E EFL + +   +   N + + ++++F AD++      Q++Y  ENPF
Sbjct:   57 KSRFNTEDEPLLRENPHRFVILPIQYPEIWQMYKKAEASFWTAEEVDLSKDSHDFAKLNDDERMFVSHVLAFFAASDGIVNENLVECFCQEVQIPEARCFYGFQIAIENIHSEMYSLLIESLIKDKAEKVNLFNAIETMPCVMKKAHWALNWINPQRASFGERIIAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMYKYLVNKPDEETVRGIIKDAVVIEQEFLTSALPVKLIGMNCALMRQYIEFVADRLLVALNCQKVYNVENPF 342          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Nematostella
Match: EDO28315 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6T9])

HSP 1 Score: 62.3882 bits (150), Expect = 1.488e-11
Identity = 56/220 (25.45%), Postives = 97/220 (44.09%), Query Frame = 2
Query:  110 EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQFGTETYSLNSLPIGXXXXXXXXXXYWSYYNEQSLIFKMN------NDIQIPEARCFFGFQINSQINHRELFSILLRSVNYKHDLMDN---------------KIELLTNLLENESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGA-ILFRHCINK-PNE 700
            EP+L  N+ RFV+FPI+++DI+  Y+ + + F+  ++        +       +    I    +++     I   N      N++Q  EA+ F+GFQI  +  H E +S+L+ +  Y  D ++                K E     +E++SF  RLI ++A+E I  S  +     L K   +  L    + +  D+  +  F   I   H INK P E
Sbjct:    5 EPILQENKDRFVIFPIKHHDIWEWYKKMEASFWTAEEIDLHQDITDWNTKLNEDEKYFIKHILAFFAASDGIVNENLAENFVNEVQYAEAKFFYGFQIMMENIHSETYSLLIDT--YVKDEVEKDKLFHAIEVFPAIKRKAEWALKWIESDSFAERLIAFAAVEGIFFSGAFCSIFWLKKRGLMPGLTFSNELISRDEGVHCDFAVHIHNHHLINKVPKE 222          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Medaka
Match: RRM2 (ribonucleoside-diphosphate reductase subunit M2-like [Source:NCBI gene;Acc:101166844])

HSP 1 Score: 122.094 bits (305), Expect = 1.694e-31
Identity = 82/299 (27.42%), Postives = 151/299 (50.50%), Query Frame = 2
Query:   47 LSDITNIRIHKDRRSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLT----------NLLENE--SFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            L   T  +I  D +S +    EPLL  N +RFV+FP+QY+DI+  Y+   + F+  ++     +     +L   ER  I  +L +++  +    ++L+ +   ++Q+ EARCF+GFQI  +  H E++S+L+ +      + + + N IE L           N + N+  ++G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H +NKP+      II+  VE E EFL   +   +   N   + ++++F AD++     F +IY+ ENPF
Sbjct:   40 LGSKTARKIFSDAKS-LKTEEEPLLKENPRRFVIFPVQYHDIWQMYKKAEASFWTAEEVDLSKDLQHWETLKDDERFFISHVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKRKADWALNWIGNKHAAYGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSSETVTEIIRNAVEIEQEFLTEALPVKLIGMNCELMKQYIEFVADRLLLELGFSKIYRAENPF 337          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Medaka
Match: rrm2b (ribonucleoside-diphosphate reductase subunit M2 B [Source:NCBI gene;Acc:101164326])

