Short transient receptor potential channel 4

Overview
NameShort transient receptor potential channel 4
Smed IDSMED30026628
Length (bp)3375
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Short transient receptor potential channel 4 (SMED30026628) t-SNE clustered cells

Violin plots show distribution of expression levels for Short transient receptor potential channel 4 (SMED30026628) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Short transient receptor potential channel 4 (SMED30026628) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Short transient receptor potential channel 4 (SMED30026628) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026628

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026628SMESG000078533.1 SmedASXL_014057SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30026628SMESG000078533.1 dd_Smed_v4_20495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026628SMESG000078533.1 dd_Smed_v4_20495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026628SMESG000078533.1 dd_Smed_v4_20495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026628SMESG000078533.1 dd_Smed_v6_20495_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30026628SMESG000078533.1 SMED30026628smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30026628SMESG000078533.1 OX_Smed_1.0.22073ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Short transient receptor potential channel 4 vs. Ensembl Human
Match: TRPC4 (transient receptor potential cation channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:12336])

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 365/778 (46.92%), Postives = 506/778 (65.04%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFI-LILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARH---QIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKT 2669
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC D LGRTAL IAIENE+ E++ELLLS+N+ + D+LLHAI +E + AVE+LL       +K+    LL    + FT DITP+ILAAH +NY IIK+L+ +G ++P+PH++RC C ECV S   DSLRHSRSR+N Y+ALASPSLI LSS+DP LTAF+LSWEL  L  +ENEFK++YE L+ QC++FA DLL QTR S EL  ILN+     N++          E +    L+RLKLAIKY+QK FV  P+CQQLL+S WY+  PG RR  +  +     +I   FP  S+ Y+++PKS LG  +++PFIKF+CH  SY+ FL  L + +  ++          L+ +GPPP+I EW I+ ++ G+IW EIKQ++  GL+ Y+ D WNL+DF  N+LY A   L+I A+         +  R+ W+ + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y   +   CKG+                C  +   FS +FE +QSL+W+ FGLI+L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+FEEGGT P PFN+IPSPKS  Y I  I  H    C +   R K +S   + ++  +   RH   Q VM++L+KRY+    + A   +G+TE++  E+K DISSFRFE++ + + + + T
Sbjct:   25 AESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDD--NSL---------IEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHID-------RSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKY----SALNPRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGI---------------RCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLIKWIWTH---LCKKKMRR-KPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLST 761          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Human
Match: TRPC4 (transient receptor potential cation channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:12336])

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 365/778 (46.92%), Postives = 506/778 (65.04%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFI-LILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARH---QIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKT 2669
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC D LGRTAL IAIENE+ E++ELLLS+N+ + D+LLHAI +E + AVE+LL       +K+    LL    + FT DITP+ILAAH +NY IIK+L+ +G ++P+PH++RC C ECV S   DSLRHSRSR+N Y+ALASPSLI LSS+DP LTAF+LSWEL  L  +ENEFK++YE L+ QC++FA DLL QTR S EL  ILN+     N++          E +    L+RLKLAIKY+QK FV  P+CQQLL+S WY+  PG RR  +  +     +I   FP  S+ Y+++PKS LG  +++PFIKF+CH  SY+ FL  L + +  ++          L+ +GPPP+I EW I+ ++ G+IW EIKQ++  GL+ Y+ D WNL+DF  N+LY A   L+I A+         +  R+ W+ + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y   +   CKG+                C  +   FS +FE +QSL+W+ FGLI+L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+FEEGGT P PFN+IPSPKS  Y I  I  H    C +   R K +S   + ++  +   RH   Q VM++L+KRY+    + A   +G+TE++  E+K DISSFRFE++ + + + + T
Sbjct:   25 AESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDD--NSL---------IEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHID-------RSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKY----SALNPRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGI---------------RCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLIKWIWTH---LCKKKMRR-KPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLST 761          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Human
Match: TRPC4 (transient receptor potential cation channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:12336])

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 364/782 (46.55%), Postives = 504/782 (64.45%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFI-LILKHCLFCCSESHNRSKWK----SIRKLVKKVNEKEARH---QIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKT 2669
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC D LGRTAL IAIENE+ E++ELLLS+N+ + D+LLHAI +E + AVE+LL       +K+    LL    + FT DITP+ILAAH +NY IIK+L+ +G ++P+PH++RC C ECV S   DSLRHSRSR+N Y+ALASPSLI LSS+DP LTAF+LSWEL  L  +ENEFK++YE L+ QC++FA DLL QTR S EL  ILN+     N++          E +    L+RLKLAIKY+QK FV  P+CQQLL+S WY+  PG RR  +  +     +I   FP  S+ Y+++PKS LG  +++PFIKF+CH  SY+ FL  L + +  ++          L+ +GPPP+I EW I+ ++ G+IW EIKQ++  GL+ Y+ D WNL+DF  N+LY A   L+I A+         +  R+ W+ + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y   +   CKG+                C  +   FS +FE +QSL+W+ FGLI+L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+FEEGGT P PFN+IPSPKS  Y I  I  H    C +   R         +R   ++  +   RH   Q VM++L+KRY+    + A   +G+TE++  E+K DISSFRFE++ + + + + T
Sbjct:   25 AESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDD--NSL---------IEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHID-------RSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKY----SALNPRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGI---------------RCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLIKWIWTH---LCKKKMRRKPESFGTIGVRTQHRRAADNLRRHHQYQEVMRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLST 766          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Human
Match: TRPC5 (transient receptor potential cation channel subfamily C member 5 [Source:HGNC Symbol;Acc:HGNC:12337])

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 351/783 (44.83%), Postives = 504/783 (64.37%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNH--DHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQ---RQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNE---KEARHQIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTP 2672
             E ELS +E+ +L +VE+GD   VK  L     Y  +NINC D LGR+AL IAIENE+ E++ELLL++++ + D+LL+AI +E + AVE+LL+      +K+    ++    + FT DITP++LAAH +NY IIK+L+ +  TIP+PH +RC C ECV S + DSLRHSRSR+N Y+ALASPSLI LSS+DPILTAF L WEL  L  +ENEFK +YE L++QC+ FA DLL Q R S EL  ILNH  DH             E  + ++   L++LK+AIKY QK FV  P+CQQLL++LWY+G PG RR  ++ +      I   FP +S+ Y++SP+S LG  +K+PFIKF+CH  SY+ FL  L + +  +           L  +GPPP++ EW I+ ++ G+IW EIK+++  G   Y+ D WNL+DF+ N+LY A   L+I AY     S      R+ WE + P LI+E LFA +NILS ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y  +       CKG+                C  +   FS +FE +QSL+W+ FGL++L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+F+EGGT P PFNIIPSPKS  Y      +      +   R + +++R   ++  +   +   +Q V+++L+KRY+    + +  ++G+TE++  E+K DISSFR+E++++  + N K P
Sbjct:   25 AETELSAEEKAFLNAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRRPSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHS------------EELDPQKYHDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFICHTASYLTFLFMLLLASQHI-------VRTDLHVQGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSRP----REEWEMWHPTLIAEALFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRAIDEPNNCKGI---------------RCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFLYLGNWFNNTFCPKRDPDGRRRRRNLRSFTERNADSLIQNQHYQEVIRNLVKRYVAAMIRNSKTHEGLTEENFKELKQDISSFRYEVLDL--LGNRKHP 767          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Human
Match: TRPC4 (transient receptor potential cation channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:12336])

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 350/735 (47.62%), Postives = 479/735 (65.17%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFI-LILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARH---QIVMKDLIKRYL 2543
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC D LGRTAL IAIENE+ E++ELLLS+N+ + D+LLHAI +E + AVE+LL       +K+    LL    + FT DITP+ILAAH +NY IIK+L+ +G ++P+PH++RC C ECV S   DSLRHSRSR+N Y+ALASPSLI LSS+DP LTAF+LSWEL  L  +ENEFK++YE L+ QC++FA DLL QTR S EL  ILN+     N++          E +    L+RLKLAIKY+QK FV  P+CQQLL+S WY+  PG RR  +  +     +I   FP  S+ Y+++PKS LG  +++PFIKF+CH  SY+ FL  L + +  ++          L+ +GPPP+I EW I+ ++ G+IW EIKQ++  GL+ Y+ D WNL+DF  N+LY A   L+I A+         +  R+ W+ + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y   +   CKG+                C  +   FS +FE +QSL+W+ FGLI+L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+FEEGGT P PFN+IPSPKS  Y I  I  H    C +   R K +S   + ++  +   RH   Q VM++L+KRY+
Sbjct:   25 AESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDD--NSL---------IEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHID-------RSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKY----SALNPRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGI---------------RCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLIKWIWTH---LCKKKMRR-KPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYV 718          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Celegans
Match: trp-2 (TRP (Transient receptor potential) channel family; TRP homlogous cation channel protein [Source:UniProtKB/TrEMBL;Acc:G5EE02])

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 352/757 (46.50%), Postives = 496/757 (65.52%), Query Frame = 3
Query:  330 EKSGISSNTEEELSDD----ERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPK---KKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMK---VEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDST--------DRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEAC---------KGVVFTYSITGQEL-ERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIR--KLVKKVNEKEARHQ 2510
            +   +S+N     SD+    E+++LLS ERGD   V+ +L   +    NINC D LGR AL IAIENE+ EM+ELLL +N+E  D++L+AI EEN+EAVEI++  +    K   ++  +++  +S  AFT DITP++LAAH+DNY  IK+ LD+  T+P PHD+RC+C EC  +++EDSLR SRSRINAYRAL SPSLICLS++DPIL AFELSWEL RL  +ENEF+TDYE L+++CQKF   +L Q RGS EL  +LNH     + ++       SA       L+RLKLAI+  QK FV HP+CQQLL  +WYEG+  +R   FI++     L   SFP  S+ Y+L+P S +G   K+PFIKFL H GSY+ FL+ L + + +   ++ IL  + V+R   RGPPP+I E AI +++ G IW EIKQL+  GL  Y  ++WN+LDF TN+LY     LR+ AY  ++            R + R+ W+A++P L+SEC FA ANI S +KLV +FT++P LGPL+ISLGRM+ DI+ FF +Y LVL A+A G++QLLW+Y+  RQ  C         K + + Y    +   ++Y+ C       S+I+   ++L+W  FGL+DLT+  L+ DH  +E+ GK + GSYC  SII+LLNM IAMM+ SYQ I++++D EWKFARS+L++ +F++  T P PFNI+PSPKS  Y +  L   L  C++    SK KS+R  K+++ VN++E  ++
Sbjct:   14 DDDDVSNNVTWTESDNSRLREKQFLLSCERGDIGSVRKLLAGISTETFNINCLDPLGRNALLIAIENENIEMIELLLDHNIETGDAILYAIGEENVEAVEIIVEHLEKMDKFDSERQGVEITEHS--AFTPDITPIVLAAHKDNYECIKLFLDKKGTVPHPHDVRCSCPECYVAREEDSLRLSRSRINAYRALTSPSLICLSARDPILYAFELSWELKRLSFIENEFRTDYEELSQKCQKFCVHMLDQVRGSKELEVVLNHTTNAWHDVT-------SANYGNPEKLARLKLAIQLSQKRFVAHPNCQQLLLDIWYEGVESVRCTNFIYKLIFYILGMLSFPLFSLVYLLAPHSSMGQFAKKPFIKFLSHSGSYIFFLILLIMASQRMNVIDNILRTDDVDRKETRGPPPTIIECAIFLWVLGLIWVEIKQLWECGLYNYCRNLWNILDFITNSLYLCTTALRVVAYVQVEQEALRANSVHIARHLPRRDWDAWDPTLLSECFFATANIFSSLKLVHIFTVSPHLGPLKISLGRMVIDIVKFFMVYALVLFAFACGLNQLLWYYASMRQNECNLYEQYKNEKSLSYKYEHLKESCDDKYKSC-------SSIYHTAETLFWALFGLVDLTHFRLKEDHFLSEWTGKTIFGSYCCCSIIVLLNMLIAMMSNSYQYISDQADIEWKFARSRLFLEYFDDTATLPPPFNIVPSPKSIYYCLHYLTKKLCNCTKLQQPSKQKSMRNQKILRSVNDRENNYR 754          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Celegans
Match: trp-2 (TRP (Transient receptor potential) channel family; TRP homlogous cation channel protein [Source:UniProtKB/TrEMBL;Acc:G5EE02])

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 348/741 (46.96%), Postives = 485/741 (65.45%), Query Frame = 3
Query:  330 EKSGISSNTEEELSDD----ERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPK---KKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMK---VEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDST--------DRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEAC---------KGVVFTYSITGQEL-ERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIR 2468
            +   +S+N     SD+    E+++LLS ERGD   V+ +L   +    NINC D LGR AL IAIENE+ EM+ELLL +N+E  D++L+AI EEN+EAVEI++  +    K   ++  +++  +S  AFT DITP++LAAH+DNY  IK+ LD+  T+P PHD+RC+C EC  +++EDSLR SRSRINAYRAL SPSLICLS++DPIL AFELSWEL RL  +ENEF+TDYE L+++CQKF   +L Q RGS EL  +LNH     + ++       SA       L+RLKLAI+  QK FV HP+CQQLL  +WYEG+  +R   FI++     L   SFP  S+ Y+L+P S +G   K+PFIKFL H GSY+ FL+ L + + +   ++ IL  + V+R   RGPPP+I E AI +++ G IW EIKQL+  GL  Y  ++WN+LDF TN+LY     LR+ AY  ++            R + R+ W+A++P L+SEC FA ANI S +KLV +FT++P LGPL+ISLGRM+ DI+ FF +Y LVL A+A G++QLLW+Y+  RQ  C         K + + Y    +   ++Y+ C       S+I+   ++L+W  FGL+DLT+  L+ DH  +E+ GK + GSYC  SII+LLNM IAMM+ SYQ I++++D EWKFARS+L++ +F++  T P PFNI+PSPKS  Y +  L   L  C++    SK KS+R
Sbjct:   14 DDDDVSNNVTWTESDNSRLREKQFLLSCERGDIGSVRKLLAGISTETFNINCLDPLGRNALLIAIENENIEMIELLLDHNIETGDAILYAIGEENVEAVEIIVEHLEKMDKFDSERQGVEITEHS--AFTPDITPIVLAAHKDNYECIKLFLDKKGTVPHPHDVRCSCPECYVAREEDSLRLSRSRINAYRALTSPSLICLSARDPILYAFELSWELKRLSFIENEFRTDYEELSQKCQKFCVHMLDQVRGSKELEVVLNHTTNAWHDVT-------SANYGNPEKLARLKLAIQLSQKRFVAHPNCQQLLLDIWYEGVESVRCTNFIYKLIFYILGMLSFPLFSLVYLLAPHSSMGQFAKKPFIKFLSHSGSYIFFLILLIMASQRMNVIDNILRTDDVDRKETRGPPPTIIECAIFLWVLGLIWVEIKQLWECGLYNYCRNLWNILDFITNSLYLCTTALRVVAYVQVEQEALRANSVHIARHLPRRDWDAWDPTLLSECFFATANIFSSLKLVHIFTVSPHLGPLKISLGRMVIDIVKFFMVYALVLFAFACGLNQLLWYYASMRQNECNLYEQYKNEKSLSYKYEHLKESCDDKYKSC-------SSIYHTAETLFWALFGLVDLTHFRLKEDHFLSEWTGKTIFGSYCCCSIIVLLNMLIAMMSNSYQYISDQADIEWKFARSRLFLEYFDDTATLPPPFNIVPSPKSIYYCLHYLTKKLCNCTKLQQPSKQKSMR 738          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Celegans
Match: trp-1 (Transient-receptor-potential-like protein [Source:UniProtKB/Swiss-Prot;Acc:P34586])

HSP 1 Score: 519.235 bits (1336), Expect = 2.196e-166
Identity = 310/848 (36.56%), Postives = 480/848 (56.60%), Query Frame = 3
Query:  306 NFDIQTGLEKSGISSNTEEELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSY-NLEIADSLLHAISEENIEAVEILLT-AMATRPKKKD----LLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNY--VERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAY--FNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCC--------SESHNRSKWKSIRK--LVKKVNEKEAR------------HQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAY--TTLRNVTKLRHKGSKKGFNRIMR 2747
            N+ +      + +   T + +S +ER++L + E G+ P ++  LD      LN+NC DS+GRTAL IA++NE+ E++ELLL   ++ I ++LL AI E     VE+L+     TR    D     LD    +S  ++SDI+P+ILAA  + + I+++L+ +  +I KPH   C C  C + +  DSL++S  RIN +RALASP+ + L+S DPIL+AF+LSW+L RL   E+EFK  Y  L+EQC++++ DLL+Q R S E+  ILN D G VN  +I             ++LSRLKLAIKY+QK+FV HPHCQQLL+S+WYEG+P  +R        +   +   +P   + YIL PKS+LG +++ PF+KF  +  S+  FL  LT    +      G    + R SDRGPP +  E  +  ++ G +W EIKQL+  G + Y+   WN LDF    LY     +R++AY  F  ++   R   R YW + EP+L++E LFA  N+ S  +++++F  NP LGPLQISLG ML D+  F  ++VL++ +++ G+ QL W+Y         G                 C      FS+I +   +L W+ F +    + ++  +H+ T+++G+ M   Y   SII+LLNM IAMM+ S+QII + +D EWKF R++LW++ F+EG + P PFNII +PKS  Y +    +CLF          +   NR++  +IR+    +K NE E              +  ++  L+ R++ Q +K  +  GV EDDL+EIK DISS R+EL +  +   +++ ++     R++ +     S++ +   MR
Sbjct:   26 NYALANIPPPAAVHIRTNDMISPEERRFLEAAELGNKPTLQECLDYDGDRRLNVNCLDSMGRTALEIAVDNENMEVVELLLQQPDIRIGNALLCAIREGVYRLVEVLVNHPNITREMLGDGWSQALDPSEAASAEYSSDISPVILAAQLNQFEILQMLIRKDASIEKPHRHSCICETCDRERLNDSLQYSLKRINTFRALASPAWMSLTSPDPILSAFKLSWDLQRLAFEEHEFKETYLQLSEQCKQYSCDLLSQCRSSEEVIAILNKD-GNVNDDNIDVW-------ASKLSLSRLKLAIKYEQKAFVSHPHCQQLLTSIWYEGIPYRQRSGTWANFFLYAFLLFLWPIFCLMYILMPKSRLGRLVRSPFMKFFYYSVSFATFLGLLTWATFEDYRYEKGERGGMTRASDRGPPATWVESLVFTWVIGMLWSEIKQLWEEGFKRYMRQWWNWLDFLMICLYLCTISIRLSAYYIFTYREDPYRYTVRTYWTSEEPMLVAEALFAVGNVFSFARIIYLFQTNPYLGPLQISLGCMLVDVAKFCFIFVLIISSFSIGLAQLYWYYDPNTDVCLPGAT---------------CKHSSNVFSSIADSYLTLLWSLFSITKPEDTDVVENHKITQWVGQGMFIMYHCTSIIVLLNMLIAMMSHSFQIINDHADLEWKFHRTKLWMAHFDEGSSLPPPFNIIVTPKSLIYVM----NCLFNTVRWLLGKYTYQKNRNR-ATIRRPGYSRKRNEMEKSGGHDDDSLKPLTYADIITRLVARFIHQTKKDMKMDGVNEDDLHEIKQDISSLRYELRDDRRREIVRSSSHIDAVKRDIMRTMSTTSRRPYGGSMR 845          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Celegans
Match: trp-1 (Transient-receptor-potential-like protein [Source:UniProtKB/Swiss-Prot;Acc:P34586])

HSP 1 Score: 512.301 bits (1318), Expect = 1.644e-163
Identity = 307/828 (37.08%), Postives = 472/828 (57.00%), Query Frame = 3
Query:  366 LSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSY-NLEIADSLLHAISEENIEAVEILLT-AMATRPKKKD----LLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNY--VERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAY--FNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCC--------SESHNRSKWKSIRK--LVKKVNEKEAR------------HQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAY--TTLRNVTKLRHKGSKKGFNRIMR 2747
            LS++  ++L + E G+ P ++  LD      LN+NC DS+GRTAL IA++NE+ E++ELLL   ++ I ++LL AI E     VE+L+     TR    D     LD    +S  ++SDI+P+ILAA  + + I+++L+ +  +I KPH   C C  C + +  DSL++S  RIN +RALASP+ + L+S DPIL+AF+LSW+L RL   E+EFK  Y  L+EQC++++ DLL+Q R S E+  ILN D G VN  +I             ++LSRLKLAIKY+QK+FV HPHCQQLL+S+WYEG+P  +R        +   +   +P   + YIL PKS+LG +++ PF+KF  +  S+  FL  LT    +      G    + R SDRGPP +  E  +  ++ G +W EIKQL+  G + Y+   WN LDF    LY     +R++AY  F  ++   R   R YW + EP+L++E LFA  N+ S  +++++F  NP LGPLQISLG ML D+  F  ++VL++ +++ G+ QL W+Y         G                 C      FS+I +   +L W+ F +    + ++  +H+ T+++G+ M   Y   SII+LLNM IAMM+ S+QII + +D EWKF R++LW++ F+EG + P PFNII +PKS  Y +    +CLF          +   NR++  +IR+    +K NE E              +  ++  L+ R++ Q +K  +  GV EDDL+EIK DISS R+EL +  +   +++ ++     R++ +     S++ +   MR
Sbjct:   66 LSNNLFRFLEAAELGNKPTLQECLDYDGDRRLNVNCLDSMGRTALEIAVDNENMEVVELLLQQPDIRIGNALLCAIREGVYRLVEVLVNHPNITREMLGDGWSQALDPSEAASAEYSSDISPVILAAQLNQFEILQMLIRKDASIEKPHRHSCICETCDRERLNDSLQYSLKRINTFRALASPAWMSLTSPDPILSAFKLSWDLQRLAFEEHEFKETYLQLSEQCKQYSCDLLSQCRSSEEVIAILNKD-GNVNDDNIDVW-------ASKLSLSRLKLAIKYEQKAFVSHPHCQQLLTSIWYEGIPYRQRSGTWANFFLYAFLLFLWPIFCLMYILMPKSRLGRLVRSPFMKFFYYSVSFATFLGLLTWATFEDYRYEKGERGGMTRASDRGPPATWVESLVFTWVIGMLWSEIKQLWEEGFKRYMRQWWNWLDFLMICLYLCTISIRLSAYYIFTYREDPYRYTVRTYWTSEEPMLVAEALFAVGNVFSFARIIYLFQTNPYLGPLQISLGCMLVDVAKFCFIFVLIISSFSIGLAQLYWYYDPNTDVCLPGAT---------------CKHSSNVFSSIADSYLTLLWSLFSITKPEDTDVVENHKITQWVGQGMFIMYHCTSIIVLLNMLIAMMSHSFQIINDHADLEWKFHRTKLWMAHFDEGSSLPPPFNIIVTPKSLIYVM----NCLFNTVRWLLGKYTYQKNRNR-ATIRRPGYSRKRNEMEKSGGHDDDSLKPLTYADIITRLVARFIHQTKKDMKMDGVNEDDLHEIKQDISSLRYELRDDRRREIVRSSSHIDAVKRDIMRTMSTTSRRPYGGSMR 865          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Celegans
Match: spe-41 (TRP homologous cation channel protein; TRP-3 channel protein [Source:UniProtKB/TrEMBL;Acc:G5EF09])

HSP 1 Score: 113.235 bits (282), Expect = 3.502e-25
Identity = 132/629 (20.99%), Postives = 266/629 (42.29%), Query Frame = 3
Query:  576 LLHAISEENIEAVEILLTAMATRPKKKDLLDLL--------GNSSNA--FTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSR-INAYRALASPSLICLSSKDPILTAFELSWELNRLGILEN-EFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSL----WYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIW----QEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTD-RMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFG---------LIDLTNLNLE-YDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNII 2369
            L+   SEE+++   +L  A+ +RP  + +L L           S+N+  F   +TPL+LA   +N+ I++ L+ RG  I  PH + C C  C   ++E    HS +R ++  RAL+S + + L++ D       ++ +L +L   +  E+   Y  L    Q+F   +       S+ A  ++  +  V   +  P RM    S       RL++A+  + + F    + Q  + S+    WY      +R  +    A     C   P + M +   P    G+ +  P  +F+ H   Y++FL+   +      +  + + +E          ++  A+ I++  Y+     ++    Y  G   + A  W   D +          +  T  +  +++ D   ++R +W ++E  L+ E   A A +LS++K  +   +   +G   IS+G+ +     +  + V ++V+++ G++ ++  Y ++          T  I  Q+     Y  T   Y   I    ++L+W+ FG         ++  T  N++   H       +++   Y  I II +LN+  +++      + +  + E+KF R+ ++  F       P P N+I
Sbjct:   91 LMDTSSEESLKEALLLSIAVGSRPLVEFVLVLFVDAPYLERSGSANSPHFPPHMTPLMLACILNNFSIVQCLITRGHCIQIPHFITCECKTC---KRETVTTHSSTRLVDVMRALSSEAYLWLATDDVFAATCAVARDLQQLASDDQLEYVETYRDLEMNVQRFLCRI-------SDQAWRVDEFNMMVANRNYCPERMTEISS------PRLQMAMDSQMRQFTCSTNSQTTIKSVFRSDWYNYGIKPKRDAWRFLRA-----CILMPFLVMLHAFMPTK--GTTMCVPLARFIAHITMYLVFLIAAILRPTIGFYFAWTDSIE----------VTVQALEIFMYAYVMGLALEKGILFYRVGRDGFFAFWWRWFD-AALIFIFLFSLIFFTGKWGKREAFDPSSVDRMHWPSFEFSLLHEICLAIACVLSILKCFYYAQMMKSIGGSVISVGKCVGKTYTYILIMVAIIVSFSVGLNIIVDPYLNRS---------TMKIGDQD-----YTKTTDSY-ETIGTSSKNLFWSIFGYLGPSTFTTVVGNTGPNMDPVKHTLNSSTFEILAAVYHGILIITVLNLMTSILVKGADEVLDNEEMEFKFTRAAIYSEFLSWEMAAPPPLNLI 670          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0335144)

HSP 1 Score: 767.689 bits (1981), Expect = 0.000e+0
Identity = 400/814 (49.14%), Postives = 545/814 (66.95%), Query Frame = 3
Query:  363 ELSDDERKYLLSVERGDAPYVKSILDN-KNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTA--MATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFG----------NYVERL-SDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMK-----DSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKT--PAYTTLRNVTKLRHKGSK--KGFN 2735
            +L+ +E+K+LL+VERGD    + +L   ++   +N+NC D LGRTAL +AI+NE+ EM+ELL++YN++  D+LLH+ISEE +EAVE+LL    +    +     +     ++ FT DITPLILAAHRDNY IIKILLDRG  +P PHD+RC C ECV+S++EDSLRHSRSRINAYRALASPSLI LSSKDPILTAFELSWEL RL  LE+EFK +Y+ L +QCQ FAT LL  TR S EL  +LNHD          P+     E  E M L+RLKLAIK +QK FV H + QQLL+S+WYEGLPG RR     Q+  I  I   FP  S+ YIL+P S +G  +++PFIKF+CH  SY  FL  L + + ++E  + G          N +E L + RG  P+  EW I+ +++G IW E+KQL+  GL+ YL DMWN++DF TN+LY A   LR+ ++F ++     +S    + R+ W+A++P+LISE LF+AANI S +KLV++F++NP LGPLQ+SL RM+ DI+ FF +YVLVL A+  G++QLLW+Y+   ++ C  V    ++               R FSN+FE  Q+L+W  FGLIDL +  L+    FT F G LM G+Y  I+I++LLN+ IAMMN SYQ+I+E++D EWKFARS+LWIS+FEEGGT P PFNIIP+PKS  Y I  ++      S +  R   K+IR+  ++ ++++ ++Q +M++L++RY+   Q+  E+QGVTEDD+NEIK DIS+FR EL+EI K + M T   A        K R K  +  KGFN
Sbjct:   77 QLTLEEKKFLLAVERGDMAGTRRMLQKAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLINYNVDTKDALLHSISEEFVEAVEVLLDHENVTFHSEGNHSWESASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTRTSHELEILLNHD-------PTGPVY----EHGERMHLNRLKLAIKLRQKKFVAHSNVQQLLASIWYEGLPGFRRKNMALQAVDIIRIGIMFPIFSLAYILAPYSSIGQTMRKPFIKFICHSASYFTFLFLLMLASQRIETFIGGWFFADSSGMLNTMEELPTKRGAKPTFIEWLILAWVSGLIWSEVKQLWDVGLQEYLNDMWNVIDFVTNSLYVATVALRVVSFFQVQKEMIYNSHATDLPRERWDAWDPMLISEGLFSAANIFSSLKLVYIFSVNPHLGPLQVSLSRMVMDIMKFFFLYVLVLFAFGSGLNQLLWYYADLEKKRCPEVSPMSALLNMNGTNDPNACIVWRRFSNLFETTQTLFWAVFGLIDLDSFELDGIKIFTRFWGMLMFGTYSVINIVVLLNLLIAMMNHSYQLISERADVEWKFARSKLWISYFEEGGTCPPPFNIIPTPKSIWYAIKWMRRVFCSGSSAARREHLKTIRRKAQQASDRDFKYQQIMRNLVRRYVTVEQRKAESQGVTEDDVNEIKQDISAFRCELVEILKNSGMDTNVTAGQGGGGGKKNRQKERRLMKGFN 879          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0080945)

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 399/822 (48.54%), Postives = 549/822 (66.79%), Query Frame = 3
Query:  363 ELSDDERKYLLSVERGDAPYVKSILDN-KNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTA--MATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFG----------NYVERL-SDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMK-----DSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRHKGSKKGFNRIMRKTNL--PG 2765
            +L+ +E+K+LL+VERGD    + +L   ++   +N+NC D LGRTAL +AI+NE+ EM+ELL++YN++  D+LLH+ISEE +EAVE+LL    +    +     +     ++ FT DITPLILAAHRDNY IIKILLDRG  +P PHD+RC C ECV+S++EDSLRHSRSRINAYRALASPSLI LSSKDPILTAFELSWEL RL  LE+EFK +Y+ L +QCQ FAT LL  TR S EL  +LNHD          P+     E  E M L+RLKLAIK +QK FV H + QQLL+S+WYEGLPG RR     Q+  I  I   FP  S+ YIL+P S +G  +++PFIKF+CH  SY  FL  L + + ++E  + G          N +E L + RG  P+  EW I+ +++G IW E+KQL+  GL+ YL DMWN++DF TN+LY A   LR+ ++F ++     +S    + R+ W+A++P+LISE LF+AANI S +KLV++F++NP LGPLQ+SL RM+ DI+ FF +YVLVL A+  G++QLLW+Y+   ++ C  V    ++               R FSN+FE  Q+L+W  FGLIDL +  L+    FT F G LM G+Y  I+I++LLN+ IAMMN SYQ+I+E++D EWKFARS+LWIS+FEEGGT P PFNIIP+PKS  Y I  ++      S +  R   K+IR+  ++ ++++ ++Q +M++L++RY+   Q+  E+QGVTEDD+NEIK DIS+FR EL+EI K + M T    T         K +++   R+M+  N+  PG
Sbjct:   16 QLTLEEKKFLLAVERGDMAGTRRMLQKAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLINYNVDTKDALLHSISEEFVEAVEVLLDHENVTFHSEGNHSWESASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTRTSHELEILLNHD-------PTGPVY----EHGERMHLNRLKLAIKLRQKKFVAHSNVQQLLASIWYEGLPGFRRKNMALQAVDIIRIGIMFPIFSLAYILAPYSSIGQTMRKPFIKFICHSASYFTFLFLLMLASQRIETFIGGWFFADSSGMLNTMEELPTKRGAKPTFIEWLILAWVSGLIWSEVKQLWDVGLQEYLNDMWNVIDFVTNSLYVATVALRVVSFFQVQKEMIYNSHATDLPRERWDAWDPMLISEGLFSAANIFSSLKLVYIFSVNPHLGPLQVSLSRMVMDIMKFFFLYVLVLFAFGSGLNQLLWYYADLEKKRCPEVSPMSALLNMNGTNDPNACIVWRRFSNLFETTQTLFWAVFGLIDLDSFELDGIKIFTRFWGMLMFGTYSVINIVVLLNLLIAMMNHSYQLISERADVEWKFARSKLWISYFEEGGTCPPPFNIIPTPKSIWYAIKWMRRVFCSGSSAARREHLKTIRRKAQQASDRDFKYQQIMRNLVRRYVTVEQRKAESQGVTEDDVNEIKQDISAFRCELVEILKNSGMDT--NVTAGQGGGGGGKKNRQKERRLMKGFNIAPPG 824          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0080946)

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 399/822 (48.54%), Postives = 549/822 (66.79%), Query Frame = 3
Query:  363 ELSDDERKYLLSVERGDAPYVKSILDN-KNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTA--MATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFG----------NYVERL-SDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMK-----DSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRHKGSKKGFNRIMRKTNL--PG 2765
            +L+ +E+K+LL+VERGD    + +L   ++   +N+NC D LGRTAL +AI+NE+ EM+ELL++YN++  D+LLH+ISEE +EAVE+LL    +    +     +     ++ FT DITPLILAAHRDNY IIKILLDRG  +P PHD+RC C ECV+S++EDSLRHSRSRINAYRALASPSLI LSSKDPILTAFELSWEL RL  LE+EFK +Y+ L +QCQ FAT LL  TR S EL  +LNHD          P+     E  E M L+RLKLAIK +QK FV H + QQLL+S+WYEGLPG RR     Q+  I  I   FP  S+ YIL+P S +G  +++PFIKF+CH  SY  FL  L + + ++E  + G          N +E L + RG  P+  EW I+ +++G IW E+KQL+  GL+ YL DMWN++DF TN+LY A   LR+ ++F ++     +S    + R+ W+A++P+LISE LF+AANI S +KLV++F++NP LGPLQ+SL RM+ DI+ FF +YVLVL A+  G++QLLW+Y+   ++ C  V    ++               R FSN+FE  Q+L+W  FGLIDL +  L+    FT F G LM G+Y  I+I++LLN+ IAMMN SYQ+I+E++D EWKFARS+LWIS+FEEGGT P PFNIIP+PKS  Y I  ++      S +  R   K+IR+  ++ ++++ ++Q +M++L++RY+   Q+  E+QGVTEDD+NEIK DIS+FR EL+EI K + M T    T         K +++   R+M+  N+  PG
Sbjct:   16 QLTLEEKKFLLAVERGDMAGTRRMLQKAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLINYNVDTKDALLHSISEEFVEAVEVLLDHENVTFHSEGNHSWESASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTRTSHELEILLNHD-------PTGPVY----EHGERMHLNRLKLAIKLRQKKFVAHSNVQQLLASIWYEGLPGFRRKNMALQAVDIIRIGIMFPIFSLAYILAPYSSIGQTMRKPFIKFICHSASYFTFLFLLMLASQRIETFIGGWFFADSSGMLNTMEELPTKRGAKPTFIEWLILAWVSGLIWSEVKQLWDVGLQEYLNDMWNVIDFVTNSLYVATVALRVVSFFQVQKEMIYNSHATDLPRERWDAWDPMLISEGLFSAANIFSSLKLVYIFSVNPHLGPLQVSLSRMVMDIMKFFFLYVLVLFAFGSGLNQLLWYYADLEKKRCPEVSPMSALLNMNGTNDPNACIVWRRFSNLFETTQTLFWAVFGLIDLDSFELDGIKIFTRFWGMLMFGTYSVINIVVLLNLLIAMMNHSYQLISERADVEWKFARSKLWISYFEEGGTCPPPFNIIPTPKSIWYAIKWMRRVFCSGSSAARREHLKTIRRKAQQASDRDFKYQQIMRNLVRRYVTVEQRKAESQGVTEDDVNEIKQDISAFRCELVEILKNSGMDT--NVTAGQGGGGGGKKNRQKERRLMKGFNIAPPG 824          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Fly
Match: trpl (gene:FBgn0005614 transcript:FBtr0088471)

HSP 1 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 341/780 (43.72%), Postives = 495/780 (63.46%), Query Frame = 3
Query:  396 SVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMAT-----RPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKV--EFI-LFGNYV-------ERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNM-----KDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQY---CITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNM 2663
            +VERGD P V+ IL    ++  +NINC D LGR AL +AI+NE+ EM+ELL+   +E  D+LLHAI+ E +EAVE+LL           P     +D+   ++  F  DITPL+LAAH++N+ I++ILLDRG  +P PHD+RC C ECV+   EDSLRHS SR+N YRAL SPSLICL+S DPI+TAF+LSWEL  L + E E K++Y  L  QCQKFA DLL QTR S+ELA ILN+D            +M S E  + M+L+RL  AI YKQK FV H + QQLLSS+WY+GLPG RR   + +   I  +   FP   + Y+ +P  + G ++++PF+KFL H  SY+ FL  L + + +   +F+ +FG          + L  RG  PS  E  +++Y+ G++W+E++++++ G+++YL +MWN +DF  N+LY +   LR  AY        +D     I R+ W  ++P LI+E LFAAAN+ S +KLV +F+INP LGPLQISLGRM+ DI+ FF +Y LVL A+A G++QLLW+++   +  C      Y + G E +   +   C+ + R F N+FE  QSL+W +FG++ L +  L     +T F G LM GSY  I++I+LLN+ IAMM+ SY +I E SD EWKFAR++LW+S+FE+  T P PFN++P   S K+ I I +      S++ +R + K      +K  E+ + +  +M+ L+ RY+    +  EN  V+EDD+NE+K +I++ R+E++EIF+ + M
Sbjct:   48 AVERGDMPNVRRILQKALRHQHININCMDPLGRRALTLAIDNENLEMVELLVVMGVETKDALLHAINAEFVEAVELLLEHEELIYKEGEPYSWQKVDI---NTAMFAPDITPLMLAAHKNNFEILRILLDRGAAVPVPHDIRCGCEECVRLTAEDSLRHSLSRVNIYRALCSPSLICLTSNDPIITAFQLSWELRNLALTEQECKSEYMDLRRQCQKFAVDLLDQTRTSNELAIILNYDP-----------QMSSYEPGDRMSLTRLVQAISYKQKKFVAHSNIQQLLSSIWYDGLPGFRRKSIVDKVICIAQVAVLFPLYCLIYMCAPNCRTGQLMRKPFMKFLIHASSYLFFLFILILVSQRADDDFVRIFGTTRMKKELAEQELRQRGQTPSKLELIVVMYVIGFVWEEVQEIFAVGMKSYLRNMWNFIDFLRNSLYVSVMCLRAFAYIQQATEIARDPQMAYIPREKWHDFDPQLIAEGLFAAANVFSALKLVHLFSINPHLGPLQISLGRMVIDIVKFFFIYTLVLFAFACGLNQLLWYFAALEKSKC------YVLPGGEADWGSHGDSCM-KWRRFGNLFESSQSLFWASFGMVGLDDFELSGIKSYTRFWGLLMFGSYSVINVIVLLNLLIAMMSNSYAMIDEHSDTEWKFARTKLWMSYFEDSATLPPPFNVLP---SVKWVIRIFRK----SSKTIDRQRSKK-----RKEQEQFSEYDNIMRSLVWRYVAAMHRKFENNPVSEDDINEVKSEINTMRYEMLEIFENSGM 794          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Fly
Match: trpl (gene:FBgn0005614 transcript:FBtr0301662)

HSP 1 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 341/780 (43.72%), Postives = 495/780 (63.46%), Query Frame = 3
Query:  396 SVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMAT-----RPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKV--EFI-LFGNYV-------ERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNM-----KDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQY---CITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNM 2663
            +VERGD P V+ IL    ++  +NINC D LGR AL +AI+NE+ EM+ELL+   +E  D+LLHAI+ E +EAVE+LL           P     +D+   ++  F  DITPL+LAAH++N+ I++ILLDRG  +P PHD+RC C ECV+   EDSLRHS SR+N YRAL SPSLICL+S DPI+TAF+LSWEL  L + E E K++Y  L  QCQKFA DLL QTR S+ELA ILN+D            +M S E  + M+L+RL  AI YKQK FV H + QQLLSS+WY+GLPG RR   + +   I  +   FP   + Y+ +P  + G ++++PF+KFL H  SY+ FL  L + + +   +F+ +FG          + L  RG  PS  E  +++Y+ G++W+E++++++ G+++YL +MWN +DF  N+LY +   LR  AY        +D     I R+ W  ++P LI+E LFAAAN+ S +KLV +F+INP LGPLQISLGRM+ DI+ FF +Y LVL A+A G++QLLW+++   +  C      Y + G E +   +   C+ + R F N+FE  QSL+W +FG++ L +  L     +T F G LM GSY  I++I+LLN+ IAMM+ SY +I E SD EWKFAR++LW+S+FE+  T P PFN++P   S K+ I I +      S++ +R + K      +K  E+ + +  +M+ L+ RY+    +  EN  V+EDD+NE+K +I++ R+E++EIF+ + M
Sbjct:   48 AVERGDMPNVRRILQKALRHQHININCMDPLGRRALTLAIDNENLEMVELLVVMGVETKDALLHAINAEFVEAVELLLEHEELIYKEGEPYSWQKVDI---NTAMFAPDITPLMLAAHKNNFEILRILLDRGAAVPVPHDIRCGCEECVRLTAEDSLRHSLSRVNIYRALCSPSLICLTSNDPIITAFQLSWELRNLALTEQECKSEYMDLRRQCQKFAVDLLDQTRTSNELAIILNYDP-----------QMSSYEPGDRMSLTRLVQAISYKQKKFVAHSNIQQLLSSIWYDGLPGFRRKSIVDKVICIAQVAVLFPLYCLIYMCAPNCRTGQLMRKPFMKFLIHASSYLFFLFILILVSQRADDDFVRIFGTTRMKKELAEQELRQRGQTPSKLELIVVMYVIGFVWEEVQEIFAVGMKSYLRNMWNFIDFLRNSLYVSVMCLRAFAYIQQATEIARDPQMAYIPREKWHDFDPQLIAEGLFAAANVFSALKLVHLFSINPHLGPLQISLGRMVIDIVKFFFIYTLVLFAFACGLNQLLWYFAALEKSKC------YVLPGGEADWGSHGDSCM-KWRRFGNLFESSQSLFWASFGMVGLDDFELSGIKSYTRFWGLLMFGSYSVINVIVLLNLLIAMMSNSYAMIDEHSDTEWKFARTKLWMSYFEDSATLPPPFNVLP---SVKWVIRIFRK----SSKTIDRQRSKK-----RKEQEQFSEYDNIMRSLVWRYVAAMHRKFENNPVSEDDINEVKSEINTMRYEMLEIFENSGM 794          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Zebrafish
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 367/792 (46.34%), Postives = 499/792 (63.01%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEAR----HQIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRH 2711
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC D LGRTAL IAIENE+ E++ELLLS+N+ + D+LLHAI +E + AVE+LL       +K+    LL    + FT DITP+ILAAH +NY IIK+L+ +G ++P+PH++RC C ECV S   DSLRHSRSR+N Y+ALASPSLI LSS+DP LTAF+LSWEL  L  +ENEFK +YE L+ QC+ FA DLL QTR S EL  ILN               M   + E    L+RLKLAIKY+QK FV  P+CQQLL+S WY+  PG RR  +  +      I   FP +S+ Y+++PKS+ G  +++PFIKF+CH  SY+ FL  L + +  +      N  +R   +GP P+  EW I+ ++ G+IW EIKQ++  G + Y+ D WNL+DF  N+LY A   L+I AY            R  WE + P L++E +FA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y +     CKG+                C  +   FS +FE +QSL+W+ FGLI L   N++ DH+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ IA+ +D EWKFAR++LW+S+FEEGGT P PFNIIPSPKS  Y I  +K  +F       RSK K     + +   +  R    +Q V+++L+KRY+    + A   +G+TE++  E+K DISSFR+E+I + K N   T A  +  + + + H
Sbjct:   25 AESELSTQEKSYLSAVEKGDYASVKLALEEAEIYFKININCIDPLGRTALLIAIENENLEIIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSDFTPDITPIILAAHTNNYEIIKMLVQKGVSVPQPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKAEYEELSHQCKHFAKDLLDQTRSSRELELILNFRDD-----------MNLLQDEANNELARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAGKLITCVFIGLMFPLLSLCYLVAPKSRYGLFIRKPFIKFICHTASYLTFLFLLLLASQHI----VSNNPDR---QGPKPTTVEWMILPWVLGFIWTEIKQMWDGGFQDYIHDWWNLMDFVMNSLYLATISLKIVAYVKYSGCK----PRDTWEMWHPTLVAEAVFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYENSEGMTCKGI---------------RCERQNNAFSTLFETLQSLFWSIFGLISLYVTNVKADHKFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQHIADHADIEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSICYLITWIKVHVF-----KRRSKRKETFGTLGRRAAENVRLNHQYQEVLRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRYEVIGMMKGNRKSTRANKSDTSASDVSH 774          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Zebrafish
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 367/792 (46.34%), Postives = 499/792 (63.01%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEAR----HQIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRH 2711
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC D LGRTAL IAIENE+ E++ELLLS+N+ + D+LLHAI +E + AVE+LL       +K+    LL    + FT DITP+ILAAH +NY IIK+L+ +G ++P+PH++RC C ECV S   DSLRHSRSR+N Y+ALASPSLI LSS+DP LTAF+LSWEL  L  +ENEFK +YE L+ QC+ FA DLL QTR S EL  ILN               M   + E    L+RLKLAIKY+QK FV  P+CQQLL+S WY+  PG RR  +  +      I   FP +S+ Y+++PKS+ G  +++PFIKF+CH  SY+ FL  L + +  +      N  +R   +GP P+  EW I+ ++ G+IW EIKQ++  G + Y+ D WNL+DF  N+LY A   L+I AY            R  WE + P L++E +FA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y +     CKG+                C  +   FS +FE +QSL+W+ FGLI L   N++ DH+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ IA+ +D EWKFAR++LW+S+FEEGGT P PFNIIPSPKS  Y I  +K  +F       RSK K     + +   +  R    +Q V+++L+KRY+    + A   +G+TE++  E+K DISSFR+E+I + K N   T A  +  + + + H
Sbjct:   25 AESELSTQEKSYLSAVEKGDYASVKLALEEAEIYFKININCIDPLGRTALLIAIENENLEIIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSDFTPDITPIILAAHTNNYEIIKMLVQKGVSVPQPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKAEYEELSHQCKHFAKDLLDQTRSSRELELILNFRDD-----------MNLLQDEANNELARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAGKLITCVFIGLMFPLLSLCYLVAPKSRYGLFIRKPFIKFICHTASYLTFLFLLLLASQHI----VSNNPDR---QGPKPTTVEWMILPWVLGFIWTEIKQMWDGGFQDYIHDWWNLMDFVMNSLYLATISLKIVAYVKYSGCK----PRDTWEMWHPTLVAEAVFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYENSEGMTCKGI---------------RCERQNNAFSTLFETLQSLFWSIFGLISLYVTNVKADHKFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQHIADHADIEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSICYLITWIKVHVF-----KRRSKRKETFGTLGRRAAENVRLNHQYQEVLRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRYEVIGMMKGNRKSTRANKSDTSASDVSH 774          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Zebrafish
Match: trpc5a (transient receptor potential cation channel, subfamily C, member 5a [Source:ZFIN;Acc:ZDB-GENE-040812-1])

HSP 1 Score: 656.366 bits (1692), Expect = 0.000e+0
Identity = 367/813 (45.14%), Postives = 513/813 (63.10%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEA---CKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSES----HNRSKWKSIRKLVKKVNEKEA-------RHQIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPA--YTTLRNVTKLRHKGSKKGFNR 2738
             E ELS +ER +L +VE+GD   V+  L     Y  ++ NC D LGR+AL IAIENE+ E++ELLL + +   D+LL+AI +E + AVE+LL+      +K+    ++    + FT DITP++LAAH +NY IIK+L+ R  TIP+PH +RC C ECV S + DSLRHSRSR+N Y+ALASPSLI LSS+DPILTAF L WEL  L  +ENEF+ +YE L++QC+ FA DLL Q R S EL TILNH   Q           E  +  E   L++LKLAIKY QK FV  P+CQQLL++LWY+G PG RR  +  +  +  +I   FP  S+ Y+L+PKS LG  +K+PFIKF+CH  SY+ FL  L + +  +           L  +GPPP++ EW I+ ++ G+IW EIK+++  G   Y+ D WNL+DF+ N+LY A   L+I AY     S      R+ WE + P LI+E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y  +  +    CKG+                C  +   FS +FE +QSL+W+ FGL++L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+F+EGGT P PFNIIPSPKS  Y    + H   C SE+     +  K +++++   K  EK A        +Q V++ L+KRY+    + A  ++G+TE++  E+K DISSFR+E++++  + N K P   Y++    T LR + S  G  R
Sbjct:   28 AEVELSPEERAFLSAVEKGDYAGVQHALREAEVYYNIDTNCVDPLGRSALLIAIENENLEVMELLLDHGVNTGDALLYAIRKEVVGAVELLLSHRKPSGEKQVPSLMMDAQFSEFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQARSSRELETILNHRDDQ----------SEELDPRECRDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRRHWAVKLVMCFIIGLLFPVFSLVYLLAPKSTLGLFIKKPFIKFICHTASYLTFLFLLLLASQHIART-------NLHMQGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFNEYVHDWWNLMDFAMNSLYLATISLKIVAYVKYNSSR----PREEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETEAADEPNHCKGI---------------RCERQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFWYLCRWV-HGRLCGSETAPPEEDTHKHENLKEFTVKKAEKHADRLIQNQHYQEVIRSLVKRYVASMIRSAKTSEGLTEENFKELKQDISSFRYEVLDL--LGNRKPPRRNYSSSSEAT-LRDEVSDDGEAR 800          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Zebrafish
Match: trpc5a (transient receptor potential cation channel, subfamily C, member 5a [Source:ZFIN;Acc:ZDB-GENE-040812-1])

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 366/809 (45.24%), Postives = 510/809 (63.04%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEA---CKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEA-------RHQIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPA--YTTLRNVTKLRHKGSKKGFNR 2738
             E ELS +ER +L +VE+GD   V+  L     Y  ++ NC D LGR+AL IAIENE+ E++ELLL + +   D+LL+AI +E + AVE+LL+      +K+    ++    + FT DITP++LAAH +NY IIK+L+ R  TIP+PH +RC C ECV S + DSLRHSRSR+N Y+ALASPSLI LSS+DPILTAF L WEL  L  +ENEF+ +YE L++QC+ FA DLL Q R S EL TILNH   Q           E  +  E   L++LKLAIKY QK FV  P+CQQLL++LWY+G PG RR  +  +  +  +I   FP  S+ Y+L+PKS LG  +K+PFIKF+CH  SY+ FL  L + +  +           L  +GPPP++ EW I+ ++ G+IW EIK+++  G   Y+ D WNL+DF+ N+LY A   L+I AY     S      R+ WE + P LI+E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y  +  +    CKG+                C  +   FS +FE +QSL+W+ FGL++L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+F+EGGT P PFNIIPSPKS  Y    + H   C SE+    +     + +K+  EK A        +Q V++ L+KRY+    + A  ++G+TE++  E+K DISSFR+E++++  + N K P   Y++    T LR + S  G  R
Sbjct:   25 AEVELSPEERAFLSAVEKGDYAGVQHALREAEVYYNIDTNCVDPLGRSALLIAIENENLEVMELLLDHGVNTGDALLYAIRKEVVGAVELLLSHRKPSGEKQVPSLMMDAQFSEFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQARSSRELETILNHRDDQ----------SEELDPRECRDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRRHWAVKLVMCFIIGLLFPVFSLVYLLAPKSTLGLFIKKPFIKFICHTASYLTFLFLLLLASQHIART-------NLHMQGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFNEYVHDWWNLMDFAMNSLYLATISLKIVAYVKYNSSR----PREEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETEAADEPNHCKGI---------------RCERQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFWYLCRWV-HGRLCGSETAPPEEDTHKHENLKEFTEKHADRLIQNQHYQEVIRSLVKRYVASMIRSAKTSEGLTEENFKELKQDISSFRYEVLDL--LGNRKPPRRNYSSSSEAT-LRDEVSDDGEAR 793          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Zebrafish
Match: trpc5a (transient receptor potential cation channel, subfamily C, member 5a [Source:ZFIN;Acc:ZDB-GENE-040812-1])

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 366/809 (45.24%), Postives = 510/809 (63.04%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEA---CKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEA-------RHQIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPA--YTTLRNVTKLRHKGSKKGFNR 2738
             E ELS +ER +L +VE+GD   V+  L     Y  ++ NC D LGR+AL IAIENE+ E++ELLL + +   D+LL+AI +E + AVE+LL+      +K+    ++    + FT DITP++LAAH +NY IIK+L+ R  TIP+PH +RC C ECV S + DSLRHSRSR+N Y+ALASPSLI LSS+DPILTAF L WEL  L  +ENEF+ +YE L++QC+ FA DLL Q R S EL TILNH   Q           E  +  E   L++LKLAIKY QK FV  P+CQQLL++LWY+G PG RR  +  +  +  +I   FP  S+ Y+L+PKS LG  +K+PFIKF+CH  SY+ FL  L + +  +           L  +GPPP++ EW I+ ++ G+IW EIK+++  G   Y+ D WNL+DF+ N+LY A   L+I AY     S      R+ WE + P LI+E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y  +  +    CKG+                C  +   FS +FE +QSL+W+ FGL++L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+F+EGGT P PFNIIPSPKS  Y    + H   C SE+    +     + +K+  EK A        +Q V++ L+KRY+    + A  ++G+TE++  E+K DISSFR+E++++  + N K P   Y++    T LR + S  G  R
Sbjct:   50 AEVELSPEERAFLSAVEKGDYAGVQHALREAEVYYNIDTNCVDPLGRSALLIAIENENLEVMELLLDHGVNTGDALLYAIRKEVVGAVELLLSHRKPSGEKQVPSLMMDAQFSEFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQARSSRELETILNHRDDQ----------SEELDPRECRDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRRHWAVKLVMCFIIGLLFPVFSLVYLLAPKSTLGLFIKKPFIKFICHTASYLTFLFLLLLASQHIART-------NLHMQGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFNEYVHDWWNLMDFAMNSLYLATISLKIVAYVKYNSSR----PREEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETEAADEPNHCKGI---------------RCERQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFWYLCRWV-HGRLCGSETAPPEEDTHKHENLKEFTEKHADRLIQNQHYQEVIRSLVKRYVASMIRSAKTSEGLTEENFKELKQDISSFRYEVLDL--LGNRKPPRRNYSSSSEAT-LRDEVSDDGEAR 818          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Xenopus
Match: hint1 (histidine triad nucleotide binding protein 1 [Source:Xenbase;Acc:XB-GENE-1014427])

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 366/775 (47.23%), Postives = 500/775 (64.52%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNH-DHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFY-SHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARH---QIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMN 2657
            +E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC D LGRTAL IAIENE+ E++ELLLSYN+ + D+LLHAI +E + AVE+LL       +K+    LL    + FT DITP+ILAAH +NY IIK L+ +G ++P+PH++RC C ECV     DSLRHSRSR+N YRAL+SPSLI LSS+DP LTAF+LSWEL  L  +ENEFK++YE L+ QC++FA DLL QTR S EL  ILN+ D G +             +      L+RLKLAIKY+QK FV  P+CQQLL+S WY+  PG RR  ++ +     ++   FPA S  Y+++PKS  G  +++PFIKF+CH  SY+ FL  L + +  +      N  E L  +GP P+I EW I+ ++ G+IW EIKQ++  G + Y+ D WNL+DF  N+LY A   L+I AY            R  WE + P L++E +FA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y +  +   CKG+                C  +   FS +FE +QSL+W+ FGLI+L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+FEEGGT P PFNIIPSPKS  Y I  ++  +  C +   R K +S   + ++  +   RH   Q VMK+L+KRY+    + A   +G+TE++  E+K DISSFRFE++ + K N
Sbjct:   25 SESELSPSEKAYLSAVEKGDYASVKQALEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSYNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKHLVQKGVSVPRPHEVRCNCVECVSGSDVDSLRHSRSRLNIYRALSSPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSSQCKQFAKDLLDQTRSSRELEIILNYRDDGGL------------LDDSNGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWVVKMVTCVIVGLLFPAFSCCYLIAPKSTFGLFIRKPFIKFICHTASYLTFLFLLLLASQNI------NKTESL--QGPAPTIVEWMILPWVLGFIWGEIKQMWDGGFQDYIHDWWNLMDFVMNSLYLATISLKIVAYVKRN--------RAEWEMFHPTLVAEAVFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEADAKSSDCKGI---------------RCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVDPKHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNIIPSPKSLWYLIKWIRKQI--CKKKMKR-KPESFGAIGRRAADNLRRHNHYQEVMKNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLKGN 753          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Xenopus
Match: TRPC5 (transient receptor potential cation channel, subfamily C, member 5 [Source:NCBI gene;Acc:100493720])

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 359/799 (44.93%), Postives = 512/799 (64.08%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEA---CKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEA-------RHQIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRHK 2714
             E ELS +E+ YL++VE+GD   VK  L+    Y  +NINC D LGR+AL IAIENE+ E++ELLLS+N+ + D+LL+AI +E + AVE+LL+      +K+    ++    + FT DITP++LAAH +NY IIK+L+ R  TIP+PH +RC C ECV S + DSLRHSRSR+N Y+ALASPSLI LSS+DPILTAF L WEL  L  +ENEFK +YE L++QC+KFA DLL Q R S EL  ILNH   Q           E  + ++   L++LK+AIKY QK FV  P+CQQLL++LWY+G PG RR  +  +      I   FP +S+ Y+++PKS+LG  +K+PFIKF+CH  SY+ FL  L + +  +           L  +GPPP++ EW I+ ++ G+IW EIK+++  G   Y+ D WNL+DF+ N+LY A   L+I AY     S      R+ W+ + P LI+E  FA +NILS ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y     E    CKG+                C  +   FS +FE +QSL+W+ FGL++L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+F+EG T P PFNII SPKS  YF   +++ L  C   ++    +   + +K   E+ A        +Q V+++L+KRY+    + +  N+G+TE++  E+K DISSFR+E++++  + N K P  +   + T++  K
Sbjct:   25 AEAELSQEEKAYLIAVEKGDYASVKHALEEAEIYYNININCMDPLGRSALLIAIENENLEIMELLLSHNIYVGDALLYAIRKEVVGAVELLLSHRKPSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQRRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKKFAKDLLDQARSSRELEIILNHRDDQ----------SEELDPQKCHDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWAVKLVTCITIGLLFPVLSVAYLIAPKSRLGLFIKKPFIKFICHTASYLTFLFLLLLASQHI-------VRTELHMQGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFNEYVHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSKP----REEWDMWHPTLIAEAFFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETSASEEPNNCKGI---------------RCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGATMPPPFNIIASPKSIWYFCKWVRYKL--CPGKNSEEDIQKQHENLKTFTERHADNLIQNQHYQEVIRNLVKRYVAAMIRNSKTNEGLTEENFKELKQDISSFRYEVLDL--LGNRKPPRRSYSTSSTEVSQK 783          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Xenopus
Match: TRPC1 (transient receptor potential cation channel, subfamily C, member 1 [Source:NCBI gene;Acc:100497011])

HSP 1 Score: 511.531 bits (1316), Expect = 6.484e-166
Identity = 303/791 (38.31%), Postives = 463/791 (58.53%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMA---TRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLL-WFYSHQRQEACKGVVFTYSITGQELERYQYCITRGR-YFSNIFEIIQSLYWTAFGL--IDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKS-CKYFILILKHCLFCCSESHNRSK-------WKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQ-RQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAY 2678
             +EE + DER +LL+ E+GD   VK +L+  +   LNIN  D LGR A+ I+IENE+ ++L+LLL+Y  +  D+LL AI  E + AV+ILL       TRP    L++ + N   + T D+ P+ILAAHR+NY I+ +LL +  ++PKPH + C C  C    K+DSLRHSR R++ YR LASP+LI L+ +DPIL AFELS +L  L ++E EF+ DYE LA++C+ FA DLLAQ R S EL  ILNH        S  P+  +    EE M LSRLKLAIKY QK FV   +CQQ L+++W+  + G RR     +  ++  +   +P +S+ Y+L+PKS++G I+  PF+KF+ H  SY  FLL      + +  +++    ++ +  GP     ++ +I++L G +W ++K+L+ +GL  +L +  N L F  N+LY A F L++ A+    +    + ERK W+A+ P L++E LFA  N+LS ++L FM+T +  LGPLQIS+G+ML+D   F  M++LVL ++  G+ QL    Y+   Q+ C G+               +C  +    F +      +L+W  F L  + L      +  +   F+G L++G+Y  + +I+L  + +AM++ S+Q+IA   DKEWKFAR++LW+S+F++  T P PFNI+PSPK+ C  F  I K    C   +  R K       WKS+R+      +++  +Q VM  L+ RYL   RQK       T ++LNE++ D+S FR E+ ++      K   +
Sbjct:   38 VKEETTLDERLFLLACEKGDYYMVKKLLEENSSEELNINSVDVLGRNAITISIENENLDILQLLLNYGCQSTDALLVAIDSEVVGAVDILLNHQPKWRTRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCTAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELAQKCKTFAKDLLAQARNSRELEVILNHQS------SDEPVD-KRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMAGYRRKHTCKKILIVLTVGIFWPVLSVCYLLAPKSQVGRIIHTPFMKFIIHGASYFTFLL-----LLNLYSLVYNE--DKKNTMGPALERIDFLLIMWLIGMVWSDVKRLWYDGLEDFLEESRNQLSFVMNSLYLATFALKVVAH----NKFHSIAERKDWDAFHPTLVAEGLFAFGNVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTTNEQKDCVGI---------------FCEQQSNDAFHSFTGTCYALFWYIFSLAHVALFVTRFSFSEELQSFVGALIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIVPSPKTICYLFNSISK--WICSHTTTGRVKRQNSLKEWKSLRQ------KRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEMRDLLGFRTSKYAMF 787          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Xenopus
Match: TRPC1 (transient receptor potential cation channel, subfamily C, member 1 [Source:NCBI gene;Acc:100497011])

HSP 1 Score: 511.146 bits (1315), Expect = 1.530e-165
Identity = 303/787 (38.50%), Postives = 462/787 (58.70%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMA---TRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLL-WFYSHQRQEACKGVVFTYSITGQELERYQYCITRGR-YFSNIFEIIQSLYWTAFGL--IDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKS-CKYFILILKHCLFCCSESHNRSK-------WKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQ-RQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMK 2666
             +EE + DER +LL+ E+GD   VK +L+  +   LNIN  D LGR A+ I+IENE+ ++L+LLL+Y  +  D+LL AI  E + AV+ILL       TRP    L++ + N   + T D+ P+ILAAHR+NY I+ +LL +  ++PKPH + C C  C    K+DSLRHSR R++ YR LASP+LI L+ +DPIL AFELS +L  L ++E EF+ DYE LA++C+ FA DLLAQ R S EL  ILNH        S  P+  +    EE M LSRLKLAIKY QK FV   +CQQ L+++W+  + G RR     +  ++  +   +P +S+ Y+L+PKS++G I+  PF+KF+ H  SY  FLL      + +  +++    ++ +  GP     ++ +I++L G +W ++K+L+ +GL  +L +  N L F  N+LY A F L++ A+    +    + ERK W+A+ P L++E LFA  N+LS ++L FM+T +  LGPLQIS+G+ML+D   F  M++LVL ++  G+ QL    Y+   Q+ C G+               +C  +    F +      +L+W  F L  + L      +  +   F+G L++G+Y  + +I+L  + +AM++ S+Q+IA   DKEWKFAR++LW+S+F++  T P PFNI+PSPK+ C  F  I K    C   +  R K       WKS+R+      +++  +Q VM  L+ RYL   RQK       T ++LNE++ D+S FR E+ ++      K
Sbjct:   58 VKEETTLDERLFLLACEKGDYYMVKKLLEENSSEELNINSVDVLGRNAITISIENENLDILQLLLNYGCQSTDALLVAIDSEVVGAVDILLNHQPKWRTRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCTAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELAQKCKTFAKDLLAQARNSRELEVILNHQS------SDEPVD-KRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMAGYRRKHTCKKILIVLTVGIFWPVLSVCYLLAPKSQVGRIIHTPFMKFIIHGASYFTFLL-----LLNLYSLVYNE--DKKNTMGPALERIDFLLIMWLIGMVWSDVKRLWYDGLEDFLEESRNQLSFVMNSLYLATFALKVVAH----NKFHSIAERKDWDAFHPTLVAEGLFAFGNVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTTNEQKDCVGI---------------FCEQQSNDAFHSFTGTCYALFWYIFSLAHVALFVTRFSFSEELQSFVGALIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIVPSPKTICYLFNSISK--WICSHTTTGRVKRQNSLKEWKSLRQ------KRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEMRDLLGFRTSK 803          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Xenopus
Match: TRPC1 (transient receptor potential cation channel, subfamily C, member 1 [Source:NCBI gene;Acc:100497011])

HSP 1 Score: 511.916 bits (1317), Expect = 7.425e-165
Identity = 303/787 (38.50%), Postives = 462/787 (58.70%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMA---TRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLL-WFYSHQRQEACKGVVFTYSITGQELERYQYCITRGR-YFSNIFEIIQSLYWTAFGL--IDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKS-CKYFILILKHCLFCCSESHNRSK-------WKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQ-RQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMK 2666
             +EE + DER +LL+ E+GD   VK +L+  +   LNIN  D LGR A+ I+IENE+ ++L+LLL+Y  +  D+LL AI  E + AV+ILL       TRP    L++ + N   + T D+ P+ILAAHR+NY I+ +LL +  ++PKPH + C C  C    K+DSLRHSR R++ YR LASP+LI L+ +DPIL AFELS +L  L ++E EF+ DYE LA++C+ FA DLLAQ R S EL  ILNH        S  P+  +    EE M LSRLKLAIKY QK FV   +CQQ L+++W+  + G RR     +  ++  +   +P +S+ Y+L+PKS++G I+  PF+KF+ H  SY  FLL      + +  +++    ++ +  GP     ++ +I++L G +W ++K+L+ +GL  +L +  N L F  N+LY A F L++ A+    +    + ERK W+A+ P L++E LFA  N+LS ++L FM+T +  LGPLQIS+G+ML+D   F  M++LVL ++  G+ QL    Y+   Q+ C G+               +C  +    F +      +L+W  F L  + L      +  +   F+G L++G+Y  + +I+L  + +AM++ S+Q+IA   DKEWKFAR++LW+S+F++  T P PFNI+PSPK+ C  F  I K    C   +  R K       WKS+R+      +++  +Q VM  L+ RYL   RQK       T ++LNE++ D+S FR E+ ++      K
Sbjct:  143 VKEETTLDERLFLLACEKGDYYMVKKLLEENSSEELNINSVDVLGRNAITISIENENLDILQLLLNYGCQSTDALLVAIDSEVVGAVDILLNHQPKWRTRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCTAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELAQKCKTFAKDLLAQARNSRELEVILNHQS------SDEPVD-KRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMAGYRRKHTCKKILIVLTVGIFWPVLSVCYLLAPKSQVGRIIHTPFMKFIIHGASYFTFLL-----LLNLYSLVYNE--DKKNTMGPALERIDFLLIMWLIGMVWSDVKRLWYDGLEDFLEESRNQLSFVMNSLYLATFALKVVAH----NKFHSIAERKDWDAFHPTLVAEGLFAFGNVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTTNEQKDCVGI---------------FCEQQSNDAFHSFTGTCYALFWYIFSLAHVALFVTRFSFSEELQSFVGALIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIVPSPKTICYLFNSISK--WICSHTTTGRVKRQNSLKEWKSLRQ------KRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEMRDLLGFRTSK 888          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Mouse
Match: Trpc4 (transient receptor potential cation channel, subfamily C, member 4 [Source:MGI Symbol;Acc:MGI:109525])

HSP 1 Score: 671.389 bits (1731), Expect = 0.000e+0
Identity = 368/805 (45.71%), Postives = 516/805 (64.10%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFI-LILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARH---QIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRHKGSKKGFNRIMRK 2750
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC D LGRTAL IAIENE+ E++ELLLS+N+ + D+LLHAI +E + AVE+LL       +K+    LL    + FT DITP+ILAAH +NY IIK+L+ +G ++P+PH++RC C ECV S   DSLRHSRSR+N Y+ALASPSLI LSS+DP LTAF+LSWEL  L  +ENEFK++YE L+ QC++FA DLL QTR S EL  ILN+     N++          E +    L+RLKLAIKY+QK FV  P+CQQLL+S WY+  PG RR  +  +     +I   FP  S+ Y+++PKS LG  +++PFIKF+CH  SY+ FL  L + +  ++          L+ +GPPP+I EW I+ ++ G+IW EIKQ++  GL+ Y+ D WNL+DF  N+LY A   L+I A+         +  R+ W+ + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y   +  +CKG+                C  +   FS +FE +QSL+W+ FGLI+L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+FEEGGT P PFN+IPSPKS  Y +  I  H    C +   R K +S   + ++  +   RH   Q VM++L+KRY+    ++A   +G+TE+++ E+K DISSFRFE++ + + + + T       +      K   +G  +  RK
Sbjct:   25 AESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDD--NSL---------IEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHID-------RSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKY----SALNPRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLSCKGI---------------RCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLVKWIWTH---LCKKKMRR-KPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAAMIREAKTEEGLTEENVKELKQDISSFRFEVLGLLRGSKLSTIQSANAASSADSDEKSQSEGNGKDKRK 788          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Mouse
Match: Trpc4 (transient receptor potential cation channel, subfamily C, member 4 [Source:MGI Symbol;Acc:MGI:109525])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 364/778 (46.79%), Postives = 509/778 (65.42%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFI-LILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARH---QIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKT 2669
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC D LGRTAL IAIENE+ E++ELLLS+N+ + D+LLHAI +E + AVE+LL       +K+    LL    + FT DITP+ILAAH +NY IIK+L+ +G ++P+PH++RC C ECV S   DSLRHSRSR+N Y+ALASPSLI LSS+DP LTAF+LSWEL  L  +ENEFK++YE L+ QC++FA DLL QTR S EL  ILN+     N++          E +    L+RLKLAIKY+QK FV  P+CQQLL+S WY+  PG RR  +  +     +I   FP  S+ Y+++PKS LG  +++PFIKF+CH  SY+ FL  L + +  ++          L+ +GPPP+I EW I+ ++ G+IW EIKQ++  GL+ Y+ D WNL+DF  N+LY A   L+I A+         +  R+ W+ + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y   +  +CKG+                C  +   FS +FE +QSL+W+ FGLI+L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+FEEGGT P PFN+IPSPKS  Y +  I  H    C +   R K +S   + ++  +   RH   Q VM++L+KRY+    ++A   +G+TE+++ E+K DISSFRFE++ + + + + T
Sbjct:   25 AESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDD--NSL---------IEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHID-------RSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKY----SALNPRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLSCKGI---------------RCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLVKWIWTH---LCKKKMRR-KPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAAMIREAKTEEGLTEENVKELKQDISSFRFEVLGLLRGSKLST 761          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Mouse
Match: Trpc5 (transient receptor potential cation channel, subfamily C, member 5 [Source:MGI Symbol;Acc:MGI:109524])

HSP 1 Score: 657.907 bits (1696), Expect = 0.000e+0
Identity = 352/783 (44.96%), Postives = 503/783 (64.24%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNH--DHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQ---RQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNE---KEARHQIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTP 2672
             E ELS +E+ +L +VE+GD   VK  L     Y  +NINC D LGR+AL IAIENE+ E++ELLL++++ + D+LL+AI +E + AVE+LL+      +K+    ++    + FT DITP++LAAH +NY IIK+L+ +  TIP+PH +RC C ECV S + DSLRHSRSR+N Y+ALASPSLI LSS+DPILTAF L WEL  L  +ENEFK +YE L++QC+ FA DLL Q R S EL  ILNH  DH             E  + ++   L++LK+AIKY QK FV  P+CQQLL++LWY+G PG RR  ++ +      I   FP +S+ Y++SP+S LG  +K+PFIKF+CH  SY+ FL  L + +  +           L  +GPPP++ EW I+ ++ G+IW EIK+++  G   Y+ D WNL+DF+ N+LY A   L+I AY     S      R+ WE + P LI+E LFA +NILS ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y  +       CKG+                C  +   FS +FE +QSL+W+ FGL++L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+F+EGGT P PFNIIPSPKS  Y      +      +   R +  ++R   ++  +   +   +Q V+++L+KRY+    + +  N+G+TE++  E+K DISSFR+E++++  + N K P
Sbjct:   25 AETELSAEEKAFLSAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRKPSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHS------------EELDPQKYHDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFICHTASYLTFLFMLLLASQHI-------VRTDLHVQGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSR----PREEWEMWHPTLIAEALFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRAIDEPNNCKGI---------------RCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFLYLGNWFNNTFCPKRDPDGRRRRHNLRSFTERHADSLIQNQHYQEVIRNLVKRYVAAMIRNSKTNEGLTEENFKELKQDISSFRYEVLDL--LGNRKHP 767          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Mouse
Match: Trpc1 (transient receptor potential cation channel, subfamily C, member 1 [Source:MGI Symbol;Acc:MGI:109528])

HSP 1 Score: 517.309 bits (1331), Expect = 4.189e-168
Identity = 306/784 (39.03%), Postives = 460/784 (58.67%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLT---AMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLL-WFYSHQRQEACKGVVFTYSITGQELERYQYCITRGR-YFSNIFEIIQSLYWTAFGL--IDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEK-EARHQIVMKDLIKRYLIQ-RQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAY 2678
             +EE + +E+ +LL+ ++GD   VK IL+  +   LNINC D LGR A+ I IENE  ++L+LLL Y  + AD+LL AI  E + AV+ILL      ++RP    L++ + N   + T D+ P+ILAAHR+NY I+ +LL +  ++PKPH + C C  C    K+DSLRHSR R++ YR LASP+LI L+ +DPIL AFELS +L  L ++E EF+ DYE LA QC+ FA DLLAQ R S EL  ILNH      T S  PL  +    EE M LSRLKLAIKY QK FV   +CQQ L+++W+  + G RR P   +   +  +   +P +S+ Y+++PKS+ G I+  PF+KF+ H  SY  FLL L + ++           ++ +  GP     ++ +I+++ G IW +IK+L+  GL  +L +  N L F  N+LY A F L++ A+    D  D    RK W+A+ P L++E LFA AN+LS ++L FM+T +  LGPLQIS+G+ML+D   F  M++LVL ++  G+ QL    Y+ + Q+ C G+               +C  +    F +      +L+W  F L  + +      Y  +   F+G +++G+Y  + +I+L  + +AM++ S+Q+IA   DKEWKFAR++LW+S+F++  T P PFNIIPSPK+  Y I  L   + C   S  + K ++  K  + + +K +  +Q VM  L+ RYL   RQK       T ++LNE++ D+S FR E+ ++      K   +
Sbjct:   56 VKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENESLDILQLLLDYGCQSADALLVAIDSEVVGAVDILLNHRPKRSSRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNH------TSSDEPLD-KRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYN-------EDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFAD----RKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGI---------------FCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWI-CSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMF 805          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Mouse
Match: Trpc1 (transient receptor potential cation channel, subfamily C, member 1 [Source:MGI Symbol;Acc:MGI:109528])

HSP 1 Score: 488.804 bits (1257), Expect = 1.138e-157
Identity = 287/781 (36.75%), Postives = 439/781 (56.21%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLL-WFYSHQRQEACKGVVFTYSITGQELERYQYCITRGR-YFSNIFEIIQSLYWTAFGL--IDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEK-EARHQIVMKDLIKRYLIQ-RQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAY 2678
             +EE + +E+ +LL+ ++GD   VK IL+  +   LNINC D LGR A+ I I                            E+++ +++LL     +     L++ + N   + T D+ P+ILAAHR+NY I+ +LL +  ++PKPH + C C  C    K+DSLRHSR R++ YR LASP+LI L+ +DPIL AFELS +L  L ++E EF+ DYE LA QC+ FA DLLAQ R S EL  ILNH      T S  PL  +    EE M LSRLKLAIKY QK FV   +CQQ L+++W+  + G RR P   +   +  +   +P +S+ Y+++PKS+ G I+  PF+KF+ H  SY  FLL L + ++           ++ +  GP     ++ +I+++ G IW +IK+L+  GL  +L +  N L F  N+LY A F L++ A+    D  D    RK W+A+ P L++E LFA AN+LS ++L FM+T +  LGPLQIS+G+ML+D   F  M++LVL ++  G+ QL    Y+ + Q+ C G+               +C  +    F +      +L+W  F L  + +      Y  +   F+G +++G+Y  + +I+L  + +AM++ S+Q+IA   DKEWKFAR++LW+S+F++  T P PFNIIPSPK+  Y I  L   + C   S  + K ++  K  + + +K +  +Q VM  L+ RYL   RQK       T ++LNE++ D+S FR E+ ++      K   +
Sbjct:   56 VKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITI--------------------------ENESLDILQLLLDYGCQK-----LMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNH------TSSDEPLD-KRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYN-------EDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFAD----RKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGI---------------FCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWI-CSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMF 771          
BLAST of Short transient receptor potential channel 4 vs. UniProt/SwissProt
Match: sp|Q9VJJ7|TRPG_DROME (Transient receptor potential-gamma protein OS=Drosophila melanogaster OX=7227 GN=Trpgamma PE=1 SV=2)

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 399/822 (48.54%), Postives = 549/822 (66.79%), Query Frame = 3
Query:  363 ELSDDERKYLLSVERGDAPYVKSILDN-KNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTA--MATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFG----------NYVERL-SDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMK-----DSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRHKGSKKGFNRIMRKTNL--PG 2765
            +L+ +E+K+LL+VERGD    + +L   ++   +N+NC D LGRTAL +AI+NE+ EM+ELL++YN++  D+LLH+ISEE +EAVE+LL    +    +     +     ++ FT DITPLILAAHRDNY IIKILLDRG  +P PHD+RC C ECV+S++EDSLRHSRSRINAYRALASPSLI LSSKDPILTAFELSWEL RL  LE+EFK +Y+ L +QCQ FAT LL  TR S EL  +LNHD          P+     E  E M L+RLKLAIK +QK FV H + QQLL+S+WYEGLPG RR     Q+  I  I   FP  S+ YIL+P S +G  +++PFIKF+CH  SY  FL  L + + ++E  + G          N +E L + RG  P+  EW I+ +++G IW E+KQL+  GL+ YL DMWN++DF TN+LY A   LR+ ++F ++     +S    + R+ W+A++P+LISE LF+AANI S +KLV++F++NP LGPLQ+SL RM+ DI+ FF +YVLVL A+  G++QLLW+Y+   ++ C  V    ++               R FSN+FE  Q+L+W  FGLIDL +  L+    FT F G LM G+Y  I+I++LLN+ IAMMN SYQ+I+E++D EWKFARS+LWIS+FEEGGT P PFNIIP+PKS  Y I  ++      S +  R   K+IR+  ++ ++++ ++Q +M++L++RY+   Q+  E+QGVTEDD+NEIK DIS+FR EL+EI K + M T    T         K +++   R+M+  N+  PG
Sbjct:   16 QLTLEEKKFLLAVERGDMAGTRRMLQKAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLINYNVDTKDALLHSISEEFVEAVEVLLDHENVTFHSEGNHSWESASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTRTSHELEILLNHD-------PTGPVY----EHGERMHLNRLKLAIKLRQKKFVAHSNVQQLLASIWYEGLPGFRRKNMALQAVDIIRIGIMFPIFSLAYILAPYSSIGQTMRKPFIKFICHSASYFTFLFLLMLASQRIETFIGGWFFADSSGMLNTMEELPTKRGAKPTFIEWLILAWVSGLIWSEVKQLWDVGLQEYLNDMWNVIDFVTNSLYVATVALRVVSFFQVQKEMIYNSHATDLPRERWDAWDPMLISEGLFSAANIFSSLKLVYIFSVNPHLGPLQVSLSRMVMDIMKFFFLYVLVLFAFGSGLNQLLWYYADLEKKRCPEVSPMSALLNMNGTNDPNACIVWRRFSNLFETTQTLFWAVFGLIDLDSFELDGIKIFTRFWGMLMFGTYSVINIVVLLNLLIAMMNHSYQLISERADVEWKFARSKLWISYFEEGGTCPPPFNIIPTPKSIWYAIKWMRRVFCSGSSAARREHLKTIRRKAQQASDRDFKYQQIMRNLVRRYVTVEQRKAESQGVTEDDVNEIKQDISAFRCELVEILKNSGMDT--NVTAGQGGGGGGKKNRQKERRLMKGFNIAPPG 824          
BLAST of Short transient receptor potential channel 4 vs. UniProt/SwissProt
Match: sp|Q9QUQ5|TRPC4_MOUSE (Short transient receptor potential channel 4 OS=Mus musculus OX=10090 GN=Trpc4 PE=1 SV=1)

HSP 1 Score: 671.389 bits (1731), Expect = 0.000e+0
Identity = 368/805 (45.71%), Postives = 516/805 (64.10%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFI-LILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARH---QIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRHKGSKKGFNRIMRK 2750
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC D LGRTAL IAIENE+ E++ELLLS+N+ + D+LLHAI +E + AVE+LL       +K+    LL    + FT DITP+ILAAH +NY IIK+L+ +G ++P+PH++RC C ECV S   DSLRHSRSR+N Y+ALASPSLI LSS+DP LTAF+LSWEL  L  +ENEFK++YE L+ QC++FA DLL QTR S EL  ILN+     N++          E +    L+RLKLAIKY+QK FV  P+CQQLL+S WY+  PG RR  +  +     +I   FP  S+ Y+++PKS LG  +++PFIKF+CH  SY+ FL  L + +  ++          L+ +GPPP+I EW I+ ++ G+IW EIKQ++  GL+ Y+ D WNL+DF  N+LY A   L+I A+         +  R+ W+ + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y   +  +CKG+                C  +   FS +FE +QSL+W+ FGLI+L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+FEEGGT P PFN+IPSPKS  Y +  I  H    C +   R K +S   + ++  +   RH   Q VM++L+KRY+    ++A   +G+TE+++ E+K DISSFRFE++ + + + + T       +      K   +G  +  RK
Sbjct:   25 AESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDD--NSL---------IEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHID-------RSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKY----SALNPRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLSCKGI---------------RCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLVKWIWTH---LCKKKMRR-KPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAAMIREAKTEEGLTEENVKELKQDISSFRFEVLGLLRGSKLSTIQSANAASSADSDEKSQSEGNGKDKRK 788          
BLAST of Short transient receptor potential channel 4 vs. UniProt/SwissProt
Match: sp|P79100|TRPC4_BOVIN (Short transient receptor potential channel 4 OS=Bos taurus OX=9913 GN=TRPC4 PE=2 SV=2)

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 364/778 (46.79%), Postives = 507/778 (65.17%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFI-LILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARH---QIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKT 2669
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC D LGRTAL IAIENE+ E++ELLLS+N+ + D+LLHAI +E + AVE+LL       +K+    LL    + FT DITP+ILAAH +NY IIK+L+ +G ++P+PH++RC C ECV S   DSLRHSRSR+N Y+ALASPSLI LSS+DP LTAF+LSWEL  L  +ENEFK++YE L+ QC++FA DLL QTR S EL  ILN+     N++          E +    L+RLKLAIKY+QK FV  P+CQQLL+S WY+  PG RR  +  +     ++   FP  S+ Y+++PKS LG  +++PFIKF+CH  SY+ FL  L + +  ++          L+ +GPPP+I EW I+ ++ G+IW EIKQ++  GL+ Y+ D WNL+DF  N+LY A   L+I A+         +  R+ W+ + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y   +  +CKG+                C  +   FS +FE +QSL+W+ FGLI+L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+FEEGGT P PFN+IPSPKS  Y I  I  H    C +   R K +S   + ++  +   RH   Q VM++L+KRY+    + A   +G+TE++  E+K DISSFRFE++ + + + + T
Sbjct:   25 AESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDD--NSL---------LEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIVGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHID-------RSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKY----SALNPRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLSCKGI---------------RCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLIKWIWTH---LCKKKMRR-KPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLST 761          
BLAST of Short transient receptor potential channel 4 vs. UniProt/SwissProt
Match: sp|Q9UBN4|TRPC4_HUMAN (Short transient receptor potential channel 4 OS=Homo sapiens OX=9606 GN=TRPC4 PE=1 SV=1)

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 365/778 (46.92%), Postives = 506/778 (65.04%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFI-LILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARH---QIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKT 2669
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC D LGRTAL IAIENE+ E++ELLLS+N+ + D+LLHAI +E + AVE+LL       +K+    LL    + FT DITP+ILAAH +NY IIK+L+ +G ++P+PH++RC C ECV S   DSLRHSRSR+N Y+ALASPSLI LSS+DP LTAF+LSWEL  L  +ENEFK++YE L+ QC++FA DLL QTR S EL  ILN+     N++          E +    L+RLKLAIKY+QK FV  P+CQQLL+S WY+  PG RR  +  +     +I   FP  S+ Y+++PKS LG  +++PFIKF+CH  SY+ FL  L + +  ++          L+ +GPPP+I EW I+ ++ G+IW EIKQ++  GL+ Y+ D WNL+DF  N+LY A   L+I A+         +  R+ W+ + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y   +   CKG+                C  +   FS +FE +QSL+W+ FGLI+L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+FEEGGT P PFN+IPSPKS  Y I  I  H    C +   R K +S   + ++  +   RH   Q VM++L+KRY+    + A   +G+TE++  E+K DISSFRFE++ + + + + T
Sbjct:   25 AESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDD--NSL---------IEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHID-------RSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKY----SALNPRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGI---------------RCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLIKWIWTH---LCKKKMRR-KPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLST 761          
BLAST of Short transient receptor potential channel 4 vs. UniProt/SwissProt
Match: sp|O35119|TRPC4_RAT (Short transient receptor potential channel 4 OS=Rattus norvegicus OX=10116 GN=Trpc4 PE=1 SV=2)

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 363/778 (46.66%), Postives = 509/778 (65.42%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFI-LILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARH---QIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKT 2669
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC D LGRTAL IAIENE+ E++ELLLS+N+ + D+LLHAI +E + AVE+LL       +K+    LL    + FT DITP+ILAAH +NY IIK+L+ +G ++P+PH++RC C ECV S   DSLRHSRSR+N Y+ALASPSLI LSS+DP LTAF+LSWEL  L  +ENEFK++YE L+ QC++FA DLL QTR S EL  ILN+     N++          E +    L+RLKLAIKY+QK FV  P+CQQLL+S WY+  PG RR  +  +     +I   FP  S+ Y+++PKS LG  +++PFIKF+CH  SY+ FL  L + +  ++          L+ +GPPP+I EW I+ ++ G+IW EIKQ++  GL+ Y+ D WNL+DF  N+LY A   L+I A+         +  R+ W+ + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y   +  +CKG+                C  +   FS +FE +QSL+W+ FGLI+L   N++  H+FT+F+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+FEEGGT P PFN+IPSPKS  Y +  I  H    C +   R K +S   + ++  +   RH   Q VM++L+KRY+    ++A   +G+TE+++ E+K DISSFRFE++ + + + + T
Sbjct:   25 AESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNYRDD--NSL---------IEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHID-------RSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKY----SALNPRESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLSCKGI---------------RCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTDFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLVKWIWTH---LCKKKMRR-KPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAAMIREAKTEEGLTEENVKELKQDISSFRFEVLGLLRGSKLST 761          
BLAST of Short transient receptor potential channel 4 vs. TrEMBL
Match: A0A267FS73 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029366g3 PE=3 SV=1)

HSP 1 Score: 993.801 bits (2568), Expect = 0.000e+0
Identity = 479/790 (60.63%), Postives = 616/790 (77.97%), Query Frame = 3
Query:  363 ELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNS-SNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTD-RMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRHKGSKK 2726
            +L+ +ER+YL +VE GD   V+  +++ +   +NINC DSLGR+ALH+AIE EH E+LE+LL+YNLE+ D+LLHAI EENI AVE+LL++   R KKKDL  LLG + S++FT D+TP+ILAA  DNY IIK+LLDRGD +PKPH+LRCAC +CV++ KEDSL+HS+SRINAY+ALASPSLI LSSKDPILTAFELSWE++RLG LE+EF+ +YE L+  CQKFAT LL QTR S ELA +LN D GQ N    + L  ++    E M L+RLK+AIKYKQK FV HPHCQQLL++LWYEGLPG RR     Q  +IG     FP +SM Y+++P+S+LG  +++PFIKF+CH  SYMLFL FL + A++VE ++     E++ +RG  PSI EW I+IY+ G++WQEIKQL+  G++AY+ DMWNLLDF TNALY A   LR  +Y+ +  +++ R + RKYW+AY+P LISECLFA ANI S++KLV +FTINP LGPLQISLGRML DIL F  + VLV+ ++A G +QL WFY++QR + C+   F + ITG +L++Y YC+TRGR FSN+FEI QSLYW+A+GLIDL+N +LEY+H FTEFIGKLM G++  I+ I+LLNM IAMMN S++ I  ++D EWKFAR +LWIS+F+EGGT P PFNIIPSPKS  Y +  LK  +  CS+ H RSKW+SIRK+VKKVNEKEAR+Q VM+DLIKRYL+ RQK+ + QGVTEDDLNEIKGDIS+FRFEL+EIF+ N M+TPA+   R+ TKLR +GSK+
Sbjct:   83 DLNMNERRYLQAVELGDLATVRRSIESASSLGININCRDSLGRSALHVAIEYEHIELLEVLLAYNLELGDALLHAIQEENIIAVEMLLSSQTERQKKKDLSGLLGTTPSSSFTPDVTPIILAAQIDNYEIIKLLLDRGDRVPKPHELRCACVDCVRAHKEDSLQHSKSRINAYKALASPSLIALSSKDPILTAFELSWEMHRLGRLEHEFREEYENLSADCQKFATALLEQTRSSEELAIVLNQDAGQGN----AKLNDKTLTEGERMNLARLKMAIKYKQKKFVAHPHCQQLLAALWYEGLPGFRRKHMFFQMGMIGTFAGIFPLLSMVYMVAPRSELGQKMRKPFIKFICHSASYMLFLGFLVLAAIRVEDLIMDTLEEKMQERGGAPSIVEWIIVIYILGFVWQEIKQLWGEGIKAYVTDMWNLLDFITNALYVATITLRGVSYYRVHQNSELRSLHRKYWDAYDPTLISECLFAIANIFSMLKLVNIFTINPHLGPLQISLGRMLNDILKFLFVVVLVICSFACGFNQLYWFYAYQRNKYCQDNKFYFGITGTDLDKYSYCVTRGRTFSNLFEITQSLYWSAYGLIDLSNTDLEYEHSFTEFIGKLMYGAFSAITFIVLLNMLIAMMNCSFEEIVAQADTEWKFARGKLWISYFDEGGTLPTPFNIIPSPKSFLYAMAWLKDKVCSCSKRHQRSKWQSIRKVVKKVNEKEARYQSVMRDLIKRYLMVRQKSDDKQGVTEDDLNEIKGDISAFRFELLEIFRTNGMRTPAHMQQRS-TKLRRRGSKR 867          
BLAST of Short transient receptor potential channel 4 vs. TrEMBL
Match: A0A267DGY4 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029366g2 PE=3 SV=1)

HSP 1 Score: 993.801 bits (2568), Expect = 0.000e+0
Identity = 479/790 (60.63%), Postives = 616/790 (77.97%), Query Frame = 3
Query:  363 ELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNS-SNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTD-RMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRHKGSKK 2726
            +L+ +ER+YL +VE GD   V+  +++ +   +NINC DSLGR+ALH+AIE EH E+LE+LL+YNLE+ D+LLHAI EENI AVE+LL++   R KKKDL  LLG + S++FT D+TP+ILAA  DNY IIK+LLDRGD +PKPH+LRCAC +CV++ KEDSL+HS+SRINAY+ALASPSLI LSSKDPILTAFELSWE++RLG LE+EF+ +YE L+  CQKFAT LL QTR S ELA +LN D GQ N    + L  ++    E M L+RLK+AIKYKQK FV HPHCQQLL++LWYEGLPG RR     Q  +IG     FP +SM Y+++P+S+LG  +++PFIKF+CH  SYMLFL FL + A++VE ++     E++ +RG  PSI EW I+IY+ G++WQEIKQL+  G++AY+ DMWNLLDF TNALY A   LR  +Y+ +  +++ R + RKYW+AY+P LISECLFA ANI S++KLV +FTINP LGPLQISLGRML DIL F  + VLV+ ++A G +QL WFY++QR + C+   F + ITG +L++Y YC+TRGR FSN+FEI QSLYW+A+GLIDL+N +LEY+H FTEFIGKLM G++  I+ I+LLNM IAMMN S++ I  ++D EWKFAR +LWIS+F+EGGT P PFNIIPSPKS  Y +  LK  +  CS+ H RSKW+SIRK+VKKVNEKEAR+Q VM+DLIKRYL+ RQK+ + QGVTEDDLNEIKGDIS+FRFEL+EIF+ N M+TPA+   R+ TKLR +GSK+
Sbjct:   83 DLNMNERRYLQAVELGDLATVRRSIESASSLGININCRDSLGRSALHVAIEYEHIELLEVLLAYNLELGDALLHAIQEENIIAVEMLLSSQTERQKKKDLSGLLGTTPSSSFTPDVTPIILAAQIDNYEIIKLLLDRGDRVPKPHELRCACVDCVRAHKEDSLQHSKSRINAYKALASPSLIALSSKDPILTAFELSWEMHRLGRLEHEFREEYENLSADCQKFATALLEQTRSSEELAIVLNQDAGQGN----AKLNDKTLTEGERMNLARLKMAIKYKQKKFVAHPHCQQLLAALWYEGLPGFRRKHMFFQMGMIGTFAGIFPLLSMVYLVAPRSELGQKMRKPFIKFICHSASYMLFLGFLVLAAIRVEDLIMDTLEEKMQERGGAPSIVEWIIVIYILGFVWQEIKQLWGEGIKAYVTDMWNLLDFITNALYVATITLRGVSYYRVHQNSELRSLHRKYWDAYDPTLISECLFAIANIFSMLKLVNIFTINPHLGPLQISLGRMLNDILKFLFVVVLVICSFACGFNQLYWFYAYQRNKYCQDNKFYFGITGTDLDKYSYCVTRGRTFSNLFEITQSLYWSAYGLIDLSNTDLEYEHSFTEFIGKLMYGAFSAITFIVLLNMLIAMMNCSFEEIVAQADTEWKFARGKLWISYFDEGGTLPTPFNIIPSPKSFLYAMAWLKDKVCSCSKRHQRSKWQSIRKVVKKVNEKEARYQSVMRDLIKRYLMVRQKSDDKQGVTEDDLNEIKGDISAFRFELLEIFRTNGMRTPAHMQQRS-TKLRRRGSKR 867          
BLAST of Short transient receptor potential channel 4 vs. TrEMBL
Match: A0A267F969 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013797g1 PE=3 SV=1)

HSP 1 Score: 984.171 bits (2543), Expect = 0.000e+0
Identity = 479/792 (60.48%), Postives = 610/792 (77.02%), Query Frame = 3
Query:  363 ELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYN-LEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLD--LLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMK-DSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRHKGSKK 2726
            +L+ +ER+YLLSVE GD   V+  ++N     +N+NC DSLGR+A+ IAIE EH E+LE+LLS+  LE+ D+LLHAI EEN+ AVE+LL A A + +KK      +    S++FT DITP+ILAAH DNY I+KILLDRGD +PKPH+LRCAC ECV +QKEDSLRHS+SRINAY+ALASPSLICLSSKDPILTAFELSWE+ RLG LENEFK++YE LA +CQ++A+ LL QTR S+ELA +LN D GQ +   ++   +E  + EE MTLSRLKLAIKYKQK FV HPHCQQLL++LWY+GLPG RR   I Q  +I      FPA++  Y+L+P S++G  +++PFIKF+CH  SY+LFL FL + A++VE +LF     ++ +RG  PS  E  I+ Y+ G++WQEIKQL++ G +AY+ DMWNLLDF+TNALY A   LR  A++ ++ D     I R+YW+AY+P LISECLFA ANI S++KLV++FT+NP LGPLQISLGRML DIL F  + VLVL ++A G +QL WFY+++R + CK V   + ITG +LE+YQYC+TRGR FSN+FEI Q+LYW+ +GLIDL+N +LEY+H FTEF+GKLM G +  I+ ++LLNM IAMMN SY+ IA ++D EWKFARS+LWIS+FEEGGT PVPFNIIPSPKS  Y     K  L  CS+ H RSKW+SIRK+VK+VNE+EAR+Q VM+DL+KRYL+ RQ+  E QGVTEDDLNEIKGDIS+FRFEL+EI + N MKTPAYT  R  TKLR +GSK+
Sbjct:   68 DLNSNERRYLLSVEMGDMTSVRQYVENAETLSVNVNCVDSLGRSAVLIAIEFEHIELLEMLLSFGFLELGDALLHAIQEENVVAVEMLLHAQAEKQQKKPQAPGPMGAVPSSSFTPDITPIILAAHIDNYEILKILLDRGDRVPKPHELRCACDECVLAQKEDSLRHSKSRINAYKALASPSLICLSSKDPILTAFELSWEMKRLGRLENEFKSEYEQLAAKCQEYASALLEQTRSSAELAIVLNQDIGQ-SGHKVNEKALEETD-EERMTLSRLKLAIKYKQKKFVAHPHCQQLLAALWYDGLPGFRRKHLILQMGMIATFAGIFPALAFMYLLAPHSEMGQKMRKPFIKFICHSASYLLFLGFLVLAAIRVEDLLFDTMELKMKERGAGPSAVELIIVTYVMGFVWQEIKQLWNEGAKAYVTDMWNLLDFATNALYIATITLRGVAWYRVRQDGNLANIHRQYWDAYDPTLISECLFATANIFSMLKLVYIFTVNPHLGPLQISLGRMLSDILKFLFVVVLVLSSFACGFNQLYWFYAYERNKYCKDVKLGFGITGSDLEKYQYCVTRGRTFSNLFEITQTLYWSTYGLIDLSNTDLEYEHSFTEFVGKLMYGVFSAITFVVLLNMLIAMMNCSYESIATQADTEWKFARSKLWISYFEEGGTLPVPFNIIPSPKSFLYIATWTKERLCSCSKQHQRSKWQSIRKVVKRVNEREARYQTVMRDLVKRYLMVRQRLDERQGVTEDDLNEIKGDISAFRFELLEILRTNGMKTPAYTQHR-ATKLRRRGSKR 856          
BLAST of Short transient receptor potential channel 4 vs. TrEMBL
Match: A0A267DBT5 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003128g1 PE=3 SV=1)

HSP 1 Score: 920.613 bits (2378), Expect = 0.000e+0
Identity = 444/739 (60.08%), Postives = 573/739 (77.54%), Query Frame = 3
Query:  363 ELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNS-SNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTD-RMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQ 2573
            +L+ +ER+YL +VE GD   V+  +++ +   +NINC DSLGR+ALH+AIE EH E+LE+LL+YNLE+ D+LLHAI EENI AVE+LL++   R KKKDL  LLG + S++FT D+TP+ILAA  DNY IIK+LLDRGD +PKPH+LRCAC +CV++ KEDSL+HS+SRINAY+ALASPSLI LSSKDPILTAFELSWE++RLG LE+EF+ +YE L+  CQKFAT LL QTR S ELA +LN D GQ N    + L  ++    E M LSRLK+AIKYKQK FV HPHCQQLL++LWYEGLPG RR     Q  +IG     FP +SM Y+++P+S+LG  +++PFIKF+CH  SYMLFL FL + A++VE ++     E++ +RG  PSI EW I+IY+ G++WQEIKQL+  G++AY+ DMWNLLDF TNALY A   LR  +Y+ +  +++ R + RKYW+AY+P LISECLFA ANI S++KLV +FTINP LGPLQISLGRML DIL F  + VLV+ ++A G +QL WFY++QR + C+   F + ITG +L++Y YC+TRGR FSN+FEI QSLYW+A+GLIDL+N +LEY+H FTEFIGKLM G++  I+ I+LLNM IAMMN S++ I  ++D EWKFAR +LWIS+F+EGGT P PFNIIPSPKS  Y +  LK  +  CS+ H RSKW+SIRK+VKKVNEKEAR+Q VM+DLIKRYL+ RQK+ +N+
Sbjct:   83 DLNMNERRYLQAVELGDLATVRRSIESASSLGININCRDSLGRSALHVAIEYEHIELLEVLLAYNLELGDALLHAIQEENIIAVEMLLSSQTERQKKKDLSGLLGTTPSSSFTPDVTPIILAAQIDNYEIIKLLLDRGDRVPKPHELRCACVDCVRAHKEDSLQHSKSRINAYKALASPSLIALSSKDPILTAFELSWEMHRLGRLEHEFREEYENLSADCQKFATALLEQTRSSEELAIVLNQDAGQGN----AKLNDKTLTEGERMNLSRLKMAIKYKQKKFVAHPHCQQLLAALWYEGLPGFRRKHMFFQMGMIGTFAGIFPLLSMVYLVAPRSELGQKMRKPFIKFICHSASYMLFLGFLVLAAIRVEDLIMDTLEEKMQERGGAPSIVEWIIVIYILGFVWQEIKQLWGEGIKAYVTDMWNLLDFITNALYVATITLRGVSYYRVHQNSELRSLHRKYWDAYDPTLISECLFAIANIFSMLKLVNIFTINPHLGPLQISLGRMLNDILKFLFVVVLVICSFACGFNQLYWFYAYQRNKYCQDNKFYFGITGTDLDKYSYCVTRGRTFSNLFEITQSLYWSAYGLIDLSNTDLEYEHSFTEFIGKLMYGAFSAITFIVLLNMLIAMMNCSFEEIVAQADTEWKFARGKLWISYFDEGGTLPTPFNIIPSPKSFLYAMAWLKDKVCSCSKRHQRSKWQSIRKVVKKVNEKEARYQSVMRDLIKRYLMVRQKSDDNE 817          
BLAST of Short transient receptor potential channel 4 vs. TrEMBL
Match: A0A4Z2DCP6 (Transient receptor potential-gamma protein OS=Schistosoma japonicum OX=6182 GN=EWB00_002257 PE=4 SV=1)

HSP 1 Score: 902.123 bits (2330), Expect = 0.000e+0
Identity = 449/794 (56.55%), Postives = 591/794 (74.43%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSY-NLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGN-SSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHG-QVNTMSISPLRMESAESE---ETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTD-RMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLF--CCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLR 2708
            T  +L+D ER +L + E+GD   +K + D  N+  LN+NC D+LGR  L IAIENEH E+L+ L++  NL++ D +LHAI+E+N+ AVEI+L A   R  KKDL  LLG   S++FT DI  +ILAAHRDNY I+K+LLDRG+ I KPHDLRCAC+ C ++++E+ L+HS+ RIN YRAL SPS I L+S DPILTAFELSWEL +LG LENEF+TDY  L  +CQKFATD+LAQTR S EL+ ILNHD G  V+    S    + + SE   E M LSRLKLAI+Y+QK FV HPHCQQLL+++WYEGLPG R+ P   Q   IG++C+ FP ++ FY+L+P SK+GS++K+PFIKFLCH  SY+ FL  LT+ A +VEF+L  +  +R+ DRGP PS++E A++IY+ G++WQ++K+LY+ GLRAYL DMWNL+DF  NALY A   LR  A+  +    + R I R  W++++PVL+SECLFAAANI+S +KLV++FT++P+LGPLQISLGRML DI  FF +Y LVLVA+AFG +QL WFY+  R   CK V FT    GQ+ + Y YCITRG YF+N+FEI+QSLYW+A+GLIDLT+ NLEY H FTEF+GKL  G+Y YI+ I+LLNM IAMMN+SY+ I  + D EWKFARS+LWISFF EG T PVPFNIIP+PK+  Y +   +  LF  C  +  +R+ W+++R  +K+V E EAR+Q VM++L KRY++Q+ ++ EN  V+ DDL+EIKGDIS+FR EL++I K N MK PAY   + V+KLR
Sbjct:   12 TVGDLNDIERLFLYAAEQGDLATIKQLTDQANELKLNLNCTDTLGRDVLRIAIENEHMELLQFLVALPNLDLKDCILHAINEDNVIAVEIILHAQNERDVKKDLQGLLGRFQSSSFTPDINGIILAAHRDNYVILKLLLDRGERIYKPHDLRCACNICTQARRENGLQHSKLRINTYRALTSPSFIILTSNDPILTAFELSWELKKLGELENEFRTDYAELEAKCQKFATDMLAQTRSSVELSIILNHDTGADVSNCHFSGPNHQPSFSEDISERMQLSRLKLAIRYEQKQFVAHPHCQQLLATIWYEGLPGFRQKPVFAQLTTIGVLCSLFPLMATFYMLAPNSKMGSMMKKPFIKFLCHSSSYLSFLALLTLAATRVEFLLTNSLDQRMHDRGPTPSLTESALVIYVIGFVWQQMKKLYTCGLRAYLMDMWNLVDFVMNALYVATISLRTVAWARIVFYDEPRYINRGQWDSFDPVLVSECLFAAANIVSTLKLVYVFTVSPQLGPLQISLGRMLYDIFRFFCVYFLVLVAFAFGFNQLYWFYAKNRARNCKNVHFTLE-EGQK-DVYDYCITRGTYFTNLFEIVQSLYWSAYGLIDLTSFNLEYPHVFTEFVGKLTFGTYSYIAFIVLLNMLIAMMNSSYEQIVGQVDVEWKFARSKLWISFFGEGCTVPVPFNIIPTPKAFMYMLTSFQE-LFSNCYKKKLHRNDWEAVRLRIKQVKECEARYQSVMRELTKRYIMQKLRSSENDTVSADDLSEIKGDISAFRHELLDILKSNGMKIPAYH--KTVSKLR 800          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Cavefish
Match: trpc4b (short transient receptor potential channel 4-like [Source:NCBI gene;Acc:103045092])

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 367/781 (46.99%), Postives = 504/781 (64.53%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNN--MKTPAYTT 2684
            +E ELS  E+ YL +VERGD   VK  LD    Y  +NINC D LGRTAL IAIENE+ E++ELLLSYN+ + D+LLHAI +E + AVE+LL       +K+    LL    + FT DITP+ILAAH +NY IIK+L+ +G ++P+PH++RC C ECV S   DSLRHSRSR+N YRAL+SPSLI LSS+DP LTAF+LSWEL  L  +ENEFKT+YE L+ QC++FA DLL QTR S EL  ILN          +S L+ + + +E    L+RLKLAIKY+QK FV  P+CQQLL+S WY+  PG RR  +  +      I   FP +S+ Y+++PKS+ G  +++PFIKF+CH  SY+ FL  L + +  +          + + +GP P+  EW I+ ++ G+IW EIKQ++  G + Y+ D WNL+DF  N+LY A   L+I AY           +R  WE + P L++E +FA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y  +    CKG+                C  +   FS +FE +QSL+W+ FGLI L   N++ DH+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ IA+ +D EWKFAR++LW+S+FEEGGT P PFNIIPSPKS  Y I  +K  +F        +     R+  +KV     ++Q V+++L+KRY+    + A   +G+TE++  E+K DISSFR+E++ + K N   + TP  +T
Sbjct:   25 SEAELSCQEKAYLSAVERGDYGSVKRALDEAEIYFKININCVDPLGRTALLIAIENENLELIELLLSYNVHVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSDFTPDITPIILAAHTNNYEIIKLLVQKGVSVPQPHEVRCNCMECVSSSDVDSLRHSRSRLNIYRALSSPSLIALSSEDPFLTAFQLSWELQELSKVENEFKTEYEELSHQCKRFAKDLLDQTRSSRELELILNFRD------DLSLLQDQESNNE----LARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAGKFITCVFIGLLFPTLSICYLVAPKSRYGLFIRKPFIKFICHTASYLTFLFLLLLASQHI-------VSTKPNLQGPAPTTVEWMILPWVLGFIWTEIKQMWDGGFQDYIHDWWNLMDFVMNSLYLATISLKIVAYVKYSGYK----QRDKWEMWHPTLVAEAVFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYDTKDDRVCKGI---------------RCEHQNNAFSTLFETLQSLFWSIFGLIGLYVTNVQADHKFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQHIADHADIEWKFARTKLWMSYFEEGGTLPTPFNIIPSPKSIWYLITWIKIHVFRRKSKRTETFGVLGRRAAEKVRLNN-QYQEVLRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRYEVLGMMKGNRTCLPTPKLST 768          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Cavefish
Match: trpc5a (short transient receptor potential channel 5-like [Source:NCBI gene;Acc:103044006])

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 362/802 (45.14%), Postives = 513/802 (63.97%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEA---CKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEK---EARHQIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTP--AYTTLRNVTKLRHKGSKKG 2729
             E ELS +ER +LL+VE+GD   VK  L     Y  +++NC D LGR+AL IAIENE+ E++ELLL + +   D+LL+AI +E + AVE+LL+      +K+    ++    + FT DITP++LAAH +NY IIK+L+    TIP+PH +RC C ECV S + DSLRHSRSR+N Y+ALASPSLI LSS+DPILTAF L WEL  L  +ENEF+ +YE L++QC++FA DLL Q R S EL TILNH   Q           E  +  E   L++LKLAIKY QK FV  P+CQQLL++LWY+G PG RR  +  +  +  +I   FP  S+ Y+L+P+S LG  +K+PFIKF+CH  SY+ FL  L + +  +           L  +GPPP++ EW I+ ++ G+IW EIK+++  G   Y+ D WNL+DF+ N+LY A   L++ AY     S      R+ WE + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y  Q  +    CKG+                C  +   FS +FE +QSL+W+ FGL++L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+F+EGGT P PFNI+PSPKS  Y    L   L    ++ +  K ++++ L +K  ++      +Q V++ L+KRY+    + A  N+G+TE++  E+K DISSFR+E++++  + N K P   Y++    T LR +GS  G
Sbjct:   28 AEVELSQEERAFLLAVEKGDYAGVKHALQEAEVYYNIDVNCVDPLGRSALLIAIENENLEVMELLLDHGVNTGDALLYAIRKEVVGAVELLLSHRRPSGEKQVPSLMMDAQFSEFTPDITPIMLAAHTNNYEIIKLLVQHKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKRFAKDLLDQARSSRELETILNHRDDQS----------EELDPRECRDLAKLKLAIKYHQKEFVSQPNCQQLLATLWYDGFPGWRRRHWAVKLVMCIIIGLLFPVFSIIYLLAPRSSLGFFIKKPFIKFICHTASYLTFLFLLLLASQHIART-------NLHMQGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFTEYVHDWWNLMDFAMNSLYLATISLKMVAYVKYNSSR----PREEWEMWHPTLMAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETQAADEPNHCKGI---------------RCEKQNNAFSTLFETLQSLFWSIFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIVPSPKSAWYLCCWLHRWLCWRGDAPHSEKHENLKDLTEKHADRIIQNKHYQEVIRSLVKRYVAAMIRSAKTNEGLTEENFKELKQDISSFRYEVMDL--LGNRKPPRRTYSSSSEAT-LRDEGSDDG 790          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Cavefish
Match: trpc4a (short transient receptor potential channel 4-like [Source:NCBI gene;Acc:103035222])

HSP 1 Score: 657.907 bits (1696), Expect = 0.000e+0
Identity = 359/773 (46.44%), Postives = 497/773 (64.29%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFY---SHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMN 2657
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC D LGRTAL IAIENE+ E++ELLLS+N+ + D+LLHAI +E + AVE+LL     R   +    LL    + FT DITP+ILAAH +NY IIK+L+ +G ++P+PH++RC C ECV S   DSLRHSRSR+N YRAL+SPSLI LSS+DP LTAF LSWEL  L  +ENEFK +YE L++QC++FA +LL QTR S EL  ILN+         I+PL     E E    L+RLKLA++Y QK FV  P+CQQLL+S WY+  PG RR  +  +      I   FP  S+FY+++PKS  G  +++PFIKF+CH  SY+ FL  L + +  +          +   +GPPP+  EW I+ ++ G+IW EIKQ++  G + Y+ D WNL+DF  N+LY A   L++ AY     S      R+ W+ + P L++E +FA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y   +    + CKG+                C  +   F+ +FE +QSL+W+ FGLIDL   N+  DH+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ IA+ +D EWKFAR++LW+S+FEEGGT P PFNIIPSPKS  YF+  +K  +F  + +   +     R+  + V     ++Q V+++L+KRY+    + A   +G+TE++  E+K DISSFR+E++ + K N
Sbjct:   25 AESELSPLEKAYLNAVEKGDYASVKQSLEEAEIYFKININCIDPLGRTALLIAIENENLEIIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKQRGGMQVPPILLDKQFSDFTPDITPIILAAHTNNYEIIKLLVQKGVSMPQPHEVRCNCVECVSSSDVDSLRHSRSRLNIYRALSSPSLIALSSEDPFLTAFRLSWELEELSKVENEFKYEYEELSQQCKQFAKNLLDQTRSSRELELILNYRD------DINPL-----EDEGVNDLARLKLAVRYHQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKFITCIFIGLLFPLFSIFYLVAPKSHYGLFIRKPFIKFICHTASYLTFLFLLLLASQHIT-------GSKALSQGPPPNTVEWMILPWVLGFIWAEIKQMWDