slc6a-6

Overview
Nameslc6a-6 (AKN21426.1)
Smed IDSMED30026643
Length (bp)2418
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc6a-6 (SMED30026643) t-SNE clustered cells

Violin plots show distribution of expression levels for slc6a-6 (SMED30026643) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc6a-6 (SMED30026643) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc6a-6 (SMED30026643) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026643

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026643SMESG000050382.1 SmedASXL_012246SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30026643SMESG000050382.1 dd_Smed_v4_6616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026643SMESG000050382.1 dd_Smed_v4_6616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026643SMESG000050382.1 dd_Smed_v4_6616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30026643SMESG000050382.1 dd_Smed_v4_6616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026643SMESG000050382.1 dd_Smed_v6_6616_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc6a-6 vs. Ensembl Human
Match: SLC6A5 (solute carrier family 6 member 5 [Source:HGNC Symbol;Acc:HGNC:11051])

HSP 1 Score: 461.07 bits (1185), Expect = 3.692e-150
Identity = 261/581 (44.92%), Postives = 367/581 (63.17%), Query Frame = 1
Query:  304 RQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDST--------------MDIYNWSL---AHPNSTKV-----------SPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRR-LRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWII--LREVIKPKSEWGPADEENR 1953
            R  W  K++F+ S V  AVGLGNVWRFPYL ++NGGGAFL+PY  ML L GLP+FF+E++ GQFAS GP++VW   P  +G G  M+I S +++ YYNVII  +L+YLFASF +VLPW  C+       C D T              + I N +    A+PN T V           S SE+YF+  VL IS  I   G  +W L LCL LAW++V A L KGI + GKV YFTA FPYV+L ILLIRG  LPGA  GI ++I P+++++ D+ VW DAATQIFFSLS   G LIT+SSYN F NNC RD + V   N ATSIFAGFVIF+ +GFMA+ +   I+NV D+GPG+AFVVYPEALT + ++P W+I FFLM++TLG  + FA +ET++  I DE  + LR      H  +F +  CI  F++G PM  +GG+Y+  ++D   + Y L+++A+ E++ I Y YG+ RF +DI +M   +PN +W++ W +++P +++ ++ F F   + + YG + YP   + L   +    +I++P +F+ +     G  I  L+ V  P+ +WGP   ++R
Sbjct:  191 RGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRT-----HKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMHLAPGRFIERLKLVCSPQPDWGPFLAQHR 766          
BLAST of slc6a-6 vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 453.366 bits (1165), Expect = 2.242e-148
Identity = 265/657 (40.33%), Postives = 386/657 (58.75%), Query Frame = 1
Query:  178 ALKSLALVDNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWS--------------LAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREV---IKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPI----GDSFFQSKR 2085
            A  SLA+  N + P E                  +K+     R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFFMEL+FGQFAS G + VW ISP+FKG+GYGM++ S  +  YYNV+I  + YY F+S   VLPW +C+       C    +D  N +              L + +  + SPSE+Y+   VL +S  I + G  +  L  CL ++W+VV   L++G+ S GKV YFTA FPYV+L IL +RG  L GA  GI++Y+ P++D+I ++KVW DAA+QIF+SL C  G LITM+SYN F NNC RD+V ++I NCATS++AGFVIF+ LGFMA+     +  V D GPGLAFV YPEALT + ++PLWS+ FF M+I LG G+QF ++ET++  I DE+    +L+ + +V +    + +  FLLGIP+T + G+Y L ++D   + + L+V++ +  + I Y YG   + +DI +M    P  +++I W ++SP +I  +++F  +    + Y  + YP   V +   +AL  ++ +P   ++R C+  G  +L+ +    KP  +WGPA  E+R    +  +    +        E +   PD    PI    G S  Q  R
Sbjct:   75 AQHSLAMAQNGAVPSEA-----------------TKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDC-AGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTL---GVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTIAPSPEDGF-----EVQPLHPDKAQIPIVGSNGSSRLQDSR 705          
BLAST of slc6a-6 vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 450.284 bits (1157), Expect = 3.369e-148
Identity = 258/623 (41.41%), Postives = 377/623 (60.51%), Query Frame = 1
Query:  280 SKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWS--------------LAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREV---IKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPI----GDSFFQSKR 2085
            +K+     R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFFMEL+FGQFAS G + VW ISP+FKG+GYGM++ S  +  YYNV+I  + YY F+S   VLPW +C+       C    +D  N +              L + +  + SPSE+Y+   VL +S  I + G  +  L  CL ++W+VV   L++G+ S GKV YFTA FPYV+L IL +RG  L GA  GI++Y+ P++D+I ++KVW DAA+QIF+SL C  G LITM+SYN F NNC RD+V ++I NCATS++AGFVIF+ LGFMA+     +  V D GPGLAFV YPEALT + ++PLWS+ FF M+I LG G+QF ++ET++  I DE+    +L+ + +V +    + +  FLLGIP+T + G+Y L ++D   + + L+V++ +  + I Y YG   + +DI +M    P  +++I W ++SP +I  +++F  +    + Y  + YP   V +   +AL  ++ +P   ++R C+  G  +L+ +    KP  +WGPA  E+R    +  +    +        E +   PD    PI    G S  Q  R
Sbjct:   19 TKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDC-AGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTL---GVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTIAPSPEDGF-----EVQPLHPDKAQIPIVGSNGSSRLQDSR 632          
BLAST of slc6a-6 vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 450.284 bits (1157), Expect = 3.369e-148
Identity = 258/623 (41.41%), Postives = 377/623 (60.51%), Query Frame = 1
Query:  280 SKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWS--------------LAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREV---IKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPI----GDSFFQSKR 2085
            +K+     R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFFMEL+FGQFAS G + VW ISP+FKG+GYGM++ S  +  YYNV+I  + YY F+S   VLPW +C+       C    +D  N +              L + +  + SPSE+Y+   VL +S  I + G  +  L  CL ++W+VV   L++G+ S GKV YFTA FPYV+L IL +RG  L GA  GI++Y+ P++D+I ++KVW DAA+QIF+SL C  G LITM+SYN F NNC RD+V ++I NCATS++AGFVIF+ LGFMA+     +  V D GPGLAFV YPEALT + ++PLWS+ FF M+I LG G+QF ++ET++  I DE+    +L+ + +V +    + +  FLLGIP+T + G+Y L ++D   + + L+V++ +  + I Y YG   + +DI +M    P  +++I W ++SP +I  +++F  +    + Y  + YP   V +   +AL  ++ +P   ++R C+  G  +L+ +    KP  +WGPA  E+R    +  +    +        E +   PD    PI    G S  Q  R
Sbjct:   19 TKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDC-AGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTL---GVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTIAPSPEDGF-----EVQPLHPDKAQIPIVGSNGSSRLQDSR 632          
BLAST of slc6a-6 vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 450.284 bits (1157), Expect = 6.437e-148
Identity = 258/623 (41.41%), Postives = 377/623 (60.51%), Query Frame = 1
Query:  280 SKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWS--------------LAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREV---IKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPI----GDSFFQSKR 2085
            +K+     R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFFMEL+FGQFAS G + VW ISP+FKG+GYGM++ S  +  YYNV+I  + YY F+S   VLPW +C+       C    +D  N +              L + +  + SPSE+Y+   VL +S  I + G  +  L  CL ++W+VV   L++G+ S GKV YFTA FPYV+L IL +RG  L GA  GI++Y+ P++D+I ++KVW DAA+QIF+SL C  G LITM+SYN F NNC RD+V ++I NCATS++AGFVIF+ LGFMA+     +  V D GPGLAFV YPEALT + ++PLWS+ FF M+I LG G+QF ++ET++  I DE+    +L+ + +V +    + +  FLLGIP+T + G+Y L ++D   + + L+V++ +  + I Y YG   + +DI +M    P  +++I W ++SP +I  +++F  +    + Y  + YP   V +   +AL  ++ +P   ++R C+  G  +L+ +    KP  +WGPA  E+R    +  +    +        E +   PD    PI    G S  Q  R
Sbjct:   38 TKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDC-AGVLDASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTL---GVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTIAPSPEDGF-----EVQPLHPDKAQIPIVGSNGSSRLQDSR 651          
BLAST of slc6a-6 vs. Ensembl Celegans
Match: dat-1 (Sodium-dependent dopamine transporter [Source:UniProtKB/Swiss-Prot;Acc:Q03614])

HSP 1 Score: 386.341 bits (991), Expect = 3.861e-124
Identity = 222/552 (40.22%), Postives = 323/552 (58.51%), Query Frame = 1
Query:  280 SKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWS-ISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHP-----NSTKVSPSEQYFEKNVLNISG----------SILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGG 1887
            + +   P R+ W GK++FL S V  AV LGN+WRFPYLC+KNGGG FL+PY  M+ L G+PLF+MEL  GQ+   G IT W  I PLFKGIGY +++ +F +  +YNVI+A  L+YL+ SF+  LPW  C+ +  + +C++        ++        ++ K+S +E+YF K  L +            S+ DLG  +W + L L + +++    + KGI++ GKV +FTA+FPYV+L IL IRG  LPG   GI +Y++P F+ ++   VW DAATQ+FFSL    G L+  SSYN+F NN   DA+F + +NCATS  +GFVIF+ LG+M+      I+ V  +GPGL FVVYPEAL+ M  AP WS+ FFLM++TLG  S F   E ++ G+ DE   L+  +  F   +F   + I     GI M   GG+ I+  L    + + LL+    E +VI Y YG+ +F  D+  M   RP  YW+  W   +P ++  +I   F++   L Y D++YP +   +    AL    F+P V IY++    G
Sbjct:   32 NTEPKDPAREQWSGKLDFLLSVVGFAVDLGNIWRFPYLCFKNGGGVFLIPYSIMVLLTGVPLFYMELCLGQYYRKGAITTWGRICPLFKGIGYCVILTAFYVDFFYNVILAWGLHYLYTSFSFNLPWASCNNSYNSPACYEPHWSEDGTAMCRSANQSVSAEKISAAEEYFYKGFLGLHEANAPNSHVIRSVTDLGNVRWDIALSLFVVYLICYFSMWKGIHTSGKVVWFTALFPYVVLGILFIRGVTLPGWQNGIEYYLRPNFEMLKRPSVWQDAATQVFFSLGPGFGVLMAYSSYNDFHNNVYVDALFTSFINCATSFLSGFVIFSVLGYMSCKSGKPIEAVAQEGPGLVFVVYPEALSTMPYAPFWSVLFFLMLMTLGLDSSFGGSEAIITGLSDEFPILKKNREVFVGCLFAFYMVI-----GIAMCTEGGILIMEWLIIYGTTWGLLIAVFCEAMVIAYIYGLRQFVHDVKEMMGFRPGNYWKFCWSCAAPFILLSMITSNFINYQALTYQDYTYPTAANVIGIIFALSGASFIPLVGIYKFVNARG 578          
BLAST of slc6a-6 vs. Ensembl Celegans
Match: mod-5 (Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7])

HSP 1 Score: 367.851 bits (943), Expect = 2.454e-116
Identity = 226/596 (37.92%), Postives = 335/596 (56.21%), Query Frame = 1
Query:  127 VENEMNSSPIDCKIVNEALKSLALVDNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVW-SISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTV----LPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSI--LDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVV-DKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIF--YFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEG 1884
            V+    S  +   + ++ L       ++  P E    +   +  +E  +   ++ +   R  W  K+EFL + V  AV LGN+WRFP +CYK+GGGAFL+PYF ML + GLP+F+MEL  GQF   G +++W  + PLF+GIGYG+      ++ +YN IIAQ++Y+   S + +    +PW  C        C D      N +++   +   +PSE+Y+   VL +  S    DLG  +  + +CLL  +I+V   L KG  S GK+ + TA  PY+IL ILLIRG LLPGA  G+ +Y+ P F++++D  VW+ AATQIFFSL    G L+ +SSYN+F NNC RDAV  +I+NCATS F+G V+F+ LG+M+ L N  I+ VV +    L F+VYP+AL  M  +  WS  FF+M+ITLG  S FA +E  + G  DE R L   +  F ++     ICI+ + L  P    GG +++  LD       +L +   E+I +C+FYG+++F KDI  M    P  YWR+ W   SP  IS++ I   Y  S   ++   +++P   V L  F+ L  ++ +P VF   Y   G
Sbjct:   41 VKAPTASEYMPLSVADKPLTLTVSTSHSIDPNEPIAALGGLTPTKEGRVAALRRRSSMVRDKWATKMEFLLAVVGYAVDLGNIWRFPSVCYKHGGGAFLIPYFIMLMIGGLPMFYMELVLGQFHRSGCVSIWRKVCPLFRGIGYGICCICTFIAIFYNAIIAQAVYFAIVSLSKIWDSEVPWASCGNPWNTPRCSDDL----NVTISRNGTPLTTPSEEYYLYKVLEVQKSTGFDDLGGVKTSMAVCLLAVFIMVYFALWKGPQSSGKIVWVTATAPYIILSILLIRGLLLPGAKNGLYYYVTPDFEKLKDPAVWSAAATQIFFSLGPGFGVLLALSSYNDFNNNCYRDAVTTSIINCATSFFSGCVVFSTLGYMSLLTNKPINEVVGEHDASLIFIVYPQALATMDYSCFWSFIFFVMLITLGIDSTFAGIEAFITGFCDESRFLSKNRKWFVLV-----ICIIYYFLSFPAISYGGQFVIPFLDEYGVSLSVLFIVTCEMIAVCWFYGVDQFSKDIRAMLGFYPGIYWRVCWT-CSPVFISVIFIMTVYNSSFKPIQMASYTFPWWSVILGWFLRLLSVLAIP-VFAIIYLLSG 625          
BLAST of slc6a-6 vs. Ensembl Celegans
Match: snf-3 (Sodium- and chloride-dependent betaine transporter [Source:UniProtKB/Swiss-Prot;Acc:G5EBN9])

HSP 1 Score: 334.339 bits (856), Expect = 2.166e-104
Identity = 206/571 (36.08%), Postives = 312/571 (54.64%), Query Frame = 1
Query:  223 ELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWS-----LAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLD-YVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFS-YPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIK 1914
            E  P    ++  +E+    S+ S  PDR  W GK +FL S VA AVGLGNVWRFPYLCYKNGGG+FLV Y     L  +P+F ME+  GQ+   G + +W + PLF+G+G G V+ +F+   Y+ VI+A +++Y+ +S   V PW  C+    +++C     +    +     +A       +  EQ++EK VL+ +G I + G  QW+L   +  AW++V   L KGI    K  YF A+FPYV++ ILLIRG  L GA  GI FY+KP   R+ D+ VW DA TQ+F+S     G LI + S+N F +NC +DA+ +  +N  TSI AGF +F+ LG+M+H+    I  +V  G GLAF+ YPE  +++ M  ++++ FFLM+  LG  SQ  ++E +   ++D    LR  K Q  + IF    C+  F +GIPM    G + L + D Y  SGY LL +   E++ + Y +G +  RK +  M           +W + +P    +L +F  V    +KY D   +P        F++   ++ +P   IY        + L+E ++
Sbjct:    5 EHVPLPTDEAKAKELE--QSQHSEEPDRGQWTGKFDFLMSMVAYAVGLGNVWRFPYLCYKNGGGSFLVVYMIFFCLAAVPIFLMEVTVGQYLQKGAMEMWLMCPLFRGVGIGNVVIAFMCIAYFCVIVAWAMFYMISSIAWVFPWETCNNYWNDATCVTGKENFTELARIKALVASAGGHTQTSVEQFWEKRVLHDTGDISEFGGIQWELFFIMAAAWLIVYFALWKGITQARKFVYFCALFPYVLIFILLIRGLTLEGAGTGIYFYLKPNATRLLDTAVWKDAGTQVFYSYGVGFGALIALGSHNKFNHNCFKDAITMCFINGCTSITAGFAVFSILGYMSHVAQKDISEIVKPGVGLAFLAYPEVASNLPMKQVFAVLFFLMITILGLDSQVCMMEGLFTALEDAFPILRKYKKQ-SLGIF----CLFFFCIGIPMVTHSGSHWLTLFDAYGASGYALLFVVFFEVVGLAYGFGAHNIRKALHEMIGVTLPKGIEYVWKFCAPATSLVLFVFCVVYYHPVKYPDGKDFPFWANAFGWFLSSCSMVVIPGYAIYYLFFTNKHLTLKERVR 568          
BLAST of slc6a-6 vs. Ensembl Celegans
Match: snf-11 (Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43])

HSP 1 Score: 322.013 bits (824), Expect = 1.360e-99
Identity = 203/583 (34.82%), Postives = 315/583 (54.03%), Query Frame = 1
Query:  283 KQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFN-TVLPWMFCDTTIKNSSCFDSTMDI----------------------------------YNWSL-AHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLD-YVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYG--DFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIK 1914
            + ++  +R+ W    +F+ SC+  A+GLGNVWRFPYLCY+NGGGAFL+PY   L   G PLF +E ++GQ  S+G + ++ I P+FKG+G    + +F L+ YY V+++ +  YL+ SF  + +PW  CD      +C    + I                                   NW++ +  + + VSP ++++   VL IS  + + G  +W L L LLL WI+    + KG+   GKV Y TA FPY++L  LLIRG  L GA  G+ FY+KP F ++ +SKVW DA TQ+FFS     G L+ + SYN F NN  + A+ V  +N  TS+FAGFVIF+ +GFMA  +  ++  V   GPGL F+ YP  +  +     WS  FFLM++ LG  SQF  +E     I DE  ++R  + ++   IF   IC++ +L+G+     GG Y+  + D Y  SG+ LL L   E I I +  GI+R+ + +  M    P+ +W+  W++ +P V   +++F  +    L+    ++ YP        F++L  ++ +P   I+ + K  G   ++E IK
Sbjct:    3 EATSVAEREQWSSWADFIMSCIGYAIGLGNVWRFPYLCYQNGGGAFLIPYCISLVFCGAPLFILETSWGQLMSVGGLGMFKICPIFKGVGIAAAVMAFWLNIYYIVVLSWAATYLYNSFTMSDVPWKNCDHAWNTPNCRSEYVKIPCDSNRTIAEFFNVKVLTHDHIHEYKKQFFVGEKMNWTVCSAADLSVVSPVKEFWNHRVLGISSGLENPGGIRWDLALFLLLVWIICYLCIFKGVKWTGKVVYITASFPYMMLFCLLIRGLTLEGAGVGLEFYLKPDFSKLLESKVWVDAVTQVFFSYGLGLGALVALGSYNKFNNNVYKQALTVCFVNSGTSVFAGFVIFSFIGFMATQQEKSVAEVAQAGPGLLFLAYPSGILQLPYTQFWSCLFFLMVLFLGVDSQFCTMEGFFTAIIDEFPQIR--RKKYGREIFVGVICVISYLIGLTTVTEGGFYVFQLFDFYAASGWALLWLLFFECIAISWSLGIDRWYEHMKSMIGYYPSAWWKFCWVFATPSVCFGVLLFGLIKYQPLRIDAYNYDYPVWGHIFGWFLSLSSMLCIPGYAIWIWFKTPG--TVQEKIK 581          
BLAST of slc6a-6 vs. Ensembl Celegans
Match: snf-6 (Sodium-dependent acetylcholine transporter [Source:UniProtKB/Swiss-Prot;Acc:O76689])