HSP 1 Score: 100.523 bits (249), Expect = 7.337e-24
Identity = 77/282 (27.30%), Postives = 142/282 (50.35%), Query Frame = 2
Query:  104 RNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSVNYKHDLMD-----NKIELLTNL-------LE-----NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            ++EPLL  N +RFV+FPIQY DI+  Y+   + F+  ++     +    + L   E+  I  +L +++  +    ++L+ + + ++Q+PEAR F+ FQI  +  H E++S+L+ +  Y  DL +     N I+ +  +       LE       +FG RL+ ++A+E I  S  +     L K   L  L    + +  D+  +  F  +L+ + + KP+E +   II + V  E EFL   +   +   N   + ++++F AD++       ++YK ENPF
Sbjct:   31 KDEPLLRENPRRFVIFPIQYPDIWKMYKQAQASFWTVEEVDLSKDLVHWDRLKPDEKHFISNVLAFFAASDGIVNENLVQRFSLEVQVPEARSFYSFQILIETVHSEMYSLLINT--YIRDLKERDYLFNAIQTMPCVKRKADWALEWINDNKSTFGERLVAFAAVEGIFFSGSFAAIYWLKKRGLLPGLTYSNELISRDEGLHCNFACLLYSYLVKKPSEDRVRGIITKAVCIEQEFLTEALPVDLIGMNCCLMKQYIEFVADRLLADLDLDKVYKVENPF 310          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Medaka
Match: rrm2b (ribonucleoside-diphosphate reductase subunit M2 B [Source:NCBI gene;Acc:101164326])

HSP 1 Score: 99.7525 bits (247), Expect = 1.515e-23
Identity = 77/281 (27.40%), Postives = 141/281 (50.18%), Query Frame = 2
Query:  107 NEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSVNYKHDLMD-----NKIELLTNL-------LE-----NESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            +EPLL  N +RFV+FPIQY DI+  Y+   + F+  ++     +    + L   E+  I  +L +++  +    ++L+ + + ++Q+PEAR F+ FQI  +  H E++S+L+ +  Y  DL +     N I+ +  +       LE       +FG RL+ ++A+E I  S  +     L K   L  L    + +  D+  +  F  +L+ + + KP+E +   II + V  E EFL   +   +   N   + ++++F AD++       ++YK ENPF
Sbjct:   34 DEPLLRENPRRFVIFPIQYPDIWKMYKQAQASFWTVEEVDLSKDLVHWDRLKPDEKHFISNVLAFFAASDGIVNENLVQRFSLEVQVPEARSFYSFQILIETVHSEMYSLLINT--YIRDLKERDYLFNAIQTMPCVKRKADWALEWINDNKSTFGERLVAFAAVEGIFFSGSFAAIYWLKKRGLLPGLTYSNELISRDEGLHCNFACLLYSYLVKKPSEDRVRGIITKAVCIEQEFLTEALPVDLIGMNCCLMKQYIEFVADRLLADLDLDKVYKVENPF 312          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Medaka
Match: ENSORLT00000025443.2 (ribonucleoside-diphosphate reductase subunit M2 [Source:NCBI gene;Acc:101158912])

HSP 1 Score: 96.6709 bits (239), Expect = 8.539e-23
Identity = 56/205 (27.32%), Postives = 105/205 (51.22%), Query Frame = 2
Query:  314 QSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSV---NYKHDLMDNKIELLT----------NLLENE--SFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            ++L+ +   ++Q+ EARCF+GFQI  +  H E++S+L+ +      + + + N IE L           N + N+  ++G R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F+H +NKP+      II+  VE E EFL   +   +   N   + ++++F AD++     F +IY+ ENPF
Sbjct:   51 ENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREYLFNAIETLPCVKRKADWALNWIGNKHAAYGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVNKPSSETVTEIIRNAVEIEQEFLTEALPVKLIGMNCELMKQYIEFVADRLLLELGFSKIYRAENPF 255          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Medaka
Match: ENSORLT00000040809.1 (ribonucleoside-diphosphate reductase subunit M2 [Source:NCBI gene;Acc:101158912])

HSP 1 Score: 56.9954 bits (136), Expect = 8.925e-10
Identity = 25/79 (31.65%), Postives = 43/79 (54.43%), Query Frame = 2
Query:  647 YTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPF 883
            +  F  ++F+H +NKP+      II+  VE E EFL   +   +   N   + ++++F AD++     F +IY+ ENPF
Sbjct:   19 HCDFACLMFKHLVNKPSSETVTEIIRNAVEIEQEFLTEALPVKLIGMNCELMKQYIEFVADRLLLELGFSKIYRAENPF 97          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Planmine SMEST
Match: SMESG000014842.1 (SMESG000014842.1)

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 282/282 (100.00%), Postives = 282/282 (100.00%), Query Frame = 2
Query:   41 MSLSDITNIRIHKDRRSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQFGTETYSLNSLPIGXXXXXXXXXXYWSYYNEQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSVNYKHDLMDNKIELLTNLLENESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPFK 886
            MSLSDITNIRIHKDRRSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQFGTETYSLNSLPIGEREIIERILLYWSYYNEQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSVNYKHDLMDNKIELLTNLLENESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPFK
Sbjct:    1 MSLSDITNIRIHKDRRSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQFGTETYSLNSLPIGEREIIERILLYWSYYNEQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRSVNYKHDLMDNKIELLTNLLENESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENPFK 282          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Planmine SMEST
Match: SMESG000079368.1 (SMESG000079368.1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.196e-15
Identity = 65/278 (23.38%), Postives = 127/278 (45.68%), Query Frame = 2
Query:  110 EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRS----VNYKHDLMDNKIELLTNLLEN------------ESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENP 880
            E LL  ++ R     IQY DI+  +    S F+   +     +      +   ER  I  +L +++  +    ++L+ +   +++IPEA  F+ FQI  +  H E++S+L+ S       K+ L  N IE +  + +              +FG R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F++  +KP+  +   +IK+ V  E EFL + +  S+   N   + E+++F AD++       + +  ENP
Sbjct:    2 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLF-NAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENP 278          
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Planmine SMEST
Match: SMESG000044188.1 (SMESG000044188.1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.196e-15
Identity = 65/278 (23.38%), Postives = 127/278 (45.68%), Query Frame = 2
Query:  110 EPLLISNEKRFVLFPIQYNDIYAAYQVISSKFYIPQQ--FGTETYSLNSLPIGXXXXXXXXXXYWSYYN---EQSLIFKMNNDIQIPEARCFFGFQINSQINHRELFSILLRS----VNYKHDLMDNKIELLTNLLEN------------ESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDKSEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFNQSPLSEFVQFEADKICDLFKFQRIYKGENP 880
            E LL  ++ R     IQY DI+  +    S F+   +     +      +   ER  I  +L +++  +    ++L+ +   +++IPEA  F+ FQI  +  H E++S+L+ S       K+ L  N IE +  + +              +FG R++ ++A+E I  S  +     L K   +  L    + +  D+  +  F  ++F++  +KP+  +   +IK+ V  E EFL + +  S+   N   + E+++F AD++       + +  ENP
Sbjct:    2 EILLTEDKSRIGFLNIQYEDIWEMFNKARSSFWTVNEVNLSKDFAHWKKMNDDERYFITHVLAFFAASDGIVNENLVERFIQEVKIPEAEAFYSFQIAIENIHSEMYSLLIDSYVTDTETKNKLF-NAIETMPCVQKKAQWALRWISDKKSTFGTRVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLCFSNELISRDEGLHCDFACLMFKYLSSKPSPEQVLDLIKEAVGIEKEFLTDALPVSLIGMNAESMCEYIEFVADRLLVELGCDKFWNTENP 278          
The following BLAST results are available for this feature:
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RRM2B6.782e-3127.02ribonucleotide reductase regulatory TP53 inducible... [more]
RRM2B1.543e-3027.02ribonucleotide reductase regulatory TP53 inducible... [more]
RRM23.056e-2826.16ribonucleotide reductase regulatory subunit M2 [So... [more]
RRM23.056e-2826.16ribonucleotide reductase regulatory subunit M2 [So... [more]
RRM29.718e-2826.16ribonucleotide reductase regulatory subunit M2 [So... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rnr-23.289e-1925.53Ribonucleoside-diphosphate reductase small chain ... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RnrS3.757e-2826.62gene:FBgn0011704 transcript:FBtr0088046[more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rrm22.778e-3128.06ribonucleotide reductase M2 polypeptide [Source:NC... [more]
rrm22.778e-3128.06ribonucleotide reductase regulatory subunit M2 [So... [more]
rrm23.374e-3128.06ribonucleotide reductase M2 polypeptide [Source:NC... [more]
rrm23.374e-3128.06ribonucleotide reductase regulatory subunit M2 [So... [more]
rrm27.193e-3128.06ribonucleotide reductase M2 polypeptide [Source:NC... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col6a61.031e-2926.24collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-... [more]
col6a61.259e-2926.07collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-... [more]
col6a61.774e-2926.07collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-... [more]
col6a62.027e-2926.07collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-... [more]
col6a62.093e-2926.10collagen, type VI, alpha 6 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rrm2b6.210e-3127.34ribonucleotide reductase M2 B (TP53 inducible) [So... [more]
Rrm23.490e-2825.81ribonucleotide reductase M2 [Source:MGI Symbol;Acc... [more]
Rrm2b3.430e-2326.34ribonucleotide reductase M2 B (TP53 inducible) [So... [more]
Rrm21.385e-1226.82ribonucleotide reductase M2 [Source:MGI Symbol;Acc... [more]
Rrm2b1.691e-929.35ribonucleotide reductase M2 B (TP53 inducible) [So... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7LG56|RIR2B_HUMAN3.257e-3027.02Ribonucleoside-diphosphate reductase subunit M2 B ... [more]
sp|Q4R741|RIR2B_MACFA3.394e-3027.37Ribonucleoside-diphosphate reductase subunit M2 B ... [more]
sp|Q6PEE3|RIR2B_MOUSE4.344e-3027.34Ribonucleoside-diphosphate reductase subunit M2 B ... [more]
sp|P79733|RIR2_DANRE5.430e-3028.06Ribonucleoside-diphosphate reductase subunit M2 OS... [more]
sp|Q5R9G0|RIR2B_PONAB1.095e-2926.67Ribonucleoside-diphosphate reductase subunit M2 B ... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIH20.000e+0100.00Ribonucleoside diphosphate reductase subunit M2 OS... [more]
A0A137NXH31.162e-3130.25Ribonucleotide reductase OS=Conidiobolus coronatus... [more]
A0A1I7RNM75.016e-3130.39Uncharacterized protein OS=Bursaphelenchus xylophi... [more]
A0A183SWT05.643e-3127.24Ribonucleoside-diphosphate reductase subunit M2 OS... [more]
A0A0L7QU827.060e-3128.43Ribonucleoside-diphosphate reductase subunit M2 OS... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rrm26.285e-3128.42ribonucleotide reductase regulatory subunit M2 [So... [more]
rrm26.285e-3128.42ribonucleotide reductase regulatory subunit M2 [So... [more]
rrm2b1.737e-3028.08ribonucleoside-diphosphate reductase subunit M2 B-... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rrm29.470e-3225.91ribonucleotide reductase regulatory subunit M2 [So... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RNR29.816e-2725.94Ribonucleotide-diphosphate reductase (RNR), small ... [more]
RNR42.575e-2023.39Ribonucleotide-diphosphate reductase (RNR) small s... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO421175.805e-3127.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421161.259e-3027.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420877.167e-3027.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283151.488e-1125.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RRM21.694e-3127.42ribonucleoside-diphosphate reductase subunit M2-li... [more]
rrm2b7.337e-2427.30ribonucleoside-diphosphate reductase subunit M2 B ... [more]
rrm2b1.515e-2327.40ribonucleoside-diphosphate reductase subunit M2 B ... [more]
ENSORLT00000025443.28.539e-2327.32ribonucleoside-diphosphate reductase subunit M2 [S... [more]
ENSORLT00000040809.18.925e-1031.65ribonucleoside-diphosphate reductase subunit M2 [S... [more]
back to top
BLAST of ribonucleoside diphosphate reductase subunit M2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000014842.10.000e+0100.00SMESG000014842.1[more]
SMESG000079368.12.196e-1523.38SMESG000079368.1[more]
SMESG000044188.12.196e-1523.38SMESG000044188.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30026659
GenBankAFJ24826.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026659 ID=SMED30026659|Name=ribonucleoside diphosphate reductase subunit M2|organism=Schmidtea mediterranea sexual|type=transcript|length=947bp
ATCTTTCATGTTGTTTTAATTTTGCGCAGTAATTTTTGAAATGTCTTTAT
CTGATATAACTAACATTCGAATTCACAAAGACAGAAGATCAGAAATATTA
GACAGAAATGAGCCATTATTAATATCTAATGAGAAACGTTTTGTTCTATT
TCCCATTCAATATAACGATATTTATGCCGCCTATCAAGTTATATCATCAA
AATTTTACATTCCTCAACAATTCGGTACTGAAACATATTCTTTGAATTCT
TTACCAATAGGTGAACGGGAAATAATCGAACGAATCTTACTATATTGGAG
TTATTATAACGAGCAAAGTTTAATTTTTAAAATGAATAACGATATTCAAA
TTCCTGAAGCTCGCTGCTTTTTTGGTTTTCAAATTAATAGCCAAATAAAT
CACAGAGAGCTATTTTCAATACTTTTGCGAAGTGTCAATTACAAACACGA
TTTGATGGACAATAAAATAGAGTTGCTTACTAATTTACTTGAGAATGAAT
CATTTGGTGGGCGACTGATTACGTATTCTGCAATGGAATCCATTTGTATT
AGCTCATTATATATTTTAAAAATGCTTTTGCTCAAATCAGATGAGCTTAA
GTATTTAATAATCCGAATTGATGCTGTGTTGAATGACAAATCTGAATATA
CAAAATTCGGTGCTATTCTTTTCCGTCACTGCATAAACAAGCCGAATGAG
AGCAAATTCCATTCGATCATCAAGCAAATAGTCGAAGCAGAAATTGAATT
TCTAGTAAATATTATCGGTAGTTCAATTTGCAGTTTCAATCAATCGCCTT
TATCTGAATTCGTGCAATTCGAAGCTGATAAGATTTGTGATTTATTTAAA
TTCCAAAGGATTTACAAAGGCGAGAATCCATTCAAATAGCCAAATCTATT
CTAGTCCTCTTTGATGTCTATCATTGTTTATTTAAAAATAAAAATTA
back to top

protein sequence of SMED30026659-orf-1

>SMED30026659-orf-1 ID=SMED30026659-orf-1|Name=SMED30026659-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=283bp
MSLSDITNIRIHKDRRSEILDRNEPLLISNEKRFVLFPIQYNDIYAAYQV
ISSKFYIPQQFGTETYSLNSLPIGEREIIERILLYWSYYNEQSLIFKMNN
DIQIPEARCFFGFQINSQINHRELFSILLRSVNYKHDLMDNKIELLTNLL
ENESFGGRLITYSAMESICISSLYILKMLLLKSDELKYLIIRIDAVLNDK
SEYTKFGAILFRHCINKPNESKFHSIIKQIVEAEIEFLVNIIGSSICSFN
QSPLSEFVQFEADKICDLFKFQRIYKGENPFK*
back to top
Aliases
The feature 'ribonucleoside diphosphate reductase subunit M2' has the following synonyms
Synonym
RRM2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0009263deoxyribonucleotide biosynthetic process
GO:0055114oxidation-reduction process
GO:0009186deoxyribonucleoside diphosphate metabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR000358RNR_small_fam
IPR009078Ferritin-like_SF
IPR012348RNR-like
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000358Ribonucleotide reductase small subunit familyPFAMPF00268Ribonuc_red_smcoord: 33..280
e-value: 1.9E-33
score: 116.1
IPR000358Ribonucleotide reductase small subunit familyPANTHERPTHR23409RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SMALL CHAINcoord: 13..281
IPR012348Ribonucleotide reductase-likeGENE3DG3DSA:1.10.620.20coord: 4..282
e-value: 1.1E-44
score: 154.7
NoneNo IPR availablePANTHERPTHR23409:SF19RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SUBUNIT M2 Bcoord: 13..281
IPR009078Ferritin-like superfamilySUPERFAMILYSSF47240Ferritin-likecoord: 15..281