Dynein light chain

Overview
NameDynein light chain
Smed IDSMED30026646
Length (bp)426
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein light chain (SMED30026646) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein light chain (SMED30026646) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein light chain (SMED30026646) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein light chain (SMED30026646) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026646

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30026646 dd_Smed_v4_107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30026646 dd_Smed_v4_107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026646 dd_Smed_v4_107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026646 dd_Smed_v4_107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026646 dd_Smed_v4_107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026646 Contig35396newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026646 Contig35396uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30026646 dd_Smed_v6_107_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30026646 OX_Smed_1.0.03580ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30026646 dd_Smed_v4_107_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026646 dd_Smed_v6_107_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30026646 dd_Smed_v6_107_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026646 dd_Smed_v4_107_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026646 SMED_06109_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30026646 SMED_06109_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein light chain vs. Ensembl Human
Match: DYNLL2 (dynein light chain LC8-type 2 [Source:HGNC Symbol;Acc:HGNC:24596])

HSP 1 Score: 55.8398 bits (133), Expect = 1.307e-10
Identity = 27/90 (30.00%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++   +K   M  ++  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 55.4546 bits (132), Expect = 1.840e-10
Identity = 28/90 (31.11%), Postives = 45/90 (50.00%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            M ++   +K   M  E+  +  E   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 55.4546 bits (132), Expect = 1.840e-10
Identity = 28/90 (31.11%), Postives = 45/90 (50.00%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            M ++   +K   M  E+  +  E   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 55.4546 bits (132), Expect = 1.840e-10
Identity = 28/90 (31.11%), Postives = 45/90 (50.00%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            M ++   +K   M  E+  +  E   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Human
Match: DYNLL1 (dynein light chain LC8-type 1 [Source:HGNC Symbol;Acc:HGNC:15476])

HSP 1 Score: 55.4546 bits (132), Expect = 1.840e-10
Identity = 28/90 (31.11%), Postives = 45/90 (50.00%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            M ++   +K   M  E+  +  E   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Celegans
Match: dlc-2 (Probable dynein light chain 2, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q21557])

HSP 1 Score: 57.3806 bits (137), Expect = 1.207e-11
Identity = 35/90 (38.89%), Postives = 48/90 (53.33%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS + IEVKET M+      +  +V++        KD A  +K+ELD KF   WHV+ GK F + V+YE   +  L C     V I+KCG
Sbjct:    1 MSEEKIEVKETDMEDPQRDMVISVVREAQRLYNIDKDVAAFVKEELDKKFGATWHVICGKCFGSRVSYEMGHFILLKC-NKVNVMIYKCG 89          
BLAST of Dynein light chain vs. Ensembl Celegans
Match: dlc-1 (Dynein light chain 1, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q22799])

HSP 1 Score: 53.9138 bits (128), Expect = 2.294e-10
Identity = 26/90 (28.89%), Postives = 45/90 (50.00%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            M ++   +K   M  ++  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MVDRKAVIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Celegans
Match: dlc-1 (Dynein light chain 1, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q22799])

HSP 1 Score: 53.9138 bits (128), Expect = 2.294e-10
Identity = 26/90 (28.89%), Postives = 45/90 (50.00%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            M ++   +K   M  ++  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MVDRKAVIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Celegans
Match: dlc-1 (Dynein light chain 1, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q22799])

HSP 1 Score: 53.9138 bits (128), Expect = 2.294e-10
Identity = 26/90 (28.89%), Postives = 45/90 (50.00%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            M ++   +K   M  ++  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MVDRKAVIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0070706)

HSP 1 Score: 56.9954 bits (136), Expect = 1.975e-11
Identity = 28/90 (31.11%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++   +K   M  E+  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0070704)

HSP 1 Score: 56.9954 bits (136), Expect = 1.975e-11
Identity = 28/90 (31.11%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++   +K   M  E+  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0307065)

HSP 1 Score: 56.9954 bits (136), Expect = 1.975e-11
Identity = 28/90 (31.11%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++   +K   M  E+  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Fly
Match: ctp (gene:FBgn0011760 transcript:FBtr0070707)

HSP 1 Score: 56.9954 bits (136), Expect = 1.975e-11
Identity = 28/90 (31.11%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++   +K   M  E+  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Fly
Match: Cdlc2 (gene:FBgn0026141 transcript:FBtr0077924)

HSP 1 Score: 56.6102 bits (135), Expect = 2.997e-11
Identity = 28/90 (31.11%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++   +K   M  E+  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Zebrafish
Match: dynll1 (dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1961])

HSP 1 Score: 58.151 bits (139), Expect = 1.163e-11
Identity = 29/90 (32.22%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++   +K   M  E+  +  E   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Zebrafish
Match: dynll1 (dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1961])

HSP 1 Score: 58.151 bits (139), Expect = 1.163e-11
Identity = 29/90 (32.22%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++   +K   M  E+  +  E   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Zebrafish
Match: dynll2a (dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:ZDB-GENE-030828-11])

HSP 1 Score: 54.6842 bits (130), Expect = 2.244e-10
Identity = 26/90 (28.89%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            M+++   +K   M  ++  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Zebrafish
Match: dynll2b (dynein, light chain, LC8-type 2b [Source:ZFIN;Acc:ZDB-GENE-050320-132])

HSP 1 Score: 54.6842 bits (130), Expect = 2.244e-10
Identity = 26/90 (28.89%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            M+++   +K   M  ++  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Zebrafish
Match: dynll2a (dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:ZDB-GENE-030828-11])

HSP 1 Score: 54.6842 bits (130), Expect = 2.244e-10
Identity = 26/90 (28.89%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            M+++   +K   M  ++  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Xenopus
Match: dynll2 (dynein light chain LC8-type 2 [Source:NCBI gene;Acc:100038056])

HSP 1 Score: 55.8398 bits (133), Expect = 1.185e-10
Identity = 27/90 (30.00%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++   +K   M  ++  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Xenopus
Match: dynll1 (dynein light chain LC8-type 1 [Source:NCBI gene;Acc:448652])

HSP 1 Score: 55.4546 bits (132), Expect = 1.650e-10
Identity = 28/90 (31.11%), Postives = 45/90 (50.00%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS +   +K   M  E+  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSERKAVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Xenopus
Match: rnf181 (ring finger protein 181 [Source:Xenbase;Acc:XB-GENE-964051])

HSP 1 Score: 48.521 bits (114), Expect = 1.160e-7
Identity = 27/83 (32.53%), Postives = 45/83 (54.22%), Query Frame = 1
Query:   64 VKETKMDSELTHEIKEIVKQVFEECESAKDRAER-IKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKC 309
            ++ T M  E+  E  E+     E+  S  + A + IK+ +D KF   WHVVIG+ F   +T+E     ++  GG+ A+ ++KC
Sbjct:   23 IRHTDMPEEMRVETMELCVTACEKFASNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYMFFGGSLAICVWKC 105          
BLAST of Dynein light chain vs. Ensembl Mouse
Match: BC048507 (cDNA sequence BC048507 [Source:MGI Symbol;Acc:MGI:3040680])

HSP 1 Score: 56.225 bits (134), Expect = 6.585e-11
Identity = 28/90 (31.11%), Postives = 45/90 (50.00%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            M ++   +K   M  E+  +      Q  E+  + KD A  IKKE D K+   WH ++G+ F ++VTYE   + +    G  A+ +FK G
Sbjct:    1 MCDRKAVIKTVDMSEEMQQDSVRCAIQALEKYSTEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTYETKHFVYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Mouse
Match: Dynll2 (dynein light chain LC8-type 2 [Source:MGI Symbol;Acc:MGI:1915347])

HSP 1 Score: 55.8398 bits (133), Expect = 8.976e-11
Identity = 27/90 (30.00%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++   +K   M  ++  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Mouse
Match: Dynll2 (dynein light chain LC8-type 2 [Source:MGI Symbol;Acc:MGI:1915347])

HSP 1 Score: 55.8398 bits (133), Expect = 8.976e-11
Identity = 27/90 (30.00%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++   +K   M  ++  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Mouse
Match: Dynll2 (dynein light chain LC8-type 2 [Source:MGI Symbol;Acc:MGI:1915347])

HSP 1 Score: 55.8398 bits (133), Expect = 8.976e-11
Identity = 27/90 (30.00%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++   +K   M  ++  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Mouse
Match: Dynll1 (dynein light chain LC8-type 1 [Source:MGI Symbol;Acc:MGI:1861457])

HSP 1 Score: 55.4546 bits (132), Expect = 1.263e-10
Identity = 28/90 (31.11%), Postives = 45/90 (50.00%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            M ++   +K   M  E+  +  E   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. UniProt/SwissProt
Match: sp|Q21557|DYL2_CAEEL (Probable dynein light chain 2, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=dlc-2 PE=3 SV=2)

HSP 1 Score: 57.3806 bits (137), Expect = 1.535e-10
Identity = 35/90 (38.89%), Postives = 48/90 (53.33%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS + IEVKET M+      +  +V++        KD A  +K+ELD KF   WHV+ GK F + V+YE   +  L C     V I+KCG
Sbjct:    1 MSEEKIEVKETDMEDPQRDMVISVVREAQRLYNIDKDVAAFVKEELDKKFGATWHVICGKCFGSRVSYEMGHFILLKC-NKVNVMIYKCG 89          
BLAST of Dynein light chain vs. UniProt/SwissProt
Match: sp|Q24117|DYL1_DROME (Dynein light chain 1, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=ctp PE=1 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.980e-10
Identity = 28/90 (31.11%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++   +K   M  E+  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. UniProt/SwissProt
Match: sp|Q759T0|DYL1_ASHGO (Dynein light chain 1, cytoplasmic OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DYN2 PE=3 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 2.580e-10
Identity = 33/90 (36.67%), Postives = 49/90 (54.44%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS   I +K + +  EL  EI  I  Q  E+ +  ++ A  IKKELD K  Q WHV++GK F ++VT+E+  + +    G  A  +FK  
Sbjct:    1 MSKPAI-LKASDITDELRDEIFGISVQAVEQFQLEREVAAYIKKELDSKHGQTWHVIVGKNFGSYVTHEKGHFIYFYI-GPLAFLVFKTA 88          
BLAST of Dynein light chain vs. UniProt/SwissProt
Match: sp|O96860|DYL2_DROME (Dynein light chain 2, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=Cdlc2 PE=1 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 3.004e-10
Identity = 28/90 (31.11%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++   +K   M  E+  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. UniProt/SwissProt
Match: sp|Q6FUJ0|DYL1_CANGA (Dynein light chain 1, cytoplasmic OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DYN2 PE=3 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 3.283e-10
Identity = 26/82 (31.71%), Postives = 47/82 (57.32%), Query Frame = 1
Query:   64 VKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKC 309
            VK + M  E+  E+  I ++   E    ++ A  IKKE+D ++   WHV++G+ F ++VT+E+ K+ +    G  A+ +FK 
Sbjct:    6 VKASDMGDEMQQEVFRIAEEAMREHTLEREIASVIKKEMDSRYGHTWHVIVGRSFGSYVTHEKGKFVYFYV-GPLALLVFKT 86          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A0R3W0N3 (Dynein light chain OS=Taenia asiatica OX=60517 GN=TASK_LOCUS3233 PE=3 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.795e-11
Identity = 32/91 (35.16%), Postives = 52/91 (57.14%), Query Frame = 1
Query:   43 MSNKGIEV-KETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++G  V K   MDS +  +   I  + FE+    KD A  IK+E D ++   WH ++GK F ++VT+E + + +    GNTA+ ++K G
Sbjct:    1 MSSQGDAVIKNADMDSTMRSDAVSIANEAFEKFSIEKDVAAHIKREFDKRYSPNWHCIVGKNFGSYVTHEANHFIYFYL-GNTAILLYKAG 90          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A0R3WWY9 (Dynein light chain OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS5267 PE=3 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 2.227e-11
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 1
Query:   64 VKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            +K   MDS +  +   I  Q FE+    KD A  IK+E D ++   WH ++GK F ++VT+E + + +    GNTAV ++K G
Sbjct:    9 IKNADMDSAMQKDAVSIATQAFEKLSIEKDVAGYIKREFDKRYSPNWHCIVGKNFGSYVTHEANHFIYFYL-GNTAVLLYKAG 90          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A564Z743 (Dynein light chain OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS12838 PE=3 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.915e-11
Identity = 32/88 (36.36%), Postives = 50/88 (56.82%), Query Frame = 1
Query:   49 NKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            N    +K   MDSE+     ++  + FE+    KD A  IKKE D ++   WH ++G+ F ++VT+E S + ++   GNTAV +FK G
Sbjct:    4 NDDAVIKNADMDSEMQKAAVDVSFEAFEKFSIEKDVASYIKKEFDKRYLPNWHCIVGRHFGSYVTHEASHFIYMYL-GNTAVLLFKTG 90          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A504YES0 (Dynein light chain OS=Fasciola gigantica OX=46835 GN=FGIG_05368 PE=3 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 8.134e-11
Identity = 32/83 (38.55%), Postives = 45/83 (54.22%), Query Frame = 1
Query:   64 VKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            VK   M  E+ HE  E+  Q FE+    KD A  IKKE D +    WH V+G+ F ++VT+E   + +  C G  A+ +FK G
Sbjct:   10 VKNADMSEEMQHEAIEVAGQAFEKFNIEKDIAAYIKKEFDKRHGPTWHCVVGRNFGSYVTHETKHFVYFYC-GQVAILLFKSG 91          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A2H1CT65 (Dynein light chain OS=Fasciola hepatica OX=6192 GN=D915_001800 PE=3 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 8.134e-11
Identity = 32/83 (38.55%), Postives = 45/83 (54.22%), Query Frame = 1
Query:   64 VKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            VK   M  E+ HE  E+  Q FE+    KD A  IKKE D +    WH V+G+ F ++VT+E   + +  C G  A+ +FK G
Sbjct:   10 VKNADMSEEMQHEAIEVAGQAFEKFNIEKDIAAYIKKEFDKRHGPTWHCVVGRNFGSYVTHETKHFVYFYC-GQVAILLFKSG 91          
BLAST of Dynein light chain vs. Ensembl Cavefish
Match: ENSAMXT00000047143.1 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:103041528])

HSP 1 Score: 54.6842 bits (130), Expect = 1.902e-10
Identity = 26/90 (28.89%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            M+++   +K   M  ++  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Cavefish
Match: dynll2b (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:103041528])

HSP 1 Score: 54.6842 bits (130), Expect = 1.902e-10
Identity = 26/90 (28.89%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            M+++   +K   M  ++  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Cavefish
Match: dynll1 (dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1961])

HSP 1 Score: 53.9138 bits (128), Expect = 7.854e-10
Identity = 25/87 (28.74%), Postives = 42/87 (48.28%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIF 303
            MS++   +K   M  E+  +  E   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +   G      ++
Sbjct:    1 MSDRKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQRNGWAVW 87          
BLAST of Dynein light chain vs. Ensembl Cavefish
Match: dnal4b (dynein axonemal light chain 4 [Source:NCBI gene;Acc:103029781])

HSP 1 Score: 48.521 bits (114), Expect = 6.276e-8
Identity = 28/83 (33.73%), Postives = 45/83 (54.22%), Query Frame = 1
Query:   64 VKETKMDSELTHEIKEIVKQVFEECESAKDRAER-IKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKC 309
            ++ T M  E+  E  E+     E+  +  + A + IK+ +D KF   WHVVIG+ F   VT+E     ++  GG+ AV ++KC
Sbjct:   23 IRHTDMPEEMRVETMELCVTACEKFATNNESAAKMIKESMDKKFGSSWHVVIGEGFGFEVTHEVKNLLYMFFGGSLAVCVWKC 105          
BLAST of Dynein light chain vs. Ensembl Yeast
Match: DYN2 (Cytoplasmic light chain dynein, microtubule motor protein; required for intracellular transport and cell division; involved in mitotic spindle positioning; forms complex with dynein intermediate chain Pac11p that promotes Dyn1p homodimerization, potentiates motor processivity; Dyn2p-Pac11p complex important for interaction of dynein motor complex with dynactin complex; acts as molecular glue to dimerize, stabilize Nup82-Nsp1-Nup159 complex module of cytoplasmic pore filaments [Source:SGD;Acc:S000002832])

HSP 1 Score: 53.1434 bits (126), Expect = 1.055e-10
Identity = 26/83 (31.33%), Postives = 46/83 (55.42%), Query Frame = 1
Query:   64 VKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            VK + +  +L  +I  I K   ++ +  +D A  +KK+LD K+   WHV++GK F ++VT+E+  + +    G  A  +FK  
Sbjct:   11 VKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVGKNFGSYVTHEKGHFVYFYI-GPLAFLVFKTA 92          
BLAST of Dynein light chain vs. Ensembl Nematostella
Match: EDO44582 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVI5])

HSP 1 Score: 54.299 bits (129), Expect = 1.041e-10
Identity = 28/90 (31.11%), Postives = 45/90 (50.00%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS +   +K   M  ++  +  E   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSERKAVIKNADMAEDMQTDAIECATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Nematostella
Match: EDO38557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCP2])

HSP 1 Score: 47.7506 bits (112), Expect = 5.511e-8
Identity = 25/83 (30.12%), Postives = 45/83 (54.22%), Query Frame = 1
Query:   64 VKETKMDSELTHEIKEIVKQVFEECESAKDRAER-IKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKC 309
            ++ + M+ E+  E  E+     E+  +  + A + IK+ +D KF   WH V+G+ F   +T+E     ++  GG TA+ I+KC
Sbjct:   27 IRYSDMNDEMRTEAMELCVTACEKFSNNNETAAKMIKESMDKKFGASWHAVVGEGFGFEITHEVRNLLYMFFGGTTAICIWKC 109          
BLAST of Dynein light chain vs. Ensembl Medaka
Match: DYNLL2 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:101174042])

HSP 1 Score: 56.9954 bits (136), Expect = 2.094e-11
Identity = 28/90 (31.11%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS+K   +K   M  E+  +  +   Q  E+    KD A  +KKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDKKAVIKNADMSDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Medaka
Match: dynll1 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:101171417])

HSP 1 Score: 56.9954 bits (136), Expect = 2.257e-11
Identity = 28/90 (31.11%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            MS++   +K   M  ++  +  E   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MSDRKAVIKNADMSEDMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Medaka
Match: ENSORLT00000005747.2 (dynein light chain 2, cytoplasmic [Source:NCBI gene;Acc:101162462])

HSP 1 Score: 55.4546 bits (132), Expect = 8.580e-11
Identity = 27/90 (30.00%), Postives = 46/90 (51.11%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            M+++   +K   M  E+  +  +   Q  E+    KD A  IKKE D K+   WH ++G+ F ++VT+E   + +    G  A+ +FK G
Sbjct:    1 MTDRKAVIKNADMSEEMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYL-GQVAILLFKSG 89          
BLAST of Dynein light chain vs. Ensembl Medaka
Match: dnal4b (dynein axonemal light chain 4 [Source:NCBI gene;Acc:101161374])

HSP 1 Score: 49.2914 bits (116), Expect = 3.317e-8
Identity = 28/83 (33.73%), Postives = 44/83 (53.01%), Query Frame = 1
Query:   64 VKETKMDSELTHEIKEIVKQVFEECESAKDRAER-IKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKC 309
            ++ T M  E+  E  E+     E   +  + A + IK+ +D KF   WHVVIG+ F   VT+E     ++  GG+ AV ++KC
Sbjct:   23 IRHTDMPDEMRIETMELCVSACETFATNNESAAKMIKEHMDKKFGSSWHVVIGESFGFEVTHELKNLLYMFFGGSLAVCVWKC 105          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000009941.1 (SMESG000009941.1)

HSP 1 Score: 185.652 bits (470), Expect = 4.819e-62
Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 1
Query:   43 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCGS 315
            MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCGS
Sbjct:    1 MSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCGS 91          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000007775.1 (SMESG000007775.1)

HSP 1 Score: 78.5666 bits (192), Expect = 8.045e-20
Identity = 36/85 (42.35%), Postives = 54/85 (63.53%), Query Frame = 1
Query:   58 IEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            + ++ +K   +    I EIV+ VF+  ES  +RA+ IK +LD +FE  W  ++GK F T+VT+EE K+CH+  G  T VQ+FK G
Sbjct:    3 VTIESSKCTDDENKRISEIVEDVFQNLESNAERAKEIKAKLDQEFEGPWQCIVGKNFATYVTHEEHKFCHVKVGSQTGVQVFKAG 87          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000008798.1 (SMESG000008798.1)

HSP 1 Score: 73.1738 bits (178), Expect = 8.347e-18
Identity = 36/83 (43.37%), Postives = 52/83 (62.65%), Query Frame = 1
Query:   64 VKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCG 312
            V ET+M +E T ++ EI ++ FEE +   DR   IKK++D++F   WHV+IGK F T + YEE  +CH     N  VQ++K G
Sbjct:    5 VIETEMSTEKTDQMVEIFEKAFEENDLDCDRVVAIKKKVDEQFGTNWHVIIGKHFITKINYEEDNFCHCRMPNNMGVQVYKSG 87          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000008800.1 (SMESG000008800.1)

HSP 1 Score: 63.5438 bits (153), Expect = 6.441e-14
Identity = 31/84 (36.90%), Postives = 49/84 (58.33%), Query Frame = 1
Query:   58 IEVKETKMDSELTHEIKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKC 309
            I + ++KM +E    I E V  +F E  + ++RA+ IK +LD +F   W V+IG  FTT +T+E+ + C L  G    +Q+FK 
Sbjct:    8 ITLIDSKMSTEDNEFIVETVGNIFNEKNTNRERAKDIKTKLDIQFGTSWQVIIGLSFTTMITHEQDQICTLKVGEKIGIQMFKT 91          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000024857.1 (SMESG000024857.1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.885e-13
Identity = 32/71 (45.07%), Postives = 46/71 (64.79%), Query Frame = 1
Query:  103 IKEIVKQVFEECESAKDRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQIFKCGS 315
            I EI + VF+E E  KDRA++IKKELD K E  WHV IGK +T++V+  E  +      G+  +Q++ CG+
Sbjct:   43 ILEIFRSVFQETEELKDRAQQIKKELDAKEEGMWHVTIGKHYTSYVSCAEESFFQAT-FGDLLIQVYCCGN 112          
The following BLAST results are available for this feature:
BLAST of Dynein light chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYNLL21.307e-1030.00dynein light chain LC8-type 2 [Source:HGNC Symbol;... [more]
DYNLL11.840e-1031.11dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
DYNLL11.840e-1031.11dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
DYNLL11.840e-1031.11dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
DYNLL11.840e-1031.11dynein light chain LC8-type 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dlc-21.207e-1138.89Probable dynein light chain 2, cytoplasmic [Sourc... [more]
dlc-12.294e-1028.89Dynein light chain 1, cytoplasmic [Source:UniProt... [more]
dlc-12.294e-1028.89Dynein light chain 1, cytoplasmic [Source:UniProt... [more]
dlc-12.294e-1028.89Dynein light chain 1, cytoplasmic [Source:UniProt... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctp1.975e-1131.11gene:FBgn0011760 transcript:FBtr0070706[more]
ctp1.975e-1131.11gene:FBgn0011760 transcript:FBtr0070704[more]
ctp1.975e-1131.11gene:FBgn0011760 transcript:FBtr0307065[more]
ctp1.975e-1131.11gene:FBgn0011760 transcript:FBtr0070707[more]
Cdlc22.997e-1131.11gene:FBgn0026141 transcript:FBtr0077924[more]
back to top
BLAST of Dynein light chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dynll11.163e-1132.22dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:Z... [more]
dynll11.163e-1132.22dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:Z... [more]
dynll2a2.244e-1028.89dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:... [more]
dynll2b2.244e-1028.89dynein, light chain, LC8-type 2b [Source:ZFIN;Acc:... [more]
dynll2a2.244e-1028.89dynein, light chain, LC8-type 2a [Source:ZFIN;Acc:... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dynll21.185e-1030.00dynein light chain LC8-type 2 [Source:NCBI gene;Ac... [more]
dynll11.650e-1031.11dynein light chain LC8-type 1 [Source:NCBI gene;Ac... [more]
rnf1811.160e-732.53ring finger protein 181 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BC0485076.585e-1131.11cDNA sequence BC048507 [Source:MGI Symbol;Acc:MGI:... [more]
Dynll28.976e-1130.00dynein light chain LC8-type 2 [Source:MGI Symbol;A... [more]
Dynll28.976e-1130.00dynein light chain LC8-type 2 [Source:MGI Symbol;A... [more]
Dynll28.976e-1130.00dynein light chain LC8-type 2 [Source:MGI Symbol;A... [more]
Dynll11.263e-1031.11dynein light chain LC8-type 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Dynein light chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q21557|DYL2_CAEEL1.535e-1038.89Probable dynein light chain 2, cytoplasmic OS=Caen... [more]
sp|Q24117|DYL1_DROME1.980e-1031.11Dynein light chain 1, cytoplasmic OS=Drosophila me... [more]
sp|Q759T0|DYL1_ASHGO2.580e-1036.67Dynein light chain 1, cytoplasmic OS=Ashbya gossyp... [more]
sp|O96860|DYL2_DROME3.004e-1031.11Dynein light chain 2, cytoplasmic OS=Drosophila me... [more]
sp|Q6FUJ0|DYL1_CANGA3.283e-1031.71Dynein light chain 1, cytoplasmic OS=Candida glabr... [more]
back to top
BLAST of Dynein light chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3W0N31.795e-1135.16Dynein light chain OS=Taenia asiatica OX=60517 GN=... [more]
A0A0R3WWY92.227e-1136.14Dynein light chain OS=Hydatigena taeniaeformis OX=... [more]
A0A564Z7432.915e-1136.36Dynein light chain OS=Hymenolepis diminuta OX=6216... [more]
A0A504YES08.134e-1138.55Dynein light chain OS=Fasciola gigantica OX=46835 ... [more]
A0A2H1CT658.134e-1138.55Dynein light chain OS=Fasciola hepatica OX=6192 GN... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000047143.11.902e-1028.89dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
dynll2b1.902e-1028.89dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
dynll17.854e-1028.74dynein, light chain, LC8-type 1 [Source:ZFIN;Acc:Z... [more]
dnal4b6.276e-833.73dynein axonemal light chain 4 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN21.055e-1031.33Cytoplasmic light chain dynein, microtubule motor ... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO445821.041e-1031.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385575.511e-830.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
DYNLL22.094e-1131.11dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
dynll12.257e-1131.11dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
ENSORLT00000005747.28.580e-1130.00dynein light chain 2, cytoplasmic [Source:NCBI gen... [more]
dnal4b3.317e-833.73dynein axonemal light chain 4 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Dynein light chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009941.14.819e-62100.00SMESG000009941.1[more]
SMESG000007775.18.045e-2042.35SMESG000007775.1[more]
SMESG000008798.18.347e-1843.37SMESG000008798.1[more]
SMESG000008800.16.441e-1436.90SMESG000008800.1[more]
SMESG000024857.11.885e-1345.07SMESG000024857.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026646 ID=SMED30026646|Name=Dynein light chain|organism=Schmidtea mediterranea sexual|type=transcript|length=426bp
TTCAGATACTTTCTATTATTATTATTATTCTGTGAATTAACAATGAGCAA
CAAAGGTATTGAAGTTAAAGAAACAAAAATGGACAGTGAGTTAACTCACG
AGATTAAAGAAATCGTCAAGCAGGTCTTTGAAGAATGCGAATCAGCAAAA
GACCGAGCTGAAAGAATTAAGAAAGAATTAGATGATAAATTTGAGCAATA
CTGGCATGTGGTTATTGGAAAACAATTCACGACATTTGTTACTTATGAAG
AATCTAAATATTGTCACTTAGTTTGTGGTGGAAACACTGCTGTTCAAATA
TTCAAATGTGGCTCATAAGAGTTTTATGAGCTCCTAGAAATTTTTATAGT
GATATTGTGCTTTGCTTTTATTTCGTAAATCATAAGATATTGTTTAAAAA
TAAATTAATGATGCTTTAAAAAAAAA
back to top

protein sequence of SMED30026646-orf-1

>SMED30026646-orf-1 ID=SMED30026646-orf-1|Name=SMED30026646-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=106bp
FRYFLLLLLFCELTMSNKGIEVKETKMDSELTHEIKEIVKQVFEECESAK
DRAERIKKELDDKFEQYWHVVIGKQFTTFVTYEESKYCHLVCGGNTAVQI
FKCGS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003774motor activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0030286dynein complex
GO:0005875microtubule associated complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037177DLC_sf
IPR001372Dynein_light_chain_typ-1/2
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 39..66
NoneNo IPR availablePANTHERPTHR11886:SF35DYNEIN LIGHT CHAIN 2, CYTOPLASMICcoord: 13..104
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.77
IPR001372Dynein light chain, type 1/2SMARTSM01375Dynein_light_2coord: 15..103
e-value: 8.2E-23
score: 91.8
IPR001372Dynein light chain, type 1/2PFAMPF01221Dynein_lightcoord: 20..103
e-value: 2.3E-21
score: 75.9
IPR001372Dynein light chain, type 1/2PANTHERPTHR11886DYNEIN LIGHT CHAINcoord: 13..104
IPR037177Dynein light chain superfamilyGENE3DG3DSA:3.30.740.10coord: 11..103
e-value: 1.6E-21
score: 78.1
IPR037177Dynein light chain superfamilySUPERFAMILYSSF54648DLCcoord: 14..104