HSP 1 Score: 286.189 bits (731), Expect = 3.632e-85
Identity = 201/631 (31.85%), Postives = 335/631 (53.09%), Query Frame = 1
Query:  175 EALKSLALVDNNSRPKELFPEIVKDSSGE------EIHITYS-KQSTGPD-----RQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDST------MD---IYNWS--LAHPNSTKVS----------PSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNV-VDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWY--WRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILR--EVIKPKSEWGPADEENR 1953
            E      +   N+    L+P  +K    +      E  I Y  ++ TG       R  W  K ++L + +    G+G+ W+FP+L +++GG AFLVPY  ML L  LP+FFME+  GQF+S   I+VW + PLFKGIG+  V  S   + ++N+I A +L+YL  SF+  +PW  C  +    +C   T      M+   + N S  + H +S + +          PS +YF+ +VL +S  + D G   W L LC+L  WI V   L +G+ S GKV Y   I P++IL +LL R   L G++  + +++ P+++ + D  VW +AA Q F+S+SCC+G L T++SY+ F NN  +D   V I++   S+    + F+ +GF  +    ++D   +  G  L FV   EAL  + +APL++  FF+M++ +   +Q  +VET+++ I DE    RL +++ HV+    ++C L  LL IP     G++ + +L   +  + L+V+A LE + I + YG++    +   +    P  Y  W+I++ +I P V   ++ F ++  ++++Y  + +P   +     IA FPLI +P V I+++C   G I  +   V+ P   WGPA   +R
Sbjct:    9 EQRNGRGMASGNNVDMSLYPPFIKQLDAKLPDYTREGDIEYPFEEITGVGDENRIRGNWSNKSDYLLAVIGFTAGVGSFWKFPFLVFQHGGAAFLVPYLCMLCLASLPMFFMEMVLGQFSSSAAISVWKVVPLFKGIGFAQVTISGFFAVFFNIISAWTLFYLINSFSFSIPWSNCANSWSGENCTLGTRIQCKEMNGTLLVNGSCIVEHASSNETTVIPLHDLGSIPSLKYFQNDVLMLSKGVDDFGTLNWYLGLCVLACWIAVFLCLFQGVKSSGKVVYVAVIVPFIILTVLLTRLLTLDGSLAAVFYFLTPKWEILMDLHVWGEAAVQAFYSVSCCSGGLFTIASYSRFHNNIYKDIWLVLIVDVIVSLVGCLLTFSAIGFTCYEFAISLDKFHIRDGFHLVFVFLAEALAGVSVAPLYAGLFFIMILLVVHATQMFVVETIVSSICDEYPE-RLRRNRRHVL---TTVCALFILLSIPFCLSSGLFWMELLTQFVLTWPLVVIAFLECMAINWVYGVDNMLDNAKWIVGYWPPCYIFWKILFKFICPMVYLAILCFLWLDWNSIQYESYQFPYWSILTAWCIASFPLILIPIVGIWQFCIAKGTITQKWWRVLYPDDAWGPAMAIHR 635          
BLAST of slc6a-6 vs. Ensembl Fly
Match: GlyT (gene:FBgn0034911 transcript:FBtr0301162)

HSP 1 Score: 434.106 bits (1115), Expect = 3.930e-136
Identity = 249/579 (43.01%), Postives = 354/579 (61.14%), Query Frame = 1
Query:  301 DRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWS-ISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCF--------DSTMDIYNWSLAHPNST---------------KVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRP---NWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIK----PKSEWGPADE 1944
            +R TW G+ +FL S +  +VGLGNVWRFPYLCY NGGGAFL+P+  ML + GLPL FMEL+FGQ+A+LGP+ V+    PLF+G+G GM++ S I+  YYN+IIA +++Y+FASF  VLPW  C+       CF        ++T   Y     H N+T               K  P+E+YF   VL +S  I + G+ +  L  CL LAW +V   L KG+ S GKV YFTA+FPYV+L IL +RG  LPGA  GI+FY+ P + ++ +++VW DAA QIFF+LS   G LIT+SSYN F NNC +D++ VA  N ATS FAG VIF+ +GF+AH  N  ++ VVD+G GLAF+VYPE +T + ++P+W++ FF+M++TLG  SQFA++ETV   I D    LR    Q+ + +  +S+ I  ++ G+  T   GMY L ++D   + + +L++A+ E I+I + YG  RF  DI  M  KR    N++W IMW YI+P  +  ++ F +V     KYG + YP     +   + L P++ +  V      +    +  R+ IK    P +EWGPA  
Sbjct:   56 ERGTWTGRFDFLLSLLGYSVGLGNVWRFPYLCYNNGGGAFLIPFTIMLVIAGLPLMFMELSFGQYAALGPVAVYRRFCPLFRGLGTGMILVSAIVMLYYNLIIAWTIFYMFASFAPVLPWQNCEPAWSTKYCFSYAQADQCEATNGTYYLRTCH-NATSAAENNITTLALGALKRPPAEEYFNNFVLGLSKGIEETGSIKLSLAACLFLAWTIVFLCLCKGVQSSGKVVYFTALFPYVVLVILFVRGVTLPGASTGILFYLTPDWKQLANAQVWGDAAVQIFFALSPAWGGLITLSSYNKFSNNCYKDSLIVAFCNIATSFFAGLVIFSIIGFLAHELNVDVEKVVDQGAGLAFIVYPEVVTRLPVSPVWAVLFFVMLLTLGLDSQFALMETVTTAILDRFPNLR----QYKIWVV-LSVAIFGYIGGLGFTTNSGMYWLQLMDKYAANWSVLLIAISECILIAWIYGSQRFLNDIQGMIGKRSWFWNFFWGIMWRYITPATLLFILFFNWVEYKPAKYGHYVYPMWADAVGWIVGLLPVLVIFLVAFQEIWRAPMSLSFRDRIKHLLQPTAEWGPAGR 628          
BLAST of slc6a-6 vs. Ensembl Fly
Match: SerT (gene:FBgn0010414 transcript:FBtr0072362)

HSP 1 Score: 397.897 bits (1021), Expect = 2.373e-128
Identity = 231/583 (39.62%), Postives = 338/583 (57.98%), Query Frame = 1
Query:  202 DNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWS-ISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVL-NISGSILDLGAP-QXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRY---CKEGGWIILREVIKPKSEWG 1932
            D+ +  K   P   K ++ E I +    + T   R+TWG K EFL + +  AV LGNVWRFPY+CY+NGGGAFLVPY   L   GLPLF+MELA GQF   G +++W  I P  KG+GY + +    +  YYN II  ++YYLFASF + LPW  CD      +C   T + +            SP++++FE+ VL +  G+ LD   P +  L LC+   +++V   L KG+ S GKV + TA+ PYV+L ILL+RG  LPGA +GI +Y+ P + ++++SKVW DAA+QIFFSL    G L+ +SSYN F NNC RDA+  + +NC TS  AGFVIF+ LG+MA+++ T+ID V  +GPGL F+VYPEA+  M  +  WSI FFLM+ITLG  S F  +E ++  + DE  R+   + +  V++    I    FL  +P    GG+ ++N L+    G  +L +  +E   + +FYG++RF  D+  M   +P  +WRI W YISP  +  + IF  +    +   ++ YP     +   +    ++ +P   IY++    K G    L+E  +P+   G
Sbjct:   43 DHTTPAKVTDPLAPKLANNERILVVSVTERT---RETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQNGGGAFLVPYCLFLIFGGLPLFYMELALGQFHRCGCLSIWKRICPALKGVGYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLPWTSCDNPWNTENCMQVTSENFT-------ELATSPAKEFFERKVLESYKGNGLDFMGPVKPTLALCVFGVFVLVYFSLWKGVRSAGKVVWVTALAPYVVLIILLVRGVSLPGADEGIKYYLTPEWHKLKNSKVWIDAASQIFFSLGPGFGTLLALSSYNKFNNNCYRDALITSSINCLTSFLAGFVIFSVLGYMAYVQKTSIDKVGLEGPGLVFIVYPEAIATMSGSVFWSIIFFLMLITLGLDSTFGGLEAMITALCDEYPRVIGRRRELFVLLLLAFI----FLCALPTMTYGGVVLVNFLNVYGPGLAILFVVFVEAAGVFWFYGVDRFSSDVEQMLGSKPGLFWRICWTYISPVFLLTIFIFSIMGYKEMLGEEYYYPDWSYQVGWAVTCSSVLCIPMYIIYKFFFASKGGCRQRLQESFQPEDNCG 611          
BLAST of slc6a-6 vs. Ensembl Fly
Match: SerT (gene:FBgn0010414 transcript:FBtr0343316)

HSP 1 Score: 397.897 bits (1021), Expect = 2.373e-128
Identity = 231/583 (39.62%), Postives = 338/583 (57.98%), Query Frame = 1
Query:  202 DNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWS-ISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVL-NISGSILDLGAP-QXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRY---CKEGGWIILREVIKPKSEWG 1932
            D+ +  K   P   K ++ E I +    + T   R+TWG K EFL + +  AV LGNVWRFPY+CY+NGGGAFLVPY   L   GLPLF+MELA GQF   G +++W  I P  KG+GY + +    +  YYN II  ++YYLFASF + LPW  CD      +C   T + +            SP++++FE+ VL +  G+ LD   P +  L LC+   +++V   L KG+ S GKV + TA+ PYV+L ILL+RG  LPGA +GI +Y+ P + ++++SKVW DAA+QIFFSL    G L+ +SSYN F NNC RDA+  + +NC TS  AGFVIF+ LG+MA+++ T+ID V  +GPGL F+VYPEA+  M  +  WSI FFLM+ITLG  S F  +E ++  + DE  R+   + +  V++    I    FL  +P    GG+ ++N L+    G  +L +  +E   + +FYG++RF  D+  M   +P  +WRI W YISP  +  + IF  +    +   ++ YP     +   +    ++ +P   IY++    K G    L+E  +P+   G
Sbjct:   43 DHTTPAKVTDPLAPKLANNERILVVSVTERT---RETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQNGGGAFLVPYCLFLIFGGLPLFYMELALGQFHRCGCLSIWKRICPALKGVGYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLPWTSCDNPWNTENCMQVTSENFT-------ELATSPAKEFFERKVLESYKGNGLDFMGPVKPTLALCVFGVFVLVYFSLWKGVRSAGKVVWVTALAPYVVLIILLVRGVSLPGADEGIKYYLTPEWHKLKNSKVWIDAASQIFFSLGPGFGTLLALSSYNKFNNNCYRDALITSSINCLTSFLAGFVIFSVLGYMAYVQKTSIDKVGLEGPGLVFIVYPEAIATMSGSVFWSIIFFLMLITLGLDSTFGGLEAMITALCDEYPRVIGRRRELFVLLLLAFI----FLCALPTMTYGGVVLVNFLNVYGPGLAILFVVFVEAAGVFWFYGVDRFSSDVEQMLGSKPGLFWRICWTYISPVFLLTIFIFSIMGYKEMLGEEYYYPDWSYQVGWAVTCSSVLCIPMYIIYKFFFASKGGCRQRLQESFQPEDNCG 611          
BLAST of slc6a-6 vs. Ensembl Fly
Match: Gat (gene:FBgn0039915 transcript:FBtr0089972)

HSP 1 Score: 392.504 bits (1007), Expect = 3.524e-126
Identity = 224/548 (40.88%), Postives = 329/548 (60.04%), Query Frame = 1
Query:  298 PDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDT-----------TIKNSSCFD-----STMDIYNWSLAHPNSTKVS-PSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLD-YVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGG 1887
            PDR +W  K++F+ S V +A+GLGNVWRFPYLCYKNGGGAF++PY   LFL G+P+FFMELA GQ  ++G + V+ I+P+FKGIGY   + S  ++ YY VI+A +++Y F S    +PW  C+              KN  C+D     +T  + + S  +  S +++ P ++++E+  L IS  I ++G  +W+L   LLL WI+    + KG+   GKV YFTA+FPYV+L ILL+RG  LPGA++GI FYI P F ++ +S+VW DA TQIFFS     G L+ + SYN F NN  +DA+ V  +N +TS+FAGFVIF+ +GFMAH +   + +V   GPGLAF+VYP A+  +  +P+WS  FF M++ +G  SQF  +E  +  I DE  +L   + +    IF   +C L +L+G+    +GGMYI  +LD Y +SG+ LL L   E + I + YG++RF   I  M    P  +W+  W   +P +   +  F  V    +KY D+SYP        F AL  ++++P    + + +  G
Sbjct:   56 PDRGSWSSKMDFILSVVGLAIGLGNVWRFPYLCYKNGGGAFILPYIITLFLAGIPMFFMELALGQMLTIGGLGVFKIAPIFKGIGYAAAVMSCWMNVYYIVILAWAVFYFFMSMRADVPWRTCNNWWNTVNCVSQYERKNLHCWDKIINGTTQKVCSVSALNITSLELTDPVKEFWERRALQISHGIEEIGNIRWELAGTLLLVWILCYFCIWKGVKWTGKVVYFTALFPYVLLTILLVRGITLPGALEGIKFYIIPNFSKLTNSEVWIDAVTQIFFSYGLGLGTLVALGSYNKFTNNVYKDALIVCTVNSSTSMFAGFVIFSVIGFMAHEQQRPVADVAASGPGLAFLVYPSAVLQLPGSPMWSCLFFFMLLLIGLDSQFCTMEGFITAIIDEWPQLLRKRKE----IFIAIVCALSYLVGLTCITQGGMYIFQILDSYAVSGFCLLWLIFFECVSISWCYGVDRFYDGIKDMIGYYPTVWWKFCWCVTTPAICLGVFFFNIVQWTPVKYLDYSYPWWAHAFGWFTALSSMLYIPLYMFWLWKRTPG 599          
BLAST of slc6a-6 vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0330002)

HSP 1 Score: 386.341 bits (991), Expect = 1.086e-123
Identity = 243/633 (38.39%), Postives = 351/633 (55.45%), Query Frame = 1
Query:  268 HITYSKQSTGPD---------RQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWS-ISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSC--FDST-----------MDIY---NWSLAHPNSTKV-----------------SPSEQYFEKNV--LNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMP 2031
            HI+ SK  T  D         R+TW GK++FL S +  AV L NVWRFPYLCYKNGGGAFLVPY  ML + G+PLF+MELA GQ    G IT W  + PLFKGIGY +V+ +F +  YYNVIIA SL + FASF   LPW  C+      +C  F+S             D+Y   N SL + N T +                 S + +YF + +  LN S  I DLGA +W + LCLL+ +++    L KGI++ GKV +FTA+FPY +L ILLIRG  LPG+  GI +Y+ P F  I  ++VW DAATQ+FFSL    G L+  +SYN + NN  +DA+  + +N ATS  AGFVIF+ LG+MAH     I++V  +GPGL FVVYP A+  M  +  W++ FF+M++TLG  S F   E ++  + DE  +++  +  F   +F      L F++G+    +GG Y  ++LD   +GY +LV    E I + + YG NRF +DI  M    P  YW++ W +++P  +  + ++  +  + L Y D+ YP     L   IA   ++ +P+V I++     G +  R  I       P  ++     + + +  +     ++ ++ AK P
Sbjct:    6 HISKSKTPTPHDNDNNSISDERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFESQNASRVPVIGNYSDLYAMGNQSLLY-NETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHDLGAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVRIEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFPKIKRNRELFVAGLFS-----LYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTNRFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYGLIGYEPLTYADYVYPSWANALGWCIAGSSVVMIPAVAIFKLLSTPGSLRQRFTILTT----PWRDQQSMAMVLNGVTTEVTVVRLTDTETAKEP 628          
BLAST of slc6a-6 vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 459.914 bits (1182), Expect = 3.596e-150
Identity = 259/583 (44.43%), Postives = 366/583 (62.78%), Query Frame = 1
Query:  304 RQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCD--------------------------TTIKNSSCFDSTMDIYNWS----LAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRR-LRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWII--LREVIKPKSEWGPADEENR 1953
            R  W  K++F+ S V  AVGLGNVWRFPYL ++NGGGAFL+PY  ML L G+P+F +E++ GQFAS GP++VW   P  +G G  M+I S +++ YYN+I+  +LYYLFAS    LPW  C                           T+IKN++   S   + N S    +   N T VSPSE+YF+ NVL+IS  I   G  +W L  CL LAW++V A L KGI S GKV YFTA FPYV+L ILLIRG  LPGA  GI+++I P+++++ D+KVW DAATQIFFSLS   G LIT+SSYN F NNC RD + V   N ATSIFAGFVIF+ +GFMAH     I++V D+GPG+AFVVYPEALT + ++P W+I FFLM++TLG  + FA +ET++  + DE  + LR  K QF ++      C+  F+LG PM    GMY+L ++D   + Y L+++A+ E++ I Y YG+ RF +DI +M   +PN +WR+ W +++P +++ ++         + Y D++YP   + L   + +  +I++P +F  +     G +I  L+ V  P+ +WGP   ++R
Sbjct:  177 RGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKNTTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEYFKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKHKPQFTLV-----CCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLMVICSVIWIPIMFAIKMHLAPGSLIERLKLVCSPQPDWGPFLMKHR 754          
BLAST of slc6a-6 vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 459.529 bits (1181), Expect = 4.783e-150
Identity = 259/583 (44.43%), Postives = 366/583 (62.78%), Query Frame = 1
Query:  304 RQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCD--------------------------TTIKNSSCFDSTMDIYNWS----LAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRR-LRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWII--LREVIKPKSEWGPADEENR 1953
            R  W  K++F+ S V  AVGLGNVWRFPYL ++NGGGAFL+PY  ML L G+P+F +E++ GQFAS GP++VW   P  +G G  M+I S +++ YYN+I+  +LYYLFAS    LPW  C                           T+IKN++   S   + N S    +   N T VSPSE+YF+ NVL+IS  I   G  +W L  CL LAW++V A L KGI S GKV YFTA FPYV+L ILLIRG  LPGA  GI+++I P+++++ D+KVW DAATQIFFSLS   G LIT+SSYN F NNC RD + V   N ATSIFAGFVIF+ +GFMAH     I++V D+GPG+AFVVYPEALT + ++P W+I FFLM++TLG  + FA +ET++  + DE  + LR  K QF ++      C+  F+LG PM    GMY+L ++D   + Y L+++A+ E++ I Y YG+ RF +DI +M   +PN +WR+ W +++P +++ ++         + Y D++YP   + L   + +  +I++P +F  +     G +I  L+ V  P+ +WGP   ++R
Sbjct:  169 RGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKNTTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEYFKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKHKPQFTLV-----CCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLMVICSVIWIPIMFAIKMHLAPGSLIERLKLVCSPQPDWGPFLMKHR 746          
BLAST of slc6a-6 vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 459.529 bits (1181), Expect = 5.339e-150
Identity = 259/583 (44.43%), Postives = 366/583 (62.78%), Query Frame = 1
Query:  304 RQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCD--------------------------TTIKNSSCFDSTMDIYNWS----LAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRR-LRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWII--LREVIKPKSEWGPADEENR 1953
            R  W  K++F+ S V  AVGLGNVWRFPYL ++NGGGAFL+PY  ML L G+P+F +E++ GQFAS GP++VW   P  +G G  M+I S +++ YYN+I+  +LYYLFAS    LPW  C                           T+IKN++   S   + N S    +   N T VSPSE+YF+ NVL+IS  I   G  +W L  CL LAW++V A L KGI S GKV YFTA FPYV+L ILLIRG  LPGA  GI+++I P+++++ D+KVW DAATQIFFSLS   G LIT+SSYN F NNC RD + V   N ATSIFAGFVIF+ +GFMAH     I++V D+GPG+AFVVYPEALT + ++P W+I FFLM++TLG  + FA +ET++  + DE  + LR  K QF ++      C+  F+LG PM    GMY+L ++D   + Y L+++A+ E++ I Y YG+ RF +DI +M   +PN +WR+ W +++P +++ ++         + Y D++YP   + L   + +  +I++P +F  +     G +I  L+ V  P+ +WGP   ++R
Sbjct:  177 RGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKNTTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEYFKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKHKPQFTLV-----CCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGLQRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLMVICSVIWIPIMFAIKMHLAPGSLIERLKLVCSPQPDWGPFLMKHR 754          
BLAST of slc6a-6 vs. Ensembl Zebrafish
Match: slc6a9 (solute carrier family 6 member 9 [Source:ZFIN;Acc:ZDB-GENE-050105-3])

HSP 1 Score: 450.284 bits (1157), Expect = 3.875e-148
Identity = 248/574 (43.21%), Postives = 366/574 (63.76%), Query Frame = 1
Query:  283 KQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCD------------TTIKNSSCFDSTMDIYNWSLAHPNSTK-VSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREV---IKPKSEWGPADEENRQ 1956
            K+     R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFF+EL+FGQF SLG + VW +SP+FKG+GYGM++ S  +  YYNV+I  + YY F S   +LPW +C+            +T + ++ F +   + +      N TK  SPSE+Y+   VLNIS  I + G  +  +  CL ++W VV   L++G+ S GKV YFTA FPYV+L IL IRG  L GA+ GI +Y+ P++ +I D+KVW DAA+QIF+SL C  G LITM+SYN F NNC RD++ +++ NC TS++AGFVIF+ LGFMAH     +  V D GPGLAFV YPEALT + ++PLWS+ FF M+I LG G+QF ++ET++  + DE+    ++K++ +V +    + I+ FLLG+P+T + G+Y L ++D   + + L++++ +  I I Y YG   + KD+ +M    P  ++RI W Y+SP +I+ ++IF  +    + Y D+ YP   + +   +AL  +I +P   +++     G   L  +   +KP  +WGPA +E+R+
Sbjct:   24 KRDENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVSTHRANATFANMSAVVSGVTEIVNRTKRTSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAVSWFVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISVTNCGTSVYAGFVIFSILGFMAHHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAVVDEIGTDWIIKNKTYVTL---GVAIIGFLLGVPLTTQAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHKNYFKDVEMMLGFPPPIFFRICWRYVSPFIITFILIFTVIQYKPITYNDYVYPGWSLVIGFAMALSSVICIPIYALFKIAMSEGSTFLERLKNSVKPDPDWGPALQEHRK 594          
BLAST of slc6a-6 vs. Ensembl Zebrafish
Match: slc6a9 (solute carrier family 6 member 9 [Source:ZFIN;Acc:ZDB-GENE-050105-3])

HSP 1 Score: 449.899 bits (1156), Expect = 4.147e-148
Identity = 248/574 (43.21%), Postives = 366/574 (63.76%), Query Frame = 1
Query:  283 KQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCD------------TTIKNSSCFDSTMDIYNWSLAHPNSTK-VSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREV---IKPKSEWGPADEENRQ 1956
            K+     R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFF+EL+FGQF SLG + VW +SP+FKG+GYGM++ S  +  YYNV+I  + YY F S   +LPW +C+            +T + ++ F +   + +      N TK  SPSE+Y+   VLNIS  I + G  +  +  CL ++W VV   L++G+ S GKV YFTA FPYV+L IL IRG  L GA+ GI +Y+ P++ +I D+KVW DAA+QIF+SL C  G LITM+SYN F NNC RD++ +++ NC TS++AGFVIF+ LGFMAH     +  V D GPGLAFV YPEALT + ++PLWS+ FF M+I LG G+QF ++ET++  + DE+    ++K++ +V +    + I+ FLLG+P+T + G+Y L ++D   + + L++++ +  I I Y YG   + KD+ +M    P  ++RI W Y+SP +I+ ++IF  +    + Y D+ YP   + +   +AL  +I +P   +++     G   L  +   +KP  +WGPA +E+R+
Sbjct:   15 KRDENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVSTHRANATFANMSAVVSGVTEIVNRTKRTSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAVSWFVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISVTNCGTSVYAGFVIFSILGFMAHHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAVVDEIGTDWIIKNKTYVTL---GVAIIGFLLGVPLTTQAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHKNYFKDVEMMLGFPPPIFFRICWRYVSPFIITFILIFTVIQYKPITYNDYVYPGWSLVIGFAMALSSVICIPIYALFKIAMSEGSTFLERLKNSVKPDPDWGPALQEHRK 585          
BLAST of slc6a-6 vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 488.034 bits (1255), Expect = 1.127e-162
Identity = 270/641 (42.12%), Postives = 395/641 (61.62%), Query Frame = 1
Query:  241 VKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFD----STMDIYNWSLAHP--------NST--KVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREV---IKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEV 2112
            +K S    +    +K+   P R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFFMEL+FGQFAS G + VW +SP+FKG+GYGM++ S  +  YYNV+I  + YY FAS N +LPW +C+      +C      ++   +N S  H         N T  + SPSE+Y+ ++VLNISG I D G  +  L  CL ++W+VV   L++G+ S GKV YFTA FPYV+L IL IRG  L GA+ GI++Y+ P++D+I  +KVW DAA+QIF+SL C  G LITM+SYN F NNC RD++ ++I NCATS++AGFVIF+ LGFMA      +  V D GPGLAFV YPEALT + ++PLWSI FF M+I LG G+QF ++ET++  I DE+    +++ +    +  + + I+ FLLGIP+T + G+Y L ++D   + + L++++ +  I + Y YG   + KDI +M    P  +++  W + SP +I  ++IF  +    +KY D+ YP   +T+   +AL  +I +P   ++R  +  G   L+ +   +KP  +WGPA  E+R    + I      SN      EA+  +P+ +   +G +   S     ++ S+V
Sbjct:    8 LKPSRNGAVPGEATKKDENPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQHSLLNLTMGLNQTLKRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWK---TLVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGHRNYFKDIEMMLGFPPPLFFQFCWRFFSPAIIFFILIFTVIQYRPIKYNDYVYPDWALTIGFLMALSSVICIPLYAVFRVWRSEGHTFLQRLKNAVKPSKDWGPALLEHRTGRYAQISSSRCDSN-----PEAQPLNPEKLKDDLGLTIHGSNGQAHTQDSKV 640          
BLAST of slc6a-6 vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 487.649 bits (1254), Expect = 1.230e-162
Identity = 268/628 (42.68%), Postives = 391/628 (62.26%), Query Frame = 1
Query:  280 SKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFD----STMDIYNWSLAHP--------NST--KVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREV---IKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEV 2112
            +K+   P R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFFMEL+FGQFAS G + VW +SP+FKG+GYGM++ S  +  YYNV+I  + YY FAS N +LPW +C+      +C      ++   +N S  H         N T  + SPSE+Y+ ++VLNISG I D G  +  L  CL ++W+VV   L++G+ S GKV YFTA FPYV+L IL IRG  L GA+ GI++Y+ P++D+I  +KVW DAA+QIF+SL C  G LITM+SYN F NNC RD++ ++I NCATS++AGFVIF+ LGFMA      +  V D GPGLAFV YPEALT + ++PLWSI FF M+I LG G+QF ++ET++  I DE+    +++ +    +  + + I+ FLLGIP+T + G+Y L ++D   + + L++++ +  I + Y YG   + KDI +M    P  +++  W + SP +I  ++IF  +    +KY D+ YP   +T+   +AL  +I +P   ++R  +  G   L+ +   +KP  +WGPA  E+R    + I      SN      EA+  +P+ +   +G +   S     ++ S+V
Sbjct:   19 TKKDENPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQHSLLNLTMGLNQTLKRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWK---TLVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGHRNYFKDIEMMLGFPPPLFFQFCWRFFSPAIIFFILIFTVIQYRPIKYNDYVYPDWALTIGFLMALSSVICIPLYAVFRVWRSEGHTFLQRLKNAVKPSKDWGPALLEHRTGRYAQISSSRCDSN-----PEAQPLNPEKLKDDLGLTIHGSNGQAHTQDSKV 638          
BLAST of slc6a-6 vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 487.649 bits (1254), Expect = 1.300e-162
Identity = 268/628 (42.68%), Postives = 391/628 (62.26%), Query Frame = 1
Query:  280 SKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFD----STMDIYNWSLAHP--------NST--KVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREV---IKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEV 2112
            +K+   P R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFFMEL+FGQFAS G + VW +SP+FKG+GYGM++ S  +  YYNV+I  + YY FAS N +LPW +C+      +C      ++   +N S  H         N T  + SPSE+Y+ ++VLNISG I D G  +  L  CL ++W+VV   L++G+ S GKV YFTA FPYV+L IL IRG  L GA+ GI++Y+ P++D+I  +KVW DAA+QIF+SL C  G LITM+SYN F NNC RD++ ++I NCATS++AGFVIF+ LGFMA      +  V D GPGLAFV YPEALT + ++PLWSI FF M+I LG G+QF ++ET++  I DE+    +++ +    +  + + I+ FLLGIP+T + G+Y L ++D   + + L++++ +  I + Y YG   + KDI +M    P  +++  W + SP +I  ++IF  +    +KY D+ YP   +T+   +AL  +I +P   ++R  +  G   L+ +   +KP  +WGPA  E+R    + I      SN      EA+  +P+ +   +G +   S     ++ S+V
Sbjct:   17 TKKDENPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQHSLLNLTMGLNQTLKRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWK---TLVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGHRNYFKDIEMMLGFPPPLFFQFCWRFFSPAIIFFILIFTVIQYRPIKYNDYVYPDWALTIGFLMALSSVICIPLYAVFRVWRSEGHTFLQRLKNAVKPSKDWGPALLEHRTGRYAQISSSRCDSN-----PEAQPLNPEKLKDDLGLTIHGSNGQAHTQDSKV 636          
BLAST of slc6a-6 vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 487.263 bits (1253), Expect = 1.362e-162
Identity = 268/628 (42.68%), Postives = 391/628 (62.26%), Query Frame = 1
Query:  280 SKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFD----STMDIYNWSLAHP--------NST--KVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREV---IKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEV 2112
            +K+   P R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFFMEL+FGQFAS G + VW +SP+FKG+GYGM++ S  +  YYNV+I  + YY FAS N +LPW +C+      +C      ++   +N S  H         N T  + SPSE+Y+ ++VLNISG I D G  +  L  CL ++W+VV   L++G+ S GKV YFTA FPYV+L IL IRG  L GA+ GI++Y+ P++D+I  +KVW DAA+QIF+SL C  G LITM+SYN F NNC RD++ ++I NCATS++AGFVIF+ LGFMA      +  V D GPGLAFV YPEALT + ++PLWSI FF M+I LG G+QF ++ET++  I DE+    +++ +    +  + + I+ FLLGIP+T + G+Y L ++D   + + L++++ +  I + Y YG   + KDI +M    P  +++  W + SP +I  ++IF  +    +KY D+ YP   +T+   +AL  +I +P   ++R  +  G   L+ +   +KP  +WGPA  E+R    + I      SN      EA+  +P+ +   +G +   S     ++ S+V
Sbjct:   10 TKKDENPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQHSLLNLTMGLNQTLKRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWK---TLVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGHRNYFKDIEMMLGFPPPLFFQFCWRFFSPAIIFFILIFTVIQYRPIKYNDYVYPDWALTIGFLMALSSVICIPLYAVFRVWRSEGHTFLQRLKNAVKPSKDWGPALLEHRTGRYAQISSSRCDSN-----PEAQPLNPEKLKDDLGLTIHGSNGQAHTQDSKV 629          
BLAST of slc6a-6 vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 487.263 bits (1253), Expect = 1.741e-162
Identity = 268/628 (42.68%), Postives = 391/628 (62.26%), Query Frame = 1
Query:  280 SKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFD----STMDIYNWSLAHP--------NST--KVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREV---IKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEV 2112
            +K+   P R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFFMEL+FGQFAS G + VW +SP+FKG+GYGM++ S  +  YYNV+I  + YY FAS N +LPW +C+      +C      ++   +N S  H         N T  + SPSE+Y+ ++VLNISG I D G  +  L  CL ++W+VV   L++G+ S GKV YFTA FPYV+L IL IRG  L GA+ GI++Y+ P++D+I  +KVW DAA+QIF+SL C  G LITM+SYN F NNC RD++ ++I NCATS++AGFVIF+ LGFMA      +  V D GPGLAFV YPEALT + ++PLWSI FF M+I LG G+QF ++ET++  I DE+    +++ +    +  + + I+ FLLGIP+T + G+Y L ++D   + + L++++ +  I + Y YG   + KDI +M    P  +++  W + SP +I  ++IF  +    +KY D+ YP   +T+   +AL  +I +P   ++R  +  G   L+ +   +KP  +WGPA  E+R    + I      SN      EA+  +P+ +   +G +   S     ++ S+V
Sbjct:   14 TKKDENPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQHSLLNLTMGLNQTLKRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWK---TLVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGHRNYFKDIEMMLGFPPPLFFQFCWRFFSPAIIFFILIFTVIQYRPIKYNDYVYPDWALTIGFLMALSSVICIPLYAVFRVWRSEGHTFLQRLKNAVKPSKDWGPALLEHRTGRYAQISSSRCDSN-----PEAQPLNPEKLKDDLGLTIHGSNGQAHTQDSKV 633          
BLAST of slc6a-6 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 462.225 bits (1188), Expect = 7.426e-151
Identity = 266/603 (44.11%), Postives = 374/603 (62.02%), Query Frame = 1
Query:  238 IVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDST--------------MDIYNWSL---AHPN-----------STKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRR-LRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYR-YCKEGGWI-ILREVIKPKSEWGPADEENR 1953
            I +D  G+E             R  W  K++F+ S V  AVGLGNVWRFPYL ++NGGGAFL+PY  ML L GLP+FF+E++ GQFAS GP++VW   P  +G G  M+I S +++ YYNVII  +L+YLFASF +VLPW  C+       C D T              + I N +    A+PN            T VS SE+YF+  VL IS  I   G  +W L  CL LAW++V A L KGI S GKV YFTA FPYV+L ILLIRG  LPGA  GI ++I P+++++ D+ VW DAATQIFFSLS   G LIT+SSYN F NNC RD + V   N ATSIFAGFVIF+ +GFMA+ +   I+NV D+GPG+AFVVYPEALT + ++P W+I FFLM++TLG  + FA +ET++  I DE  + LR      H  +F +  CI  F++G PM  +GG+Y+  ++D   + Y L+++A+ E++ I Y YG+ RF +DI +M   +PN +W++ W +++P +++ ++ F F   + + YG + YP   + L   +    +I++P +F+ + Y   G +I  L+ V  P+ +WGP   ++R
Sbjct:  173 IPEDEQGDE----------NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRT-----HKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGPFLAQHR 760          
BLAST of slc6a-6 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 462.225 bits (1188), Expect = 7.426e-151
Identity = 266/603 (44.11%), Postives = 374/603 (62.02%), Query Frame = 1
Query:  238 IVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDST--------------MDIYNWSL---AHPN-----------STKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRR-LRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYR-YCKEGGWI-ILREVIKPKSEWGPADEENR 1953
            I +D  G+E             R  W  K++F+ S V  AVGLGNVWRFPYL ++NGGGAFL+PY  ML L GLP+FF+E++ GQFAS GP++VW   P  +G G  M+I S +++ YYNVII  +L+YLFASF +VLPW  C+       C D T              + I N +    A+PN            T VS SE+YF+  VL IS  I   G  +W L  CL LAW++V A L KGI S GKV YFTA FPYV+L ILLIRG  LPGA  GI ++I P+++++ D+ VW DAATQIFFSLS   G LIT+SSYN F NNC RD + V   N ATSIFAGFVIF+ +GFMA+ +   I+NV D+GPG+AFVVYPEALT + ++P W+I FFLM++TLG  + FA +ET++  I DE  + LR      H  +F +  CI  F++G PM  +GG+Y+  ++D   + Y L+++A+ E++ I Y YG+ RF +DI +M   +PN +W++ W +++P +++ ++ F F   + + YG + YP   + L   +    +I++P +F+ + Y   G +I  L+ V  P+ +WGP   ++R
Sbjct:  173 IPEDEQGDE----------NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRT-----HKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGPFLAQHR 760          
BLAST of slc6a-6 vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 462.225 bits (1188), Expect = 7.426e-151
Identity = 266/603 (44.11%), Postives = 374/603 (62.02%), Query Frame = 1
Query:  238 IVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDST--------------MDIYNWSL---AHPN-----------STKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRR-LRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYR-YCKEGGWI-ILREVIKPKSEWGPADEENR 1953
            I +D  G+E             R  W  K++F+ S V  AVGLGNVWRFPYL ++NGGGAFL+PY  ML L GLP+FF+E++ GQFAS GP++VW   P  +G G  M+I S +++ YYNVII  +L+YLFASF +VLPW  C+       C D T              + I N +    A+PN            T VS SE+YF+  VL IS  I   G  +W L  CL LAW++V A L KGI S GKV YFTA FPYV+L ILLIRG  LPGA  GI ++I P+++++ D+ VW DAATQIFFSLS   G LIT+SSYN F NNC RD + V   N ATSIFAGFVIF+ +GFMA+ +   I+NV D+GPG+AFVVYPEALT + ++P W+I FFLM++TLG  + FA +ET++  I DE  + LR      H  +F +  CI  F++G PM  +GG+Y+  ++D   + Y L+++A+ E++ I Y YG+ RF +DI +M   +PN +W++ W +++P +++ ++ F F   + + YG + YP   + L   +    +I++P +F+ + Y   G +I  L+ V  P+ +WGP   ++R
Sbjct:  173 IPEDEQGDE----------NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRT-----HKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGPFLAQHR 760          
BLAST of slc6a-6 vs. Ensembl Mouse
Match: Slc6a9 (solute carrier family 6 (neurotransmitter transporter, glycine), member 9 [Source:MGI Symbol;Acc:MGI:95760])

HSP 1 Score: 449.514 bits (1155), Expect = 5.399e-148
Identity = 263/623 (42.22%), Postives = 379/623 (60.83%), Query Frame = 1
Query:  280 SKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWS-----------LAHP-NST--KVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREV---IKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPI----GDSFFQSKR 2085
            +K+     R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFFMEL+FGQFAS G + VW ISP+FKG+GYGM++ S  +  YYNV+I  + YY F+S   VLPW +C+       C    +D  N +           L+H  N T  + SPSE+Y+   VL +S  I + G  +  L  CL ++W+VV   L++G+ S GKV YFTA FPYV+L IL +RG  L GA  GI++Y+ P++D+I ++KVW DAA+QIF+SL C  G LITM+SYN F NNC RD+V ++I NCATS++AGFVIF+ LGFMA+     +  V D GPGLAFV YPEALT + ++PLWS+ FF M+I LG G+QF ++ET++  I DE+    +L+ + +V +    + +  FLLGIP+T + G+Y L ++D   + + L+V++ +  + I Y YG   + +DI +M    P  +++I W ++SP +I  ++IF  +    + Y  + YP   V +   +AL  +I +P   +++ C+  G  +L+ +    KP  +WGPA  E+R    +       +        E +   PD    PI    G S FQ  R
Sbjct:   19 TKKDQNLTRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTPDC-AGVLDASNLTNGSRPAALSGNLSHLFNYTLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFTGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTL---GVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVSIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILIFTVIQYRPITYNHYQYPGWAVAIGFLMALSSVICIPLYALFQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPSPEDGF-----EVQPLHPDKAQIPIVGSNGSSRFQDSR 632          
BLAST of slc6a-6 vs. Ensembl Mouse
Match: Slc6a9 (solute carrier family 6 (neurotransmitter transporter, glycine), member 9 [Source:MGI Symbol;Acc:MGI:95760])

HSP 1 Score: 449.514 bits (1155), Expect = 5.399e-148
Identity = 263/623 (42.22%), Postives = 379/623 (60.83%), Query Frame = 1
Query:  280 SKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWS-----------LAHP-NST--KVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREV---IKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPI----GDSFFQSKR 2085
            +K+     R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFFMEL+FGQFAS G + VW ISP+FKG+GYGM++ S  +  YYNV+I  + YY F+S   VLPW +C+       C    +D  N +           L+H  N T  + SPSE+Y+   VL +S  I + G  +  L  CL ++W+VV   L++G+ S GKV YFTA FPYV+L IL +RG  L GA  GI++Y+ P++D+I ++KVW DAA+QIF+SL C  G LITM+SYN F NNC RD+V ++I NCATS++AGFVIF+ LGFMA+     +  V D GPGLAFV YPEALT + ++PLWS+ FF M+I LG G+QF ++ET++  I DE+    +L+ + +V +    + +  FLLGIP+T + G+Y L ++D   + + L+V++ +  + I Y YG   + +DI +M    P  +++I W ++SP +I  ++IF  +    + Y  + YP   V +   +AL  +I +P   +++ C+  G  +L+ +    KP  +WGPA  E+R    +       +        E +   PD    PI    G S FQ  R
Sbjct:   19 TKKDQNLTRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTPDC-AGVLDASNLTNGSRPAALSGNLSHLFNYTLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFTGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTL---GVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVSIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILIFTVIQYRPITYNHYQYPGWAVAIGFLMALSSVICIPLYALFQLCRTDGDTLLQRLKNATKPSRDWGPALLEHRTGRYAPTTTPSPEDGF-----EVQPLHPDKAQIPIVGSNGSSRFQDSR 632          
BLAST of slc6a-6 vs. UniProt/SwissProt
Match: sp|A7Y2W8|SC6A9_XENLA (Sodium- and chloride-dependent glycine transporter 1 OS=Xenopus laevis OX=8355 GN=slc6a9 PE=2 SV=1)

HSP 1 Score: 483.411 bits (1243), Expect = 2.257e-160
Identity = 266/637 (41.76%), Postives = 392/637 (61.54%), Query Frame = 1
Query:  280 SKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNST-----------------------KVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYR-YCKEGGWII--LREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEV 2112
            +K+     R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFFMEL+FGQFAS G + VW +SP+FKG+GYGM++ S  +  YYNV+I  + YY FAS N VLPW +C+     ++C           +  PNS+                       + SPSE+Y+ ++VL IS  I D G  Q  L  CL ++W+VV   L++G+ S GKV YFTA FPYV+L IL IRG  L GA+ GI++Y+ P++D+I  + VW DAA+QIF+SL C  G LITM+SYN F NNC RD++ ++I NCATS++AGFVIF+ LGFMA      +  V D GPGLAFV YPEALT + ++PLWSI FF M+I LG G+QF ++ET++  + DE+    +++ +    +  + + I+ FLLGIP+T + G+Y L ++D   + + L++++ +  I + Y YG  ++ KDI +M    P  +++I W +ISPG+I  ++IF  +    ++Y D+ YP   +T+   +AL  +I +P   I++ +C EG   +  L+  +KP  +WGPA +E+R    + +     +SN      EA+  +P+ M   +  +   S     ++ S+V
Sbjct:   14 TKKDENLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRVLPWTYCNNLWNTNNCA---------GVLSPNSSASFNLSSQQNLLNLTLGLNQTLKRTSPSEEYWRRHVLKISEDIGDFGEVQLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLEGAINGILYYLTPQWDKILHAMVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAVVDEIGNDWIIRWK---TLVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGHRKYFKDIEMMLGFPPPLFFQICWRFISPGIIFFILIFTVIQYRPIQYNDYLYPDWAITIGFLMALSSVICIPLYAIFKIWCSEGDTFLQRLKNAVKPSKDWGPALQEHRTGRYAQMSSTRSESN-----PEAQPLNPEKMKEDLSLTIQGSNGQAHTQDSKV 633          
BLAST of slc6a-6 vs. UniProt/SwissProt
Match: sp|Q761V0|SC6A5_MOUSE (Sodium- and chloride-dependent glycine transporter 2 OS=Mus musculus OX=10090 GN=Slc6a5 PE=1 SV=1)

HSP 1 Score: 461.84 bits (1187), Expect = 9.881e-150
Identity = 266/603 (44.11%), Postives = 374/603 (62.02%), Query Frame = 1
Query:  238 IVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDST--------------MDIYNWSL---AHPN-----------STKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRR-LRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYR-YCKEGGWI-ILREVIKPKSEWGPADEENR 1953
            I +D  G+E             R  W  K++F+ S V  AVGLGNVWRFPYL ++NGGGAFL+PY  ML L GLP+FF+E++ GQFAS GP++VW   P  +G G  M+I S +++ YYNVII  +L+YLFASF +VLPW  C+       C D T              + I N +    A+PN            T VS SE+YF+  VL IS  I   G  +W L  CL LAW++V A L KGI S GKV YFTA FPYV+L ILLIRG  LPGA  GI ++I P+++++ D+ VW DAATQIFFSLS   G LIT+SSYN F NNC RD + V   N ATSIFAGFVIF+ +GFMA+ +   I+NV D+GPG+AFVVYPEALT + ++P W+I FFLM++TLG  + FA +ET++  I DE  + LR      H  +F +  CI  F++G PM  +GG+Y+  ++D   + Y L+++A+ E++ I Y YG+ RF +DI +M   +PN +W++ W +++P +++ ++ F F   + + YG + YP   + L   +    +I++P +F+ + Y   G +I  L+ V  P+ +WGP   ++R
Sbjct:  181 IPEDEQGDE----------NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRT-----HKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGPFLAQHR 768          
BLAST of slc6a-6 vs. UniProt/SwissProt
Match: sp|Q9Y345|SC6A5_HUMAN (Sodium- and chloride-dependent glycine transporter 2 OS=Homo sapiens OX=9606 GN=SLC6A5 PE=1 SV=3)

HSP 1 Score: 461.07 bits (1185), Expect = 1.773e-149
Identity = 261/581 (44.92%), Postives = 367/581 (63.17%), Query Frame = 1
Query:  304 RQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDST--------------MDIYNWSL---AHPNSTKV-----------SPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRR-LRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWII--LREVIKPKSEWGPADEENR 1953
            R  W  K++F+ S V  AVGLGNVWRFPYL ++NGGGAFL+PY  ML L GLP+FF+E++ GQFAS GP++VW   P  +G G  M+I S +++ YYNVII  +L+YLFASF +VLPW  C+       C D T              + I N +    A+PN T V           S SE+YF+  VL IS  I   G  +W L LCL LAW++V A L KGI + GKV YFTA FPYV+L ILLIRG  LPGA  GI ++I P+++++ D+ VW DAATQIFFSLS   G LIT+SSYN F NNC RD + V   N ATSIFAGFVIF+ +GFMA+ +   I+NV D+GPG+AFVVYPEALT + ++P W+I FFLM++TLG  + FA +ET++  I DE  + LR      H  +F +  CI  F++G PM  +GG+Y+  ++D   + Y L+++A+ E++ I Y YG+ RF +DI +M   +PN +W++ W +++P +++ ++ F F   + + YG + YP   + L   +    +I++P +F+ +     G  I  L+ V  P+ +WGP   ++R
Sbjct:  191 RGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRT-----HKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMHLAPGRFIERLKLVCSPQPDWGPFLAQHR 766          
BLAST of slc6a-6 vs. UniProt/SwissProt
Match: sp|P58295|SC6A5_RAT (Sodium- and chloride-dependent glycine transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc6a5 PE=1 SV=2)

HSP 1 Score: 460.299 bits (1183), Expect = 2.815e-149
Identity = 265/603 (43.95%), Postives = 374/603 (62.02%), Query Frame = 1
Query:  238 IVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDST--------------MDIYNWSL---AHPN-----------STKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRR-LRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYR-YCKEGGWI-ILREVIKPKSEWGPADEENR 1953
            I +D  G+E             R  W  K++F+ S V  AVGLGNVWRFPYL ++NGGGAFL+PY  ML L GLP+FF+E++ GQFAS GP++VW   P  +G G  M+I S +++ YYNVII  +L+YLFASF +VLPW  C+       C D T              + I N +    A+PN            T VS SE+YF+  VL IS  I   G  +W L  CL LAW++V A L KGI + GKV YFTA FPYV+L ILLIRG  LPGA  GI ++I P+++++ D+ VW DAATQIFFSLS   G LIT+SSYN F NNC RD + V   N ATSIFAGFVIF+ +GFMA+ +   I+NV D+GPG+AFVVYPEALT + ++P W+I FFLM++TLG  + FA +ET++  I DE  + LR      H  +F +  CI  F++G PM  +GG+Y+  ++D   + Y L+++A+ E++ I Y YG+ RF +DI +M   +PN +W++ W +++P +++ ++ F F   + + YG + YP   + L   +    +I++P +F+ + Y   G +I  L+ V  P+ +WGP   ++R
Sbjct:  181 IPEDEQGDE----------NKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRT-----HKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGLQRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIPIMFVIKMYLAPGRFIERLKLVCSPQPDWGPFLAQHR 768          
BLAST of slc6a-6 vs. UniProt/SwissProt
Match: sp|Q28039|SC6A9_BOVIN (Sodium- and chloride-dependent glycine transporter 1 OS=Bos taurus OX=9913 GN=SLC6A9 PE=2 SV=1)

HSP 1 Score: 451.44 bits (1160), Expect = 6.959e-148
Identity = 260/622 (41.80%), Postives = 377/622 (60.61%), Query Frame = 1
Query:  280 SKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFD--STMDIYNWSL--AHPNST---------KVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWII---LREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPI----GDSFFQSKR 2085
            +K+     R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFFMEL+FGQFAS G + VW ISP+FKG+GYGM++ S  +  YYNV+I  + YY F+S   VLPW +C+       C       +I N S   A P +          + SPSE+Y+   VL +S  I + G  +  L  CL ++W+VV   L++G+ S GKV YFTA FPYV+L IL IRG  L GA  GI++Y+ P++D+I ++KVW DAA+QIF+SL C  G L+TM+SYN F NNC RD+V ++I NCATS++AGFVIF+ LGFMA+     +  V D GPGLAFV YPEALT + ++PLWS+ FF M+I LG G+QF ++ET++  I DE+    +L+ + +V +    + +  FLLGIP+T + G+Y L ++D   + + L++++ +  + I Y YG   + +DI +M    P  +++I W ++SP +I  ++IF  +    + Y  + YP   V +   +AL  +I +P   ++++C+  G  +   L+   KP  +WGPA  E+R    +       +        E +   PD    P+    G S FQ  R
Sbjct:   24 TKKDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTPVLPWTYCNNPWNTPDCMSVLDNPNITNGSQPPALPGNVSQALNQTLKRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGVTLEGAFTGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLVTMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTL---GVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVIISCIMCVSIMYIYGHQNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILIFSVIQYQPITYNQYQYPSWRVRIGFLMALSSVICIPLYALFQFCRTDGDTLLHRLKNATKPSRDWGPALLEHRTRRYAPTTTPSPEDGL-----EVQPLHPDKAQIPMVGSNGSSRFQDSR 637          
BLAST of slc6a-6 vs. TrEMBL
Match: A0A0H3YIU5 (Transporter OS=Schmidtea mediterranea OX=79327 GN=slc6a-6 PE=2 SV=1)

HSP 1 Score: 1305.43 bits (3377), Expect = 0.000e+0
Identity = 673/673 (100.00%), Postives = 673/673 (100.00%), Query Frame = 1
Query:  100 MNKDLTRIVVENEMNSSPIDCKIVNEALKSLALVDNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEVAA 2118
            MNKDLTRIVVENEMNSSPIDCKIVNEALKSLALVDNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQWKLCLCLLLAWIVVLAVLLKGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYVLLVLALLEIIVICYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEVAA
Sbjct:    1 MNKDLTRIVVENEMNSSPIDCKIVNEALKSLALVDNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQWKLCLCLLLAWIVVLAVLLKGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYVLLVLALLEIIVICYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEVAA 673          
BLAST of slc6a-6 vs. TrEMBL
Match: A0A0X3PE14 (Transporter OS=Schistocephalus solidus OX=70667 GN=SC6A9 PE=3 SV=1)

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 354/672 (52.68%), Postives = 468/672 (69.64%), Query Frame = 1
Query:  196 LVDNNSRPKELFPEIVKDSSGEEIHITYSKQSTGP-DRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTK----VSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFIS------SIMRMDEQSNAIS----------GSKEAKMPSPDNMSTPIG------------DSFFQSKRSLLSKFSEV 2112
            L+  N+   E   +I  ++  +++ +TY  Q T P DR TWGGKIEF+ SCV+ AVGLGNVWRFPYLC+KNGGGAFL PY  ML  VGLPLFF+E AFGQFASLGPI++W++SPLFKGIGY MV  S++LS YYNVI++Q+L+YLFASF + LPW  C+    NS  +  T    +++   PN++      SP+E +F++ VL  S  I ++GAP WKL LCLLLAW +   VL+KG+ SLGKV+YFTA FPY+IL ILL+RG LLPG+++GI++YIKP F R++D +VW DAATQIFFSL CC+G+LI MSS+N FKNNCCRDAV VA +NCATS++AGFV+F NLGFMAH+KN ++++V   GPGLAFVVYPEA+  M    LWSICFFLM+ TLG GSQFAIVETV++G++DELRR+  L S++  + FRV +C++ F LG+PM C+GG ++L ++D+ +SGY L+ + L EI V+ Y YG+ +F KDI LM  +RPNWYWRI W+ I+PG+   LIIF  VS   ++   + +PQ   +L + IA FP+I +P   IY+YC EGGWI+  E +KP +EWGPA +E+R  FIS      S+ R D   + +           G  EA  P   NM    G            + FFQSK S+  K ++ 
Sbjct:   21 LLTRNNNNGEHSTQIDPENDMDDVQVTY--QPTKPVDRATWGGKIEFVLSCVSYAVGLGNVWRFPYLCHKNGGGAFLFPYVLMLIFVGLPLFFLEFAFGQFASLGPISIWNVSPLFKGIGYAMVAVSWLLSLYYNVIVSQALFYLFASFTSELPWSHCN----NSWNYMGTCRT-SFNETAPNASMGGLVTSPAEDFFDRYVLEKSNGIEEMGAPSWKLSLCLLLAWTLTALVLIKGVQSLGKVSYFTACFPYLILTILLVRGVLLPGSLKGILYYIKPEFHRLQDPRVWVDAATQIFFSLGCCSGSLIAMSSFNPFKNNCCRDAVIVACINCATSVYAGFVVFANLGFMAHVKNVSMEHVAKAGPGLAFVVYPEAIAQMPFPVLWSICFFLMLTTLGLGSQFAIVETVMSGVEDELRRVGRLTSRWSKMAFRVGLCVVNFFLGLPMICKGGYFLLFLVDWSMSGYPLMFICLSEITVLAYSYGLRQFLKDIELMIKERPNWYWRICWLVITPGITIALIIFSIVSSQRMQLDTYMFPQWAESLAYLIAAFPIICIPMWLIYKYCVEGGWILFTEFLKPVTEWGPAQDEHRAEFISMIRSSESLKRHDLPGSGVCLSSSYIPPGLGDAEAYPPHRTNMVLGSGIVLGSTKGLESENGFFQSKLSVAEKLTQA 685          
BLAST of slc6a-6 vs. TrEMBL
Match: A0A5K3EUZ4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 340/653 (52.07%), Postives = 452/653 (69.22%), Query Frame = 1
Query:  160 CKIVNEALKSLALVDNNSRPKELFPEI-VKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIK-NSSCFDSTMDIY-----NWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDE-QSNAISGSKEAKMPS---PDNMSTPIGDSFFQSKR 2085
            CK       SL L+  +    E   ++ +   +  ++ ITY +Q+   +R TWGGK EF+ SC++ AVGLGN+WRFPYLC+KNGGGAFLVPY  ML LVGLPLFF+E AFGQFASLGPI++W++SPLFKGIGY MV  S++LS YYNVIIA+SL YLF SF   LPW +C+ T   N +C D+T ++      N S A  N T  SP+E ++  ++L  SG I ++G P W+L LCLLLAW +   VLLKG+ SLGKV+YFTA+FPYVIL +LLI    L G++ GI++Y+ P+F R++D +VW DAATQIFFSL CC+G+LI MSS+N FKNNCCRDA+ VA +NC TSI+AGFV+F +LGFMA  KN T++NV   GPGLAFVVYPEAL  M +  +WSI FF M+ T+G GSQF IVETV++G++DELRR+ LL S +    FR+ +C++ FLLGIPM CRGG Y+L ++D+ +SGY L+ + ++EI++ICY YG+ +FR+DI LM   RPNWYWRI WM  +PG+   LIIF  VS   L+  ++ +P    ++ +  A FP++ +P  F Y+YCKEGGWI+  E +KP +EWGPA +E+R  FIS I   D  +     GS +  +     P  +  P G       R
Sbjct:    7 CKEKETDPGSLVLLKKDEHAMENGSKLQLPPEADGDLQITY-QQAQPINRATWGGKFEFVLSCISYAVGLGNIWRFPYLCHKNGGGAFLVPYLLMLILVGLPLFFLEFAFGQFASLGPISIWNVSPLFKGIGYAMVATSWLLSLYYNVIIAESLLYLFYSFTRELPWTYCNNTWNDNVTCIDATTNLTSFLSSNGSSATSNLTFTSPAEDFYYNHILQKSGGIDEIGLPVWQLSLCLLLAWTITALVLLKGVQSLGKVSYFTALFPYVILTVLLIHSLTLKGSLNGILYYLTPKFSRLKDPRVWVDAATQIFFSLGCCSGSLIAMSSFNPFKNNCCRDAIIVACVNCCTSIYAGFVVFASLGFMAEQKNVTMENVAKSGPGLAFVVYPEALAQMPLPAMWSIFFFFMLSTVGLGSQFPIVETVMSGVEDELRRVGLLTSHWVRYTFRIGLCVVNFLLGIPMVCRGGYYLLFLVDWAMSGYPLMFICVIEIVIICYSYGLKQFRRDIELMINARPNWYWRISWMITTPGISVGLIIFSMVSSSGLQLDNYVFPYWAQSIAYMTAAFPIVCIPLWFFYKYCKEGGWILFTEFLKPVNEWGPAKDEHRAEFISMIRSNDSLRQGGGHGSSQVCLSRAYIPQGLGDPEGGDIIDGSR 658          
BLAST of slc6a-6 vs. TrEMBL
Match: G7Y7I2 (Transporter OS=Clonorchis sinensis OX=79923 GN=CLF_102215 PE=3 SV=1)

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 356/694 (51.30%), Postives = 474/694 (68.30%), Query Frame = 1
Query:  109 DLTRIVVENEMNSSPIDCKIVNEALKSLALVDNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKV-SPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDE--QSNAISGSKEAKMPSPDNMSTP----------------------IGDS-FFQSKRSLLSKFSEV 2112
            D++  V + + N S      V EA+ S+A      +   + P  + D   +E+ +T++  +   +R TWGGK++FL +C+  AVGLGNVWRFPYLCYKNGGGAFL+PY  ML L+GLPLFF+E AFGQFASLGPI+VW+ISPLFKGIGY MV+ S+IL  YY ++IA SLY+L  SF +VLPW +C        C D T    N +L   N  K+ SPSE Y+  +VL  S  I   G P WKL LCL   W++    ++KG+ SLGKV+YFTA+FPY++L ILLIR  LLPGA++G++FY+KP F R+ D +VW DAATQIFFSLSCCNG LI +SS+N FKNNCCRDAV VA +NCATS++AGFVIF NLGFMA  KNTT+D V   GPGLAFVVYPEALT+M M  +WS+ FF MM TLGFGSQF+I+E V++G+QDELRR   ++S    IIFR  IC++ FLLGIPM C GG Y+  ++D  +SGY LL +A+ E +VICY YG+ +FR+DIALM  +RPNWYWRI WM++ P +   L++F FV+G+  K  ++ YP+  + L + IA+ P+  +P  F+Y+YC+EGG+I+LRE +KP  EWGPA +E+R  FIS I R +E  + + ++ +  + +P+   M+T                       I D+ FFQSK S+  K ++ 
Sbjct:    3 DISNHVPDRKANGS----TEVTEAMDSVA------QDTVVLPPSLIDERADEMDVTFNPHAQA-NRVTWGGKLDFLMTCIGYAVGLGNVWRFPYLCYKNGGGAFLIPYTLMLLLLGLPLFFLEFAFGQFASLGPISVWNISPLFKGIGYAMVLVSWILVIYYQIVIAHSLYFLINSFTSVLPWTYCGNVWNEPGCVDGT----NATLNASNFWKITSPSEDYYYNHVLEASSGIEVFGTPSWKLTLCLFACWVICCLAVIKGVQSLGKVSYFTAVFPYILLTILLIRSLLLPGALKGVLFYLKPEFSRLLDPRVWVDAATQIFFSLSCCNGGLIAISSFNKFKNNCCRDAVIVAFINCATSVYAGFVIFANLGFMADAKNTTVDAVAKSGPGLAFVVYPEALTNMPMPAIWSVFFFFMMCTLGFGSQFSILEAVISGLQDELRRFGYIQSNLKQIIFRCLICLINFLLGIPMVCGGGYYLFYLIDNYLSGYPLLFIAIAETVVICYIYGLKQFRRDIALMINERPNWYWRISWMFLVPLISLGLLLFLFVAGEEFKVEEYRYPKWALALGNVIAMSPVAMIPLWFVYKYCREGGFILLREFVKPVQEWGPARDEHRAEFISMI-RSNESLKRSRLNNASASILPTTTVMNTGSQLQVGYGLGGSVISGLAGTGIIDDTGFFQSKLSVAEKLTQA 680          
BLAST of slc6a-6 vs. TrEMBL
Match: W6UPQ2 (Transporter OS=Echinococcus granulosus OX=6210 GN=EGR_01729 PE=3 SV=1)

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 337/675 (49.93%), Postives = 450/675 (66.67%), Query Frame = 1
Query:  247 DSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIK-NSSCFDSTMDIYNW--SLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFY------------------------------------------GINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSK--------EAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEV 2112
            D  G  + +TY +Q+   +R TWGGKIEF+ SC++ AVGLGNVWRFPYLC+KNGGGAFL+PY  ML LVGLPLFF+E AFGQFASLGPI++W++SPLFKG GY MV  S++LS YYNVI+A+SL Y F SFN+VLPW +C+ T   N++C D T ++     S    N T  SP+E ++  ++L  S  + D+G P W+L   LLLAWI+   VL+KG+ SLGKV+YFTA+FPY+IL +LLIR  ++ G++QGI++Y+ P+FDR++D +VW DAATQIFFSL CC+G+LI MSS+N FKNNCCRDA+ VA +NC TSI+AGFV+F +LGFMAH KN T+DNV   GPGLAFVVYPEAL+ M    +WS+ FF M+ T+G GSQFAIVETV++G++DELRR  LL S     IFR+ +C + FLLG+PM CRGG Y+L ++D+ +SGY L+ + + EII+ICY Y                                          G+ +FRKDI LM   RPNWYWRI W+  +PG+   LI+F  VS   L+  ++ +P    +L +  A FP++ +P  F Y+YC+EGGWI+  E +KP +EWGPA +E+R  FIS I   D   + +  S+           +  P+N     GDS  + +R L+   S V
Sbjct:    8 DGDGA-LRVTY-QQAQPINRATWGGKIEFVLSCISYAVGLGNVWRFPYLCHKNGGGAFLIPYVVMLALVGLPLFFLEFAFGQFASLGPISIWNVSPLFKGTGYAMVAGSWLLSLYYNVIVAESLLYFFYSFNSVLPWTYCNNTWNANTTCIDFTRNLTELLNSNIPSNITFTSPAEDFYYNHILQKSSGLEDMGLPSWQLSPVLLLAWIITALVLIKGVQSLGKVSYFTALFPYLILSVLLIRSLMMEGSLQGILYYLTPKFDRLKDPRVWVDAATQIFFSLGCCSGSLIAMSSFNPFKNNCCRDAIIVACINCCTSIYAGFVVFASLGFMAHQKNVTMDNVAKSGPGLAFVVYPEALSQMPFPAIWSVFFFFMLSTVGLGSQFAIVETVMSGVEDELRRFNLLTSNCLKYIFRIGLCTVNFLLGLPMVCRGGYYLLFLIDWAMSGYPLMFICVTEIIIICYSYGFAESGSSPSSEVCFHTHDRCFTVDAAICSQGSAESSKRLLIGLKQFRKDIELMINARPNWYWRISWLITTPGITIALIVFSMVSTAELQLDNYVFPHWAHSLAYLTAAFPILCIPLWFFYKYCREGGWILFTEFLKPVNEWGPAQDEHRAEFISMIRSNDSLRHNVGSSQVCISSTHIPPGLADPENGVAGGGDSSGRHRRILIGNSSVV 680          
BLAST of slc6a-6 vs. Ensembl Cavefish
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:103034591])

HSP 1 Score: 451.055 bits (1159), Expect = 1.819e-148
Identity = 253/583 (43.40%), Postives = 365/583 (62.61%), Query Frame = 1
Query:  256 GEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDST------MDIYNWSLAHPNSTKV-------SPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREV---IKPKSEWGPADEENRQ 1956
            GE++     K+     R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFF+EL+FGQF SLG + VW +SP+FKG+GYGM++ S  +  YYNV+I  + YY F S   +LPW +C+       C            I N S      T+V       SPSE+Y+   VLNIS  I + G  +  +  CL ++W+VV   L++G+ S GKV YFTA FPYV+L IL IRG  L GA+ GI +Y+ P++ +I D+KVW DAA+QIF+SL C  G LITM+SYN F NNC RD++ +++ NCATS++AGFVIF+ LGFMAH     +  V D GPGLAFV YPEALT + ++PLWS+ FF M+I LG G+QF ++ET++  I DE+    +++++    I    + ++ FLLG+P+T R G+Y L ++D   + + L++++ +  I I Y YG   + KD+ +M    P  ++RI W +ISP +IS ++IF  +    + Y D+ YP+  + +   +AL  +I +P   +++     G   L  +   +KP   WGPA +E+R+
Sbjct:   16 GEQV-----KKDENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSQRLNASIANISAVVSGVTEVVNRTKRTSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAISWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLEGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISVTNCATSVYAGFVIFSILGFMAHHLGVDVSQVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNK---TIITFGVAVVGFLLGVPLTTRAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHRNYFKDVEMMLGFPPPIFFRICWRFISPLIISFILIFTVIQYKPITYNDYVYPRWSLVIGFCMALSSVICIPVYALFKIATSEGSTFLERLKYSLKPHPSWGPALQEHRK 590          
BLAST of slc6a-6 vs. Ensembl Cavefish
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:103034591])

HSP 1 Score: 450.669 bits (1158), Expect = 2.805e-148
Identity = 253/583 (43.40%), Postives = 365/583 (62.61%), Query Frame = 1
Query:  256 GEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDS------TMDIYNWSLAHPNSTKV-------SPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREV---IKPKSEWGPADEENRQ 1956
            GE++     K+     R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF+ PYF ML   G+PLFF+EL+FGQF SLG + VW +SP+FKG+GYGM++ S  +  YYNV+I  + YY F S   +LPW +C+       C            I N S      T+V       SPSE+Y+   VLNIS  I + G  +  +  CL ++W+VV   L++G+ S GKV YFTA FPYV+L IL IRG  L GA+ GI +Y+ P++ +I D+KVW DAA+QIF+SL C  G LITM+SYN F NNC RD++ +++ NCATS++AGFVIF+ LGFMAH     +  V D GPGLAFV YPEALT + ++PLWS+ FF M+I LG G+QF ++ET++  I DE+    +++++    I    + ++ FLLG+P+T R G+Y L ++D   + + L++++ +  I I Y YG   + KD+ +M    P  ++RI W +ISP +IS ++IF  +    + Y D+ YP+  + +   +AL  +I +P   +++     G   L  +   +KP   WGPA +E+R+
Sbjct:   20 GEQV-----KKDENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSQRLNASIANISAVVSGVTEVVNRTKRTSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAISWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLEGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISVTNCATSVYAGFVIFSILGFMAHHLGVDVSQVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNK---TIITFGVAVVGFLLGVPLTTRAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGHRNYFKDVEMMLGFPPPIFFRICWRFISPLIISFILIFTVIQYKPITYNDYVYPRWSLVIGFCMALSSVICIPVYALFKIATSEGSTFLERLKYSLKPHPSWGPALQEHRK 594          
BLAST of slc6a-6 vs. Ensembl Cavefish
Match: slc6a3 (solute carrier family 6 member 3 [Source:NCBI gene;Acc:103026128])

HSP 1 Score: 427.172 bits (1097), Expect = 1.161e-139
Identity = 242/591 (40.95%), Postives = 358/591 (60.58%), Query Frame = 1
Query:  217 PKELFPEIVKDSSGEE------IHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGS--ILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWII--LREVIKPKSEWGPADE-ENRQ 1956
            PKE+   +VK+ +G +      +  T     +G  R+TWG KI+FL S +  AV L NVWRFPYLCYKNGGGAFLVPY   + + G+PLF+MELA GQ+   G   VW I P+FKG+G+ +++ S  +  YYNVIIA +L+YLF+SF+  LPW+ C+ T  +++C D    + N      +S KV+P+ +YFE+ VL++  S  I DLG P+W+L  CL +  +V+   L KG+ + GKV + TA  PYV+L +LL+RG  LPGA+ GI  Y+   F R+ D++VW +AATQI FSL    G LI  SSYN F NNC RDA+  + +N  TS F+GFVIF+ LG+M+   N  +D V   GPGL F++YPEA+  +  + +W++ FF+M++TLG  S    +E+V+ G+ DE + L       H  +F + I +L FL+ +     GG+Y+  +LD+  +G  +L   L+E I I +FYG++RF  DI  M   RP  YWR+ W ++SP  +  +++  F + +  KYG + +P     +   +++  +I VP   IY++C   G     L   I P++E    +  E RQ
Sbjct:   26 PKEVELILVKEQNGVQFTSSALVTSTGQTHPSGEQRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQYNREGAAGVWKICPVFKGVGFTVILISLYVGFYYNVIIAWALFYLFSSFSGELPWVNCNNTWNSANCSDLNATLLN------DSHKVTPALEYFERGVLHMQDSRGIDDLGLPRWQLTCCLAVVIVVLYFSLWKGVKTSGKVVWITATMPYVVLTVLLLRGVTLPGAIDGIKAYLSVDFLRLCDAQVWIEAATQICFSLGVGFGVLIAFSSYNKFSNNCYRDAIITSSINSLTSFFSGFVIFSFLGYMSQKHNVALDKVATDGPGLVFIIYPEAIATLPGSSVWAVIFFIMLLTLGIDSAMGGMESVITGLIDEFKFLHR-----HRELFTLFIVVLTFLISLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGIAWFYGVDRFSDDIQEMIGHRPGLYWRLCWKFVSPCFLLFMVVVSFATFNPPKYGSYYFPTWANMVGWCLSISSMIMVPLYAIYKFCTLPGSFCAKLAYAITPETEHHLVERGEVRQ 605          
BLAST of slc6a-6 vs. Ensembl Cavefish
Match: slc6a14 (solute carrier family 6 member 14 [Source:NCBI gene;Acc:103047067])

HSP 1 Score: 407.142 bits (1045), Expect = 1.392e-131
Identity = 251/594 (42.26%), Postives = 352/594 (59.26%), Query Frame = 1
Query:  259 EEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCD-----------TTIKNSSCFDSTMDIYNWSLAH------PNSTKVSP-----SEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYI--KPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPN--W-YWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGG--WIILREVIKPKSEWGPADEENR 1953
            ++ H+    +    +R  W  K E++ S +  AVGLGNVWRFPYL YK+GGGAFL+PY  ML + GLPLFF+E +FGQF S GPI VW   P+ +G+G  M++ S  ++ YYNVI+A S+YYLFASF   LPW  C            T   N++ ++ ++   N S         P    VS      SEQY++   L  + S+ + G   W L LCLLL WI++ A L KGI S GKV YFTA FPY +L ILLIRG  L GA  GI +YI  +    ++ +++VW DAATQIFFSLS   G L  ++SYN F NNC +D++ V + NC TSIFAGF IF+ LG MAH+    +  V   G GLAF+ YP+AL+ + ++PLWSI FF M+ITLG  SQFA +E +   +QD     + LKS+  +I   V IC++ FLLG+P     G+Y +N++D  ++G++LLV  LLE+  +   YG NRF KDI +M   +    W +WR  W +I+P V+ +++ +   +     YG   YP+  + L   +  F L+++P V ++R  K  G  W  ++    P  +WGP  E +R
Sbjct:   30 QDPHV--GTEDENAERGNWSSKREYMLSMIGYAVGLGNVWRFPYLAYKHGGGAFLIPYVIMLSIAGLPLFFLESSFGQFCSQGPINVWKAVPILQGVGITMMLVSTFVAIYYNVILAYSIYYLFASFQYPLPWSNCSGWSDMGCNINATEYCNTTSYNGSLVALNRSAGADGNQSCPEELIVSTPLQTISEQYWDVVALQRTSSMDETGPVVWHLALCLLLGWIMIGAALFKGIKSSGKVVYFTATFPYAVLLILLIRGVTLEGARNGIEYYIGSQSNLTKLSEAEVWKDAATQIFFSLSIAWGGLTALASYNKFHNNCYKDSIIVCVTNCGTSIFAGFAIFSILGHMAHVYGKPVSEVAQAGFGLAFIAYPDALSKLPISPLWSILFFFMLITLGLDSQFAGIEVITTCLQDAYP--KFLKSKRGLI--TVIICVVLFLLGLPCVTGAGIYWVNLIDTFVAGWILLVAGLLEVFGLSCIYGGNRFIKDIEMMIGNKSAIFWIWWRSCWFFITPFVLLVILGWSVYTFTAPTYGTVEYPEWGIALGWCMTAFCLMWIPIVAVWRIAKASGGLWQRIKSTCVPTEDWGPYLERHR 617          
BLAST of slc6a-6 vs. Ensembl Cavefish
Match: slc6a1b (solute carrier family 6 member 1b [Source:ZFIN;Acc:ZDB-GENE-041114-57])

HSP 1 Score: 402.905 bits (1034), Expect = 2.745e-130
Identity = 224/544 (41.18%), Postives = 330/544 (60.66%), Query Frame = 1
Query:  169 VNEALKSLALVDNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYV-ISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQ 1797
            VNEA    A    N +PK L  ++              K+   PDR+TW GK +FL SCV  A+GLGNVWRFPYLC KNGGGAFL+PYF  L   G+PLF +E A GQ+ S+G + VW ++P+FKG+G    + SF L+ YY VIIA ++YYL+ SF T LPW  CD       CF       N+SLA   +   S   +++E+N+  ++  + + G  +  L + L +AW++V   + KG+   GKV YF+A +PY +L IL  RG  LPGA +GI+FYI P F+++++S+VW DAATQIFFS     G+LI + SYN F NN  +D++ V  +N  TS+FAGFVIF+ +GFM+H+    I +V   GPGLAF+ YPEA+T + ++PLW+I FF M++ LG  SQF  VE  +  + DE  R+   + +    IF   +C++ +++G+    +GG+Y+  + DY   SG  LL L   E I I +FYG+N+F  +I  M   +P  +W++ W+  +P +++ + +F  V    L   ++ +P+
Sbjct:   19 VNEAAAPTA----NDKPKTLVVKV-------------QKKKDLPDRETWAGKFDFLLSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLFLLETALGQYTSIGGLGVWKLAPMFKGVGLAAAVLSFWLNIYYIVIIAWAIYYLYNSFTTDLPWKSCDNPWNTDRCFS------NYSLAS-TANMTSAVVEFWERNMHQLTNGLEEPGEVRGPLAITLAIAWVLVYFCIWKGVGWTGKVVYFSATYPYFMLLILFFRGVTLPGAKEGILFYITPDFEKLKESEVWLDAATQIFFSYGLGLGSLIALGSYNPFNNNVYKDSIIVCCINSFTSMFAGFVIFSIVGFMSHITKRPIADVAKSGPGLAFLAYPEAVTQLPISPLWAILFFSMLLMLGIDSQFCTVEGFITALVDEFPRVLRGRRE----IFIAVVCLISYIIGLSNITQGGLYVFKLFDYYSASGMCLLFLVFFECISISWFYGVNKFYGNIEEMIGYKPCIWWKLCWVVFTPLIVAGVFLFSAVQMVPLTMNNYVFPK 534          
BLAST of slc6a-6 vs. Ensembl Sea Lamprey
Match: slc6a1a (solute carrier family 6 member 1a [Source:ZFIN;Acc:ZDB-GENE-060519-23])

HSP 1 Score: 395.971 bits (1016), Expect = 1.843e-129
Identity = 221/547 (40.40%), Postives = 330/547 (60.33%), Query Frame = 1
Query:  280 SKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCC-RDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYV-ISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIK 1914
            +K+   P R  W G+ +FL SCV  A+GLGNVWRFPYLC KNGGGAFL+PYF  L   G+PLF +E + GQ+ S+G + VW ++P+FKG+G   V+ SF L+ YY VII+ ++YYL+ SF ++LPW  C+       CF       N+S+    +   S   +++E+N+  +S  + + G  +  L + L ++W++V   + KG+   GKV YF+A FPYV+L +L  RG  LPGA +GI+FYI P F R+ DS VW DAATQIFFS     G+L+ + SYN F NN   RD++ V  +N  TS+FAGFVIF+ +GFM+H+    +  +   GPGLAF+ YP+A+T + ++PLWSI FF M++ LG  SQF  VE  +  + DE  +      + H  IF   IC++ +++G+    +GG+Y+  M DY   SG  LL L   E I I + YG++RF  +I  M   + + +W I W++ +P V+  + +F  V    L  G ++YP     +  F+AL  ++ +P   +Y +    G   LR+V++
Sbjct:    2 AKKKELPVRGAWKGRFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLVFAGIPLFLLETSLGQYTSVGGLGVWKLAPMFKGVGLASVVISFYLNIYYIVIISWAIYYLYNSFTSMLPWQDCNNPWNTDKCFS------NYSILD-TTNLTSTVVEFWERNMHQLSSGLDEPGQVRGPLAITLAISWVMVYFCIWKGVAWTGKVVYFSATFPYVMLFVLFFRGITLPGAKEGILFYITPDFRRLTDSAVWLDAATQIFFSYGLGLGSLVALGSYNPFHNNVYNRDSIIVCCINSVTSVFAGFVIFSIVGFMSHITKKPVKELAASGPGLAFLAYPQAVTQLPISPLWSILFFSMLLMLGLDSQFCTVEGFVTALSDEYPQYL----RGHKEIFIAVICVISYIIGLANITQGGLYVFKMFDYYSASGMSLLFLVFFETIAISWCYGVDRFNDNICEMIGHKVHKWWNICWVFFTPLVVVGVFMFSVVEMTPLTLGSYTYPMWGQGMGWFMALSSMLLIPGYMVYLFLVSKG--TLRQVLR 535          
BLAST of slc6a-6 vs. Ensembl Sea Lamprey
Match: slc6a4b (solute carrier family 6 member 4b [Source:ZFIN;Acc:ZDB-GENE-060314-2])

HSP 1 Score: 345.51 bits (885), Expect = 2.479e-110
Identity = 203/493 (41.18%), Postives = 305/493 (61.87%), Query Frame = 1
Query:  412 GAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWS-ISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDT---TIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNI--SGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVV-DKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYR 1869
            GAFL+PY  M    G+PLF+MELA GQF   G I++W  I P+FKG+G+ + I +F ++ YYN IIA +LYYL++SF + LPW  CD    T+  +S FD+T       +A    ++ SP+E+++ +NVL I  S  +  +G  +W+L LCL L + +V   L KG+ + GKV + TA FPYV+L ILLIRG+ LPGA +G++FY+KP + ++  ++VW DAA QIFFSL    G L+ ++SYN F NNC RDA+  + +NC TS  +GFVIFT LG+MA ++N  +++V  D GP L F+ YPEA+ +M  +  W+I FF+MMITLG  S F  +E ++  + DE   L   + ++ V+     +  +CF+  +     GG YI+ +L+   SG  ++ + LLE I + +FYG+ RF  DI  M    P ++WR+ W+ ISP  +S +++ +      LK  D+ +P   + L +FIA    +FVP    Y+
Sbjct:    1 GAFLIPYCLMAVFGGIPLFYMELALGQFHRNGAISIWRRICPIFKGVGFAICIINFYVAFYYNTIIAWALYYLYSSFTSTLPWTKCDNPWNTVNCTSYFDTT------GVAWGKHSR-SPAEEFYTRNVLEIQYSKGLGGVGGLRWQLLLCLFLIFTIVYFSLWKGVKTSGKVVWVTATFPYVVLFILLIRGATLPGAWRGVLFYLKPNWKKLLTTEVWVDAAAQIFFSLGPGFGVLLALASYNKFNNNCYRDALVTSSVNCFTSFMSGFVIFTVLGYMAEMRNVEVEDVAKDMGPSLLFITYPEAIANMMGSTFWAILFFMMMITLGLDSTFGGLEAIITAVMDEYPSLFSKRREYFVL----GLVTICFMGALSTLTYGGAYIVKLLEEFGSGCSIIGIVLLEAIAVSWFYGVKRFCADIHSMLGFSPGYFWRLCWVAISPLFLSFIVVSFLTGSKPLKLFDYDFPDWSMILGYFIAASSFMFVPLYMAYK 482          
BLAST of slc6a-6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008631.1 (pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 gene:ENSPMAG00000007785.1 transcript:ENSPMAT00000008631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 276.174 bits (705), Expect = 5.014e-84
Identity = 190/500 (38.00%), Postives = 285/500 (57.00%), Query Frame = 1
Query:  412 GAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTV-LPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTK----VSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLD-YVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPN-WYWRIMWMYISPGVISLLIIFYFVSGDTLKY-GDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGG 1887
            GAFLVPY   +  VG+PLFF+E+A GQ    G I VW I PLF G+G   ++  F+   YY V++A SLYYL  S  T  LPW  C      ++C D+       S A   ++      SP+ +++E+NVL +S  + DLG+  W++ LCLL  W++V   + KGI   GKV Y T   PYV+L +LL++G +LPGA+ GI +Y++P + ++   +VW +A+TQ+F+      G L  + SYN F NNC RD++ + I+N ATS F+GFV+F+ LGFMA  +   I +V + GPGL FVVYP A++ + +  LW+   F+M++ LG  S+FA +E  + G+ D       L  +     F    C++ FLL + M  +GG+Y+  + D Y  SG  +L L   E I + + YG NRF +D+  M   RP+ W W   W  +SP V   + +F+ V  + L Y G + YP     L   +AL  ++ +P+V +Y+     G
Sbjct:    1 GAFLVPYGLTVVCVGIPLFFLEVALGQLTQQGTIGVWKIVPLFTGVGVASMVVVFLSDLYYIVVLAWSLYYLLHSLTTAQLPWTHCQGWWATAACSDTLGTSRAASNASEGASACQDTTSPAVEFWERNVLRVSSGMHDLGSVNWEMLLCLLAVWLLVYFSVWKGIKFSGKVVYVTGSVPYVLLLVLLVQGVMLPGALDGITYYLQPDWAKLATPQVWVEASTQVFYCYGVGFGVLPALGSYNKFHNNCYRDSIILTIINSATSFFSGFVVFSFLGFMAQEQGVDISHVAETGPGLVFVVYPRAISLLPVPALWATLLFIMLLLLGVDSEFAGMEGFVTGLTDLFP--SQLSGKRRREAFTGLCCLVSFLLSVTMVTQGGIYVFQLFDSYAASGISMLWLMGWECIAVAWVYGANRFMQDLTAMLGFRPHAWVWWC-WSVVSPAVCLGIFVFHLVHYERLVYNGRYEYPGWAEALGWLLALSSMLCIPAVALYKLATAKG 497          
BLAST of slc6a-6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001684.1 (pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 gene:ENSPMAG00000001516.1 transcript:ENSPMAT00000001684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 234.187 bits (596), Expect = 1.717e-71
Identity = 139/257 (54.09%), Postives = 177/257 (68.87%), Query Frame = 1
Query:  301 DRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTI-KNSSCFDSTMDIYNWSLAHP-----NSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYI--KPRFDRIRDSKV 1047
            +R  W  K E++ S +  AVGLGN+WRFPYL YKNGGGAFL+PY  ML  VGLPLFF+E + GQFASLGPIT+W + PL KG+G+ MVI S +++ YYN IIA  L+YLFASF + LPW  C      + +CFD +  + N SLA       NS+K +PSEQY+ K  L  S S+ + G   W L L LLL+WIV  A L+KGI S GKV YFTAIFPYV+L ILLIRG+ LPGA+ GI +YI  +  F +++ ++V
Sbjct:    5 ERGNWASKSEYMLSMIGNAVGLGNLWRFPYLAYKNGGGAFLIPYIIMLAFVGLPLFFLECSIGQFASLGPITIWKVVPLLKGLGWMMVITSSLIALYYNSIIAYGLFYLFASFTSELPWSSCKKWWGADENCFDRS--VCNSSLAEGNCSSVNSSKQTPSEQYWNKYALRRSESMDETGDVVWHLALTLLLSWIVTCAALVKGIKSSGKVVYFTAIFPYVVLIILLIRGATLPGAILGIEYYIGRQSNFTKLQSAEV 259          
BLAST of slc6a-6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004857.1 (pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 gene:ENSPMAG00000004412.1 transcript:ENSPMAT00000004857.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 230.72 bits (587), Expect = 1.090e-68
Identity = 141/345 (40.87%), Postives = 194/345 (56.23%), Query Frame = 1
Query:  907 KVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYV-ISGYXXXXXXXXXXXXXCYFY-GINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGD-FSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWG 1932
            +V YFTA FPY++L IL I G  LPG+  GI++Y+KP + ++   +VW DA TQIFFS +   G L  + SYN F NNC RD   +A++N  TS FAGFV+F+ LGFMA  +   I  V + GPGLAF+ YP+A++ M MAPLW+  FF M+I LG  SQF  VE  + GI D       L   +   +F    C   FL+ I M   GGMY+  + DY   SG  LL  A  E IV+ + Y G +RF  +IALM   RP  + R  W +++P V + + +F  ++   L Y   + YP     L   +AL  ++ +P V IYR  +  G ++ R  I     WG
Sbjct:    1 QVVYFTATFPYLVLIILFINGMTLPGSYDGIMYYLKPDWSKLGQPQVWIDAGTQIFFSYAIGLGALSALGSYNRFNNNCYRDTFILALVNSGTSFFAGFVVFSTLGFMAAEQGVDISQVAESGPGLAFIAYPKAVSLMPMAPLWAALFFFMLILLGLDSQFVGVEGFVTGISDLFP--AALTGGYRREVFVGVCCFTSFLIAISMVTEGGMYVFQLFDYYSASGMTLLWQAGWECIVVAWVYAGGDRFMDNIALMIGYRPFPWMRWCWAFVTPCVCTGIFLFNLLNYKPLTYNKGYVYPWWGEALGWCMALSSMLCIPVVAIYRLARTKGNLLERWRILTTPVWG 343          
BLAST of slc6a-6 vs. Ensembl Nematostella
Match: EDO49218 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4])

HSP 1 Score: 464.151 bits (1193), Expect = 7.468e-155
Identity = 261/567 (46.03%), Postives = 365/567 (64.37%), Query Frame = 1
Query:  247 DSSGEEI----HITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWS-ISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWII--LREVIKPKSE 1926
            D+ GE +    +     +  G +R+ WG K+EF  +CV  AVGLGNVWRFPYLC+KNGGGAFL+PY  ML + G+PLFFMEL+ GQF SLGP+T W+ I P+ KG+G+ M++ SF+   YYNVIIA  LYYLF SF   +PW  CD     ++  + T ++ + +L   +S    PS++++E  VL I+  I   G  +W+L +CL+LAW++V   L KGI S GKV YFTA FPY++L ILLIRG  LPGAM+G+ FY+KP F ++ D+ VW DAATQIF+SL    G+LI M SYN F NNC RDA+ V+++NC+TS+FAG VIF+ LGFMA +    +  V   GPGLAFVVYPE +  M ++P WSICFF M++TLG  +QFA+ E V  G+ DE   +RLL+++    +F   +C  CFLLG+P+  + G +I+N+  +   G  L+ LA  E+IV+ + YG +RF  DI  MT  +   +W I W YI+P VI+ + IF  V    + Y D+ YP     +   +AL  ++++P V IY+  +  G  +   R + +P  E
Sbjct:   15 DADGEGLTSDENCKIDVEIIGEEREKWGRKVEFFLACVGYAVGLGNVWRFPYLCFKNGGGAFLIPYLCMLLICGMPLFFMELSLGQFVSLGPVTSWAAICPISKGVGFAMLVVSFLCCVYYNVIIAWCLYYLFESFAKDVPWKTCDNWWNTAT--NCTSNLTDTALKEYSS----PSKEFYENYVLRITPDIDTFGVMRWQLVVCLILAWVLVYFCLWKGIKSSGKVVYFTATFPYLVLVILLIRGLTLPGAMKGLSFYLKPNFSKLGDAIVWVDAATQIFYSLGIGFGSLIAMGSYNKFHNNCFRDAMTVSVINCSTSVFAGLVIFSVLGFMAEVLGKEVSEVATSGPGLAFVVYPEGIAQMPISPFWSICFFFMLLTLGLDTQFAMFEAVTTGLGDE--YVRLLRNRKE--LFTAFLCFCCFLLGLPIVSQSGAFIMNLYVWQAGGVSLVFLAFFEVIVVAWGYGADRFALDIETMTGNKVWPWWPIAWKYITPAVITGIFIFSLVQWQGVSYDDYQYPPWAEFVGWVMALSSMLWIPGVAIYKMSRAKGTFMERWRSLTRPDQE 571          
BLAST of slc6a-6 vs. Ensembl Nematostella
Match: EDO31545 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0])

HSP 1 Score: 452.981 bits (1164), Expect = 2.035e-150
Identity = 258/571 (45.18%), Postives = 352/571 (61.65%), Query Frame = 1
Query:  292 TGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVW-SISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCF--------------DSTMDIYNWSLAHP--------NST--------KVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVI 1911
            T  +R+TWG K +FL SC+  AVGLGNVWRFPYLCY NGGGAFL+PY  ML L G+P+FFMEL+ GQ+ SLGPI VW +I PLF+GIG+  ++ SF++  YYNVIIA  LY+L  SF + + W  CD      +C+               S   + N +LA+         N+T        +VSPS +++E  +L +S  I + G  +W++ +CL+LAW+ V   + KG+ S GKV YFTA FPY++L IL +RG  LPGA +GI FY+KP + R++D KVW  AATQIF+SL    G+L+ M SYN F NN  +DA+ ++++NC TS+FAGFVIF+ LGFM+H+ N  I+ V + GPGLAFVVYPEA+  M ++PLW+I FF M++TLG  SQF ++E V+ GI DE    R  K  F  +      C LCFLLGI    +GG Y+LN+ DY   G  LL L   E + + + YG +RF KDI  M   RP  +WR  W + +P V++ +  +  +    + YG + YPQ        IAL  ++F+P   IY   K  G   LRE +
Sbjct:    2 TTNERETWGKKADFLLSCIGFAVGLGNVWRFPYLCYANGGGAFLLPYLIMLVLCGMPMFFMELSAGQYFSLGPIGVWGAICPLFRGIGFASIVISFLVCVYYNVIIAWCLYFLAVSFRSEVLWKHCDNWWNTDNCYAGRIPESMSCSLGSGSNNSLVNSTLANATVLAANATNATTECLFPENQVSPSLEFWENYILRLSDGIGEAGEIRWQILVCLILAWVGVYFCMWKGVKSSGKVVYFTATFPYLVLFILFVRGVTLPGADKGIAFYLKPEWHRLKDPKVWVAAATQIFYSLGIGFGSLVAMGSYNKFHNNIFKDAISISLINCGTSVFAGFVIFSTLGFMSHVLNKPIEEVANSGPGLAFVVYPEAIAQMPISPLWAILFFFMILTLGLDSQFGMMEAVITGIIDEYPVCRKRKELFIAV-----ACFLCFLLGITNVTQGGAYVLNLFDYQSGGVSLLFLGFFETVCLAWIYGADRFSKDIEDMVGSRPAAWWRFTWKFCAPTVMAGIFFYSIIFWQGVSYGSYKYPQWAEFFGWVIALSSMLFIPGNAIYMIWKTPG--TLRERV 565          
BLAST of slc6a-6 vs. Ensembl Nematostella
Match: EDO39707 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977])

HSP 1 Score: 421.779 bits (1083), Expect = 3.774e-138
Identity = 260/617 (42.14%), Postives = 366/617 (59.32%), Query Frame = 1
Query:  184 KSLALVDNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVW-SISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCF-----DSTMDIYNWSLAHPNSTK-VSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILRE----VIKPKSEWGPADEENRQVFISSIMRMDEQSNA 2001
            K + + ++N   K LF      SS +   I   ++ T   R  W  K EF+ S +   VG GNVWRFPYLCYKNGG  FL+PYF ML + G+PLFF+ELA GQ+ S G I VW SI PL KGIGY + + S++   YY VI+A + YYLF SF  V+PW  CD       C      D  ++     L    + K  SPS +++  NVL ++  I D G  +W L    +L+WIVV   L KGI S GKV YFTA FP+++L IL+IRG+ L G++ G+I+Y+ P ++R+ D +VW  AATQI++SL    G LIT  SYN F NN  +DA+ ++I NC+TS FAGFV+F+ LGFMA   +TT+  V   GPGLAFV YPEA++ M ++ LW++ FF M+ITLG  SQFA +E V+  I DE   +R   +++   +F + +CI   +LG+P   +GGM+I N++DY ++G  LL++ALLEII I + YG++RF  D+  MT +RP  ++RI W Y+SP     +I+   +    +KY    YP     +   + L  ++ +P+  I+   K  G   LRE    ++KP       DEE     +S IMR +    A
Sbjct:    4 KGVEIEESNDTKKPLFGS--TSSSEDSPQIDVEEEQT---RDKWSSKAEFMLSSLGYCVGFGNVWRFPYLCYKNGGATFLIPYFIMLIVNGIPLFFLELAIGQWFSSGVIGVWKSICPLLKGIGYAICMISYLCCIYYIVILAWTFYYLFMSFQAVVPWKTCDNPWNTKFCRAKRSGDLLLNCTELDLPQNCTAKPTSPSGEFWSNNVLEMTEDISDFGDMRWPLFGTFILSWIVVYFCLFKGIKSSGKVVYFTATFPFIVLFILMIRGATLEGSLDGVIYYLNPDWERLADPQVWIYAATQIYWSLGVGFGALITFGSYNKFNNNVHKDALVISIANCSTSFFAGFVVFSVLGFMALTLDTTVAKVATSGPGLAFVAYPEAISQMPVSTLWAVLFFFMLITLGLDSQFATIEAVITAIVDEYPWVR--GTKWRKPVFVLILCISLCILGLPCVFQGGMWIFNLMDYQVAGLSLLIVALLEIITIGWIYGVDRFSDDVEYMTGRRPMRWFRICWKYVSPLCTLAIILANLIQWKGVKYNGKPYPGWAELIGWMLMLSSVLMIPAFAIHEIYKRSG--TLRERITFLLKP-------DEEA----LSKIMRDNGNKRA 600          
BLAST of slc6a-6 vs. Ensembl Nematostella
Match: EDO40151 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6])

HSP 1 Score: 399.438 bits (1025), Expect = 4.497e-130
Identity = 232/556 (41.73%), Postives = 338/556 (60.79%), Query Frame = 1
Query:  292 TGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWS-ISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYR-YCKEGGWIILREVIKPKSEWGPADEENR 1953
            T   R+ W  KIEFL +C+  AVG GN WRFPY+C+KNGGGAFL+PY   L L G+PLFFMEL+ GQ    GPI  W  I PLF GIG+  ++ SFI+S YYNVI+A SLY+L+ SF   +PW+ C  +     C+     +YN   A  N++ VS S ++  KNVL I+ SI + G     L LCLL+AWI+V   + +GI + GKV Y TA  PY+IL I  I+G  LPGA+ G++++I P++DR++D KVW DAA+QI +SL+   G LI  +SYN  KNN   DA+ ++++NCATS+FAGFVIF  +G+MAH++  ++  V  +GPGL F+VYP A++ +    +W++ FFLM+I LG  SQF  VE V A + ++  R +L K +  V++    IC + FLLG+    +GGM++ N+ D    G  LL +   E++VI + YG  R+  +I+ M  +    +W I W YISP ++  + +F       + Y +  YP     +   +AL  ++ +P    Y+ Y  EG ++   E I     +  A E++ 
Sbjct:   19 TVESRERWDRKIEFLFACIGFAVGYGNFWRFPYMCFKNGGGAFLIPYVLFLCLGGIPLFFMELSLGQLLQEGPIKAWQKICPLFSGIGFASIVISFIVSIYYNVILAWSLYFLYNSFFADIPWVGCHHSWNTPDCY-----VYN---ASANASGVSSSREFLVKNVLEITKSIEEPGGLSVHLTLCLLVAWILVYFSIWRGIRTTGKVVYVTATLPYIILVIFFIKGVTLPGAIDGVLYFITPQWDRLQDPKVWIDAASQILYSLTIGFGVLIGFASYNPRKNNVFSDALLISVINCATSVFAGFVIFAIVGYMAHVQEKSVPEVASQGPGLVFIVYPAAISQLPFPQIWAVIFFLMLIALGLDSQFGQVEVVAAALIEQWPR-QLHKHRELVVLV---ICFVMFLLGLSCVSKGGMFVFNLFDSFSCGLSLLFVVCFELLVIGWIYGARRYADNISQMIGRPVLQWWVICWKYISPIMVLGIFVFSLAKYKRITYENVPYPAWAEGVGWLLALSSMLCIPVTMCYKIYKAEGTFLQNSETISGFMHYTYAVEQSN 562          
BLAST of slc6a-6 vs. Ensembl Nematostella
Match: EDO39708 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978])

HSP 1 Score: 393.275 bits (1009), Expect = 3.964e-128
Identity = 238/543 (43.83%), Postives = 331/543 (60.96%), Query Frame = 1
Query:  301 DRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSI-SPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSE 1926
            +R+ W  KI+FL SC+  AVGLGNVWRFPYLCYKNGG +FL+PY   L   G+P+F++E+A GQ+ + G +  W++ SP+  GIG+ M + +F+ S YYNVI+A S YY+F ++  V+PW  C+       C  S     N    H N+     S     + VL +SG +   G  +++L +CLLLAWIVV   + KGI S GKV YFTA FPY++L ILLIRG+ LPGA  G +FY+KP F ++ D +VW DAA QIFFSLS   G LIT  SYN F NNC RD + V+++NC TS+FAGFVIFT +GFMAH     +++VV  GPGLAF+ YP+ +  +  +P W+  FF M+  LG  SQF  VETV   + D  +  R  K+   ++      C++ ++LGI    +GG+YI  M DY   G  L+++ALLE+I I +FYG+ RF ++I  M   RPN Y+ + W YISP +I ++ I+  V    + YGD+ +P         +    ++ VP   IYR  K  G   L EV +   +
Sbjct:    3 EREQWSNKIDFLLSCIGYAVGLGNVWRFPYLCYKNGGASFLIPYLVCLVFCGIPIFYLEVALGQYTAQGVVNAWAVVSPIMTGIGFAMTVITFLCSVYYNVIMAWSFYYMFDAWRAVVPWNDCNNEWNTQFC--SCTHAMNIPSFHENTII---SVTLSRRKVLQLSGDVGKPGEVRFELAMCLLLAWIVVYFCVWKGIKSAGKVVYFTATFPYLVLFILLIRGATLPGAANGALFYVKPDFTKLGDPRVWVDAAGQIFFSLSVGFGGLITYGSYNKFNNNCQRDTLIVSVINCLTSVFAGFVIFTMMGFMAHELGVEVEDVVKSGPGLAFIAYPQGIKKIPGSPFWAFLFFFMLFNLGLDSQFVGVETVTTVLSDSYKGARRYKAHLTLL-----FCVVSYILGISNVTQGGVYIFTMFDYQGGGISLILIALLEVIAIGWFYGVERFARNIESMIGHRPNIYFLLCWKYISPLIIGVIFIWNCVDWSGISYGDYVFPAWAEFCGWLLCFSSIVCVPICAIYRCVKGKG--TLAEVKRATRD 533          
BLAST of slc6a-6 vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 446.432 bits (1147), Expect = 1.204e-146
Identity = 248/575 (43.13%), Postives = 365/575 (63.48%), Query Frame = 1
Query:  283 KQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIY--NWSLAHPNST-------------KVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWII---LREVIKPKSEWGPADEENR 1953
            K+     R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF++PYF ML   G+PLFF+EL+FGQFAS G + VW ISP+FKG+GYGM++ S  +  YYNV+I  + YY F S   +LPW +C+       C       Y  N SLA+  ++             + SPSE+Y++  VLNIS  I + G  +  +  CL ++W VV   L++G+ S GKV YFTA FPYV+L IL IRG  L GA+ GI +Y+ P++ ++ D+KVW DAA+QIF+SL C  G LITM+SYN F NNC RD++ ++I NCATS++AGFVIF+ LGFMAH  N  +  V D GPGLAFV YPEALT + ++PLWS+ FF M+I LG G+QF ++ET++  I DE+    +++++    +  +S+ ++ FLLG+P+T + G+Y L ++D   + + L+V++ +  I I Y YG   + +D+ +M    P  ++++ W +ISP +IS ++IF  +    + Y D+ YP   + +   +AL  ++ +P   +Y+  +  G      L+   +   +WGPA  E+R
Sbjct:   24 KKDENLRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNISDDIGNFGEVRLPILGCLAVSWCVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNVPVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNK---TVVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGHRNYFRDVEMMLGFPPPLFFKVCWRFISPLIISFILIFTVIQYKPITYNDYVYPGWSLAIGFAMALSSVVCIPVYALYKISRSPGATFRERLKAACRAHPKWGPALLEHR 595          
BLAST of slc6a-6 vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 446.047 bits (1146), Expect = 1.861e-146
Identity = 248/575 (43.13%), Postives = 365/575 (63.48%), Query Frame = 1
Query:  283 KQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIY--NWSLAHPNST-------------KVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWII---LREVIKPKSEWGPADEENR 1953
            K+     R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF++PYF ML   G+PLFF+EL+FGQFAS G + VW ISP+FKG+GYGM++ S  +  YYNV+I  + YY F S   +LPW +C+       C       Y  N SLA+  ++             + SPSE+Y++  VLNIS  I + G  +  +  CL ++W VV   L++G+ S GKV YFTA FPYV+L IL IRG  L GA+ GI +Y+ P++ ++ D+KVW DAA+QIF+SL C  G LITM+SYN F NNC RD++ ++I NCATS++AGFVIF+ LGFMAH  N  +  V D GPGLAFV YPEALT + ++PLWS+ FF M+I LG G+QF ++ET++  I DE+    +++++    +  +S+ ++ FLLG+P+T + G+Y L ++D   + + L+V++ +  I I Y YG   + +D+ +M    P  ++++ W +ISP +IS ++IF  +    + Y D+ YP   + +   +AL  ++ +P   +Y+  +  G      L+   +   +WGPA  E+R
Sbjct:   20 KKDENLRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNISDDIGNFGEVRLPILGCLAVSWCVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNVPVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNK---TVVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGHRNYFRDVEMMLGFPPPLFFKVCWRFISPLIISFILIFTVIQYKPITYNDYVYPGWSLAIGFAMALSSVVCIPVYALYKISRSPGATFRERLKAACRAHPKWGPALLEHR 591          
BLAST of slc6a-6 vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 446.047 bits (1146), Expect = 1.861e-146
Identity = 248/575 (43.13%), Postives = 365/575 (63.48%), Query Frame = 1
Query:  283 KQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIY--NWSLAHPNST-------------KVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWII---LREVIKPKSEWGPADEENR 1953
            K+     R  WG +IEF+ + V  AVGLGNVWRFPYLCY+NGGGAF++PYF ML   G+PLFF+EL+FGQFAS G + VW ISP+FKG+GYGM++ S  +  YYNV+I  + YY F S   +LPW +C+       C       Y  N SLA+  ++             + SPSE+Y++  VLNIS  I + G  +  +  CL ++W VV   L++G+ S GKV YFTA FPYV+L IL IRG  L GA+ GI +Y+ P++ ++ D+KVW DAA+QIF+SL C  G LITM+SYN F NNC RD++ ++I NCATS++AGFVIF+ LGFMAH  N  +  V D GPGLAFV YPEALT + ++PLWS+ FF M+I LG G+QF ++ET++  I DE+    +++++    +  +S+ ++ FLLG+P+T + G+Y L ++D   + + L+V++ +  I I Y YG   + +D+ +M    P  ++++ W +ISP +IS ++IF  +    + Y D+ YP   + +   +AL  ++ +P   +Y+  +  G      L+   +   +WGPA  E+R
Sbjct:   20 KKDENLRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVGSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNISDDIGNFGEVRLPILGCLAVSWCVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNVPVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNK---TVVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGHRNYFRDVEMMLGFPPPLFFKVCWRFISPLIISFILIFTVIQYKPITYNDYVYPGWSLAIGFAMALSSVVCIPVYALYKISRSPGATFRERLKAACRAHPKWGPALLEHR 591          
BLAST of slc6a-6 vs. Ensembl Medaka
Match: slc6a5 (solute carrier family 6 member 5 [Source:NCBI gene;Acc:101158004])

HSP 1 Score: 449.514 bits (1155), Expect = 3.353e-146
Identity = 253/584 (43.32%), Postives = 357/584 (61.13%), Query Frame = 1
Query:  304 RQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTM--------------------------------DIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWI--ILREVIKPKSEWGPADEENR 1953
            R  W  K++F+ S V  AVGLGNVWRFPYL ++NGGGAFL+PY +ML + G+P+F +E++ GQFAS GP++VW   P  +G G  M+I S +++ YYN+I+  +LYYLFAS    LPW  C        C D  M                                 + N S+   N T VSPSE+YF+ NVL+IS  I   G  +W L  CL LAW++V A L KGI S GKV YFTA FPYV+L ILLIRG  LPGA  GI+++I P+++++ D+KVW DAATQIFFSLS   G LIT+SSYN F NNC RD V V   N ATSIFAGFVIF+ +GFMAH     I+ V D+GPG+AFVVYPEALT + ++P W+I FFLM++TLG  + FA +ET++  + DE  +      + H  +F +  C   F+LG PM    GMY+L ++D   + Y L+++A+ E++ I Y YG+ RF  DI +M   +PN +WR+ W +++P +++ ++         + Y D++YP   + +   + +  +I++P +F+ +     G I   L+ V  P+ +WGP   ++R
Sbjct:  169 RGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVSLGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWANCRNEWNTVECKDKDMLLLDSCILRDRNAISVKNSTFCLSANAVGNLTKLLNVSI-DANKTYVSPSEEYFKYNVLHISKGIEYPGDIRWPLAGCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLIILLIRGVTLPGAGDGILYFITPKWEKLSDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIEKVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYL----RKHKPVFTLICCASFFILGFPMITENGMYMLQLVDTFAASYSLVIIAIFELLGISYLYGLQRFCADIEMMIGFQPNRFWRLCWAFVTPTILTGILGLSLYQWKVMTYEDYTYPTWSMIMGWLMVICSVIWIPIMFLIKMYLAPGTIGERLKLVCSPQPDWGPFLMKHR 747          
BLAST of slc6a-6 vs. Ensembl Medaka
Match: slc6a2 (solute carrier family 6 member 2 [Source:NCBI gene;Acc:101172721])

HSP 1 Score: 421.779 bits (1083), Expect = 1.428e-137
Identity = 245/616 (39.77%), Postives = 358/616 (58.12%), Query Frame = 1
Query:  172 NEALKSLA-LVDNNSRPKELFPEIVKDSSGEEIH----ITYSKQSTGP-------DRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDS---TMDIYNWSLAHPNSTKVSPSEQYFEKNVLNI--SGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILR--EVIKPKSEWGPADEENRQVF 1962
               L S+A L   N   KE+   +VKD +G +      I  + +  GP       +R+TWG KI+FL S +  AV L NVWRFPYLCYKNGGGAFL+PY   L + G+PLF+MELA GQ+   G  TVW I P+FKG+GY +++ +  +  YYNVIIA SLYYL++S    LPW+ C  +  + +C D        ++ + ++ N+ K +P+ +Y+E+ VL++  S  I DLG P+ +L LCL++   ++   L KG+ S GKV Y TA  PYV+L +LLIRG  LPGA+ GI  Y+      + + +VW DAATQIF+SL    G LI  SSYN F NNC RDA+  + +NC TS  +GF IF+ LG+MA   N  I  V   GPGL F++YPEA++ +  +  W+I FF+M++TLG  S    +E V+ G+ D+ + L+  +      +F  +     FL+ +     GG+Y+L +LD   +G  +L   L+E I + +FYG++RF +DI  M   +P  YWR+ W ++SP  +  ++I   V+   LKYGD+ +P     L   +A+  ++FVP   IY++    G    R    I P+ E     E N + F
Sbjct:    8 EHKLSSVAPLKQCNVEKKEVELILVKDQNGVQYTNSTIIPTAARCAGPHGTSTDIERETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLIPYILFLVIAGMPLFYMELALGQYNREGAATVWKICPVFKGVGYAVIVIALYVGFYYNVIIAWSLYYLYSSMTAELPWLKCGHSWNSINCTDPQHINASFFDKNTSYANN-KFTPASEYYERGVLHLHESKGIEDLGLPRLELTLCLVVVVFILYFSLWKGVKSSGKVVYITATMPYVVLFVLLIRGITLPGALNGIKAYLNFSLSELNNLQVWIDAATQIFYSLGAGFGVLIAFSSYNKFDNNCYRDAILTSAVNCITSFVSGFAIFSVLGYMAQKYNMDIKAVATDGPGLVFIIYPEAISTLPGSTFWAIVFFIMLLTLGIDSSMGGMEAVITGLSDDFKFLKRNRK-----LFTFATAFGTFLMALICVTNGGIYVLTLLDKYAAGTSILFAVLIEAIGVSWFYGVDRFSEDIEQMMGFKPGLYWRLCWKFVSPVFLLFVVIASTVTSSGLKYGDYVFPNGANLLGWGVAMSSMLFVPFYAIYKFFSVRGTFTERIAYCITPEHEHHKVAEGNVRQF 617          
BLAST of slc6a-6 vs. Planmine SMEST
Match: SMESG000050382.1 (SMESG000050382.1)

HSP 1 Score: 1305.43 bits (3377), Expect = 0.000e+0
Identity = 673/673 (100.00%), Postives = 673/673 (100.00%), Query Frame = 1
Query:  100 MNKDLTRIVVENEMNSSPIDCKIVNEALKSLALVDNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEVAA 2118
            MNKDLTRIVVENEMNSSPIDCKIVNEALKSLALVDNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQWKLCLCLLLAWIVVLAVLLKGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYVLLVLALLEIIVICYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEVAA
Sbjct:    1 MNKDLTRIVVENEMNSSPIDCKIVNEALKSLALVDNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQWKLCLCLLLAWIVVLAVLLKGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYVLLVLALLEIIVICYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEVAA 673          
BLAST of slc6a-6 vs. Planmine SMEST
Match: SMESG000050382.1 (SMESG000050382.1)

HSP 1 Score: 1277.69 bits (3305), Expect = 0.000e+0
Identity = 660/660 (100.00%), Postives = 660/660 (100.00%), Query Frame = 1
Query:  139 MNSSPIDCKIVNEALKSLALVDNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEVAA 2118
            MNSSPIDCKIVNEALKSLALVDNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQWKLCLCLLLAWIVVLAVLLKGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYVLLVLALLEIIVICYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEVAA
Sbjct:    1 MNSSPIDCKIVNEALKSLALVDNNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQWKLCLCLLLAWIVVLAVLLKGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYVLLVLALLEIIVICYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEVAA 660          
BLAST of slc6a-6 vs. Planmine SMEST
Match: SMESG000003011.1 (SMESG000003011.1)

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 373/670 (55.67%), Postives = 491/670 (73.28%), Query Frame = 1
Query:  133 NEMNSSPI---DCKIV--NEALKSLALVDNNSRPKELF--PEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIK-NSSCFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSEVAA 2118
            N+  +SP    D +IV  +  LK + L D     KE    P     S GE   ITY  Q    +R  WGGKI+F+ +C++ AVGLGNVWRFPYL YKNGGGAFL+PY  ML  VGLP+FF+E A GQF+SLGPI+ W ISPLFKG+GYGMVI ++ L+ YYNVI+A  ++YLF+SF + LPW  C      N++CFD + +  +  LA  N  K+S +EQY+EK VL +S  I D G P WKL LCLLL+WI+V AVLLKG++SLGK++YFTA+FPYV+L ILLIR + LPGA QGI +Y+ P+F R+ D  VWTDAATQIFFSLSCC+G LI M+SYN FKNNCCRDAV VA++NCATS+FAGFVIF NLGFMA++KN TID V   GPGLAF+VYPEAL++M MAPLWSI FF MM+TLGFGSQF++VETV++G QDEL R  ++ S+     FRV +C++ F LGIPM C GG+Y+L +LD+ +SGY LL+L L+EI+VICYFYGI +F+KDI+LMT  RPNWYWRI W+ I+P V+  L++FYF +G +L+YGD+ YP+S++    F+AL P++F+P +F+ RYC++GG+I+L+E +KP S+WGPA++ NR  FI  ++R +E   ++      + P+ +N        FFQSK+S++ K +  A 
Sbjct:    4 NKKGNSPEKIPDQQIVIDSRPLKHITLSDRILLTKESLNLPTETIGSEGEVYKITYGDQKL--ERGEWGGKIDFIFTCISFAVGLGNVWRFPYLVYKNGGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYGMVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHL-LAIEN--KISATEQYYEKYVLEVSKGIEDFGLPSWKLLLCLLLSWIIVTAVLLKGVSSLGKISYFTALFPYVLLTILLIRSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDKVAKGGPGLAFIVYPEALSNMPMAPLWSILFFFMMLTLGFGSQFSMVETVMSGFQDELMRAGIISSEKFRKTFRVMVCVVGFALGIPMICNGGIYLLTLLDWTVSGYPLLILGLMEILVICYFYGIRQFKKDISLMTGGRPNWYWRITWLIITPIVMVFLLVFYFAAGSSLQYGDYKYPRSWLYFAQFVALVPMLFIPYMFMQRYCRDGGFILLKEYMKPSSDWGPAEQNNRAEFI-DLIRSNE---SLKKKCFIRNPNDENGEENEETKFFQSKQSIIDKLNRAAT 664          
BLAST of slc6a-6 vs. Planmine SMEST
Match: SMESG000009986.1 (SMESG000009986.1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 337/628 (53.66%), Postives = 441/628 (70.22%), Query Frame = 1
Query:  229 FPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSS-CFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFSE 2109
            FP+ + D +GEEI I Y K S  P R+ W  + EF+  C+  AVGLGNVWRFPYLCYKNGGGAFL+PY   L  +GLPLFFMELA GQFAS G I +WSISP+FKGIGYGM + S ++  YYN+IIAQ L+Y   SF ++LPW  C+ +  N + C+D T +      +   S K+SPSE+Y+EK+ LN+S  I D+G PQW+L + L++AW +V+ +LLKGI  +GKV+YFTA+FPY+IL ILLIRG +LPG++ GI++YI+P F  +R+ +VW +AATQIFFSLS CNGNLITMSSYN F NNC RDAV VA++NCATS++ G VIF+N+GFMA  KN ++ +VV  GPGLAF VYPEALT M ++PLWS+ FFLMMI LG GSQ A+VETVLAG+QDEL R + L +    I++R+ +C++ F+LG+PMTCRGGMY+L + D  +SG  +L+LAL+E++V+ Y YGI RFR DI LM   +PN +W+  WM ISP +I +LII   V    LK   F  P  FV L   ++L P+ FV S+F + YCK+GGW++  E+ KP   WGPA +E++Q F SSI              E+K  S          +FFQSK S+L KF  
Sbjct:   18 FPKSIIDENGEEIKIEYEK-SVKPKREEWSNRFEFILCCIGTAVGLGNVWRFPYLCYKNGGGAFLIPYTITLCFIGLPLFFMELALGQFASQGAIGIWSISPMFKGIGYGMTMVSGLVCIYYNIIIAQCLFYFGVSFTSLLPWSNCNNSWNNRTLCYDGTDN------STQLSGKISPSEEYYEKHFLNMSDGIEDMGWPQWRLLVSLVIAWCIVIVILLKGIKYMGKVSYFTALFPYIILTILLIRGLVLPGSLNGILYYIRPDFKYLRNPRVWVEAATQIFFSLSVCNGNLITMSSYNKFTNNCLRDAVLVAVINCATSVYGGLVIFSNMGFMAFAKNVSMTDVVKGGPGLAFKVYPEALTKMPLSPLWSVLFFLMMIILGIGSQIALVETVLAGLQDELVRAKKLVTSNQKILYRLVMCLILFVLGVPMTCRGGMYVLEIFDGAVSGSPMLILALVEVLVVSYCYGIERFRMDIKLMIGYKPNKFWKYSWMIISPFLIFILIIGLTVL-SILKKSTF--PIGFVILQIVLSLLPIFFVISIFAFVYCKKGGWLLFSELKKPLHHWGPAHDEHKQNFYSSI------------QDESKTNS----------NFFQSKESILKKFHR 613          
BLAST of slc6a-6 vs. Planmine SMEST
Match: SMESG000009987.1 (SMESG000009987.1)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 316/636 (49.69%), Postives = 434/636 (68.24%), Query Frame = 1
Query:  205 NNSRPKELFPEIVKDSSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCYKNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGIGYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSS-CFDSTMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQXXXXXXXXXXXXXXXXXXXXGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGIIFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCRDAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVYPEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLLKSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYXXXXXXXXXXXXXCYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFYFVSGDTLKYGDF-SYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIILREVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMSTPIGDSFFQSKRSLLSKFS 2106
            N    + L  +  +DS   E  I    +S  P R  W  ++EF  SC++M+VGLGN+WRFPYLCYKNGGGAFL+P+   + L+GLP+FFMELA GQFASLG I VW+ISP+FKGIGYGM I SFI+S YYN++IAQ L+Y   SF + LPW  C+ +  N   C+D + +            K+ PSE+Y++  VLN S +I D G PQWKL +CL +AWI+V+ +LLKG+  +GKV+YFTA+FPY+IL ILLIRGSLLPG++QGII+YIKP F  +++ +VW +AATQ+FFSL  CNGNL+T+SSYN+FKN+CCRDAV  A+++C TS++AGFVIF N+GFM+   N ++  VV +GPGLAF +YPEALT M ++PLWSI FF+MM++LGFGSQ AIVETVL+  QDELRR+  + S+  V+++R+ +C++ F++GIPMTCRGG+Y+L + D  +S Y +L+L L EI VI Y YG+NRF  D+ LM  ++PN +W+  W+ ++P    L I+   VS     Y +  ++P SF+ L H +   P+  +  +F+  YCK GGW +L E+ KP  +W PA E+++Q FI S+   D                           FFQSK S+ +KFS
Sbjct:   13 NTETQQRLEDKNSEDSEDLEEKIIIKTESQ-PQRGQWNSRVEFFMSCISMSVGLGNIWRFPYLCYKNGGGAFLIPFTITMCLIGLPIFFMELALGQFASLGTIGVWNISPMFKGIGYGMTIVSFIVSIYYNIVIAQCLFYFGMSFTSRLPWSSCNNSWNNPLLCYDGSDN------TSSIVGKLFPSEEYYDNFVLNKSKNITDFGLPQWKLVVCLTVAWIIVIIILLKGVKIMGKVSYFTALFPYLILTILLIRGSLLPGSLQGIIYYIKPNFRILKNPRVWAEAATQVFFSLGVCNGNLMTISSYNDFKNDCCRDAVLFAVIDCLTSVYAGFVIFCNMGFMSQSLNVSMAQVVTEGPGLAFKIYPEALTKMPLSPLWSILFFMMMLSLGFGSQIAIVETVLSSFQDELRRIGKMTSKTRVMLYRILVCLIMFIIGIPMTCRGGIYLLELFDTSVSQYSMLILGLAEICVISYVYGVNRFISDVHLMIGRKPNIFWKACWLVVTP----LFILILLVSMIYYNYKEVPAFPPSFMALQHCLTCSPIAALVIIFLIVYCKSGGWTLLTEIKKPLIQWAPAKEDHKQDFIHSLNSFDNPEKG----------------------FFQSKESIANKFS 615          
The following BLAST results are available for this feature:
BLAST of slc6a-6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC6A53.692e-15044.92solute carrier family 6 member 5 [Source:HGNC Symb... [more]
SLC6A92.242e-14840.33solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A93.369e-14841.41solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A93.369e-14841.41solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A96.437e-14841.41solute carrier family 6 member 9 [Source:HGNC Symb... [more]
back to top
BLAST of slc6a-6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dat-13.861e-12440.22Sodium-dependent dopamine transporter [Source:Uni... [more]
mod-52.454e-11637.92Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7][more]
snf-32.166e-10436.08Sodium- and chloride-dependent betaine transporter... [more]
snf-111.360e-9934.82Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43][more]
snf-63.632e-8531.85Sodium-dependent acetylcholine transporter [Sourc... [more]
back to top
BLAST of slc6a-6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GlyT3.930e-13643.01gene:FBgn0034911 transcript:FBtr0301162[more]
SerT2.373e-12839.62gene:FBgn0010414 transcript:FBtr0072362[more]
SerT2.373e-12839.62gene:FBgn0010414 transcript:FBtr0343316[more]
Gat3.524e-12640.88gene:FBgn0039915 transcript:FBtr0089972[more]
DAT1.086e-12338.39gene:FBgn0034136 transcript:FBtr0330002[more]
back to top
BLAST of slc6a-6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a53.596e-15044.43solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a54.783e-15044.43solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a55.339e-15044.43solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a93.875e-14843.21solute carrier family 6 member 9 [Source:ZFIN;Acc:... [more]
slc6a94.147e-14843.21solute carrier family 6 member 9 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc6a-6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxd41.127e-16242.12MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
mxd41.230e-16242.68MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
mxd41.300e-16242.68MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
mxd41.362e-16242.68MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
mxd41.741e-16242.68MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of slc6a-6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc6a57.426e-15144.11solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a57.426e-15144.11solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a57.426e-15144.11solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a95.399e-14842.22solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a95.399e-14842.22solute carrier family 6 (neurotransmitter transpor... [more]
back to top
BLAST of slc6a-6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7Y2W8|SC6A9_XENLA2.257e-16041.76Sodium- and chloride-dependent glycine transporter... [more]
sp|Q761V0|SC6A5_MOUSE9.881e-15044.11Sodium- and chloride-dependent glycine transporter... [more]
sp|Q9Y345|SC6A5_HUMAN1.773e-14944.92Sodium- and chloride-dependent glycine transporter... [more]
sp|P58295|SC6A5_RAT2.815e-14943.95Sodium- and chloride-dependent glycine transporter... [more]
sp|Q28039|SC6A9_BOVIN6.959e-14841.80Sodium- and chloride-dependent glycine transporter... [more]
back to top
BLAST of slc6a-6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YIU50.000e+0100.00Transporter OS=Schmidtea mediterranea OX=79327 GN=... [more]
A0A0X3PE140.000e+052.68Transporter OS=Schistocephalus solidus OX=70667 GN... [more]
A0A5K3EUZ40.000e+052.07Uncharacterized protein OS=Mesocestoides corti OX=... [more]
G7Y7I20.000e+051.30Transporter OS=Clonorchis sinensis OX=79923 GN=CLF... [more]
W6UPQ20.000e+049.93Transporter OS=Echinococcus granulosus OX=6210 GN=... [more]
back to top
BLAST of slc6a-6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a91.819e-14843.40solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a92.805e-14843.40solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a31.161e-13940.95solute carrier family 6 member 3 [Source:NCBI gene... [more]
slc6a141.392e-13142.26solute carrier family 6 member 14 [Source:NCBI gen... [more]
slc6a1b2.745e-13041.18solute carrier family 6 member 1b [Source:ZFIN;Acc... [more]
back to top
BLAST of slc6a-6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a1a1.843e-12940.40solute carrier family 6 member 1a [Source:ZFIN;Acc... [more]
slc6a4b2.479e-11041.18solute carrier family 6 member 4b [Source:ZFIN;Acc... [more]
ENSPMAT00000008631.15.014e-8438.00pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 ... [more]
ENSPMAT00000001684.11.717e-7154.09pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 ge... [more]
ENSPMAT00000004857.11.090e-6840.87pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 ... [more]
back to top
BLAST of slc6a-6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc6a-6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO492187.468e-15546.03Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4][more]
EDO315452.035e-15045.18Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0][more]
EDO397073.774e-13842.14Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977][more]
EDO401514.497e-13041.73Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6][more]
EDO397083.964e-12843.83Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978][more]
back to top
BLAST of slc6a-6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a91.204e-14643.13solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a91.861e-14643.13solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a91.861e-14643.13solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a53.353e-14643.32solute carrier family 6 member 5 [Source:NCBI gene... [more]
slc6a21.428e-13739.77solute carrier family 6 member 2 [Source:NCBI gene... [more]
back to top
BLAST of slc6a-6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050382.10.000e+0100.00SMESG000050382.1[more]
SMESG000050382.10.000e+0100.00SMESG000050382.1[more]
SMESG000003011.10.000e+055.67SMESG000003011.1[more]
SMESG000009986.10.000e+053.66SMESG000009986.1[more]
SMESG000009987.10.000e+049.69SMESG000009987.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30026643
GenBankAKN21426.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026643 ID=SMED30026643|Name=slc6a-6|organism=Schmidtea mediterranea sexual|type=transcript|length=2418bp
TGCTTTATCGTAGTTGACCAATGAGGAATGACATCAAAAATTCCCTCAAA
GTAATATTGATTCATATCCAGAAAATTCAATACATTAACTATTGGAATTA
TGAATAAAGATTTAACGAGGATTGTTGTTGAAAATGAGATGAACAGTTCC
CCGATCGATTGTAAAATTGTCAACGAAGCCTTGAAATCTCTGGCTTTAGT
GGATAATAATTCCAGGCCGAAAGAATTGTTTCCAGAAATTGTTAAAGATT
CAAGTGGAGAAGAAATTCACATAACATATTCCAAACAAAGCACAGGTCCA
GATCGTCAAACTTGGGGTGGAAAGATTGAATTTCTTTGCTCATGTGTTGC
AATGGCAGTTGGGTTGGGAAATGTCTGGCGATTTCCTTATTTGTGTTATA
AAAATGGGGGTGGAGCTTTTCTCGTTCCTTATTTTTCCATGTTATTTCTA
GTTGGATTACCTTTATTTTTTATGGAGTTAGCATTTGGTCAATTTGCCAG
TCTCGGTCCAATCACTGTATGGTCAATCAGCCCATTATTTAAAGGTATTG
GATACGGAATGGTAATCGCATCTTTCATCTTGTCAACATATTACAATGTT
ATAATAGCTCAAAGTTTGTATTATTTATTCGCTAGTTTTAATACGGTTTT
GCCTTGGATGTTCTGTGATACAACTATCAAAAATAGTTCATGTTTTGATT
CAACTATGGATATATACAACTGGTCCTTAGCACATCCGAACAGCACAAAA
GTTAGTCCATCAGAACAATATTTTGAGAAAAATGTTTTAAATATATCCGG
AAGCATTTTGGACCTTGGGGCTCCACAGTGGAAACTTTGCTTGTGTTTGC
TCTTAGCTTGGATAGTCGTATTAGCTGTATTGTTGAAAGGAATAAATTCT
CTAGGAAAGGTCGCTTATTTTACGGCTATTTTTCCATACGTCATTCTATG
CATTCTTCTGATTAGAGGAAGTTTACTACCCGGAGCAATGCAAGGAATAA
TATTTTATATCAAACCGAGATTCGATCGAATAAGAGATTCCAAAGTATGG
ACAGATGCTGCGACACAGATATTCTTTTCTCTTTCCTGTTGTAATGGCAA
TCTGATAACAATGTCCAGTTATAACAATTTTAAGAACAATTGCTGCAGAG
ATGCAGTGTTTGTAGCAATTCTAAACTGTGCCACATCCATTTTTGCTGGA
TTTGTCATTTTCACAAATCTCGGCTTTATGGCTCACTTGAAAAATACAAC
AATTGATAATGTTGTCGACAAAGGTCCTGGGTTAGCTTTTGTAGTTTATC
CAGAAGCTTTGACGCATATGTTTATGGCCCCGTTATGGTCTATTTGTTTC
TTTTTGATGATGATCACTTTGGGATTTGGATCACAATTTGCAATTGTTGA
AACGGTCTTAGCTGGGATCCAAGACGAACTAAGAAGACTGAGATTGTTAA
AGTCGCAATTTCATGTCATAATATTTAGGGTCAGTATATGTATACTATGC
TTCCTGTTAGGTATTCCAATGACATGTCGAGGAGGAATGTATATACTCAA
TATGCTAGACTATGTTATCAGTGGATATGTTTTATTAGTGCTCGCACTGT
TGGAAATTATAGTTATTTGTTATTTCTATGGAATAAATAGATTCAGAAAA
GATATAGCTTTAATGACAACAAAAAGACCAAATTGGTACTGGAGGATTAT
GTGGATGTACATTTCTCCTGGAGTGATTTCATTGTTGATTATATTTTATT
TCGTGTCGGGGGACACTCTGAAATACGGTGATTTTTCATATCCTCAGTCA
TTTGTAACATTAACTCATTTTATTGCACTGTTTCCATTGATATTCGTTCC
CTCGGTGTTTATTTACAGATACTGCAAAGAGGGAGGATGGATCATATTGC
GTGAGGTAATAAAACCGAAGTCCGAATGGGGACCAGCGGATGAAGAGAAC
AGGCAAGTTTTTATTAGCAGCATAATGAGAATGGACGAACAATCAAATGC
AATCAGTGGAAGTAAGGAGGCGAAAATGCCTTCGCCGGATAATATGTCCA
CTCCGATTGGTGACTCGTTTTTCCAAAGCAAAAGGAGTCTGCTTTCTAAA
TTCAGTGAAGTAGCAGCGAAAGAGAATTCCAAGAATCCAAGCAATTAAAA
ATCGTAATGTTGTAGATTTGAGATGTAAAGTGAATGACATGAGTTCAGTG
ATCTTGTAGCCGATTTTTATAAGTTTAATTAGGCGATTTGTTATTTTTAT
GGTTATAGTTGTGGTGATTCAATATTTCTGCCGTTTCTCCAATAACAGAT
CTTTGACGGACAATTGTAATAATACGGAATGGAAAATATTTATGTAGTTA
TAATGTTATTAATAGTTATAGATAAATATGTTGCTATTTATAGTTGAATT
GTGCAATTATGATTCTCT
back to top

protein sequence of SMED30026643-orf-1

>SMED30026643-orf-1 ID=SMED30026643-orf-1|Name=SMED30026643-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=683bp
MNKDLTRIVVENEMNSSPIDCKIVNEALKSLALVDNNSRPKELFPEIVKD
SSGEEIHITYSKQSTGPDRQTWGGKIEFLCSCVAMAVGLGNVWRFPYLCY
KNGGGAFLVPYFSMLFLVGLPLFFMELAFGQFASLGPITVWSISPLFKGI
GYGMVIASFILSTYYNVIIAQSLYYLFASFNTVLPWMFCDTTIKNSSCFD
STMDIYNWSLAHPNSTKVSPSEQYFEKNVLNISGSILDLGAPQWKLCLCL
LLAWIVVLAVLLKGINSLGKVAYFTAIFPYVILCILLIRGSLLPGAMQGI
IFYIKPRFDRIRDSKVWTDAATQIFFSLSCCNGNLITMSSYNNFKNNCCR
DAVFVAILNCATSIFAGFVIFTNLGFMAHLKNTTIDNVVDKGPGLAFVVY
PEALTHMFMAPLWSICFFLMMITLGFGSQFAIVETVLAGIQDELRRLRLL
KSQFHVIIFRVSICILCFLLGIPMTCRGGMYILNMLDYVISGYVLLVLAL
LEIIVICYFYGINRFRKDIALMTTKRPNWYWRIMWMYISPGVISLLIIFY
FVSGDTLKYGDFSYPQSFVTLTHFIALFPLIFVPSVFIYRYCKEGGWIIL
REVIKPKSEWGPADEENRQVFISSIMRMDEQSNAISGSKEAKMPSPDNMS
TPIGDSFFQSKRSLLSKFSEVAAKENSKNPSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR037272SNS_sf
IPR000175Na/ntran_symport
Vocabulary: molecular function
TermDefinition
GO:0005328neurotransmitter:sodium symporter activity
GO:0015293symporter activity
Vocabulary: biological process
TermDefinition
GO:0006836neurotransmitter transport
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000175Sodium:neurotransmitter symporterPRINTSPR00176NANEUSMPORTcoord: 271..288
score: 58.38
coord: 492..512
score: 36.77
coord: 353..373
score: 44.26
coord: 149..175
score: 43.05
coord: 532..552
score: 25.92
coord: 77..98
score: 67.29
coord: 407..426
score: 46.23
coord: 106..125
score: 53.77
IPR000175Sodium:neurotransmitter symporterPFAMPF00209SNFcoord: 69..593
e-value: 1.4E-187
score: 624.6
IPR000175Sodium:neurotransmitter symporterPANTHERPTHR11616SODIUM/CHLORIDE DEPENDENT TRANSPORTERcoord: 61..636
IPR000175Sodium:neurotransmitter symporterPROSITEPS00610NA_NEUROTRAN_SYMP_1coord: 93..107
IPR000175Sodium:neurotransmitter symporterPROSITEPS50267NA_NEUROTRAN_SYMP_3coord: 68..596
score: 93.974
NoneNo IPR availablePANTHERPTHR11616:SF231SODIUM-DEPENDENT PROLINE TRANSPORTERcoord: 61..636
NoneNo IPR availableTMHMMTMhelixcoord: 355..377
NoneNo IPR availableTMHMMTMhelixcoord: 271..293
NoneNo IPR availableTMHMMTMhelixcoord: 410..432
NoneNo IPR availableTMHMMTMhelixcoord: 167..189
NoneNo IPR availableTMHMMTMhelixcoord: 103..125
NoneNo IPR availableTMHMMTMhelixcoord: 453..475
NoneNo IPR availableTMHMMTMhelixcoord: 240..262
NoneNo IPR availableTMHMMTMhelixcoord: 533..552
NoneNo IPR availableTMHMMTMhelixcoord: 140..162
NoneNo IPR availableTMHMMTMhelixcoord: 490..512
NoneNo IPR availableTMHMMTMhelixcoord: 567..589
NoneNo IPR availableTMHMMTMhelixcoord: 320..342
IPR037272Sodium:neurotransmitter symporter superfamilySUPERFAMILYSSF161070SNF-likecoord: 69..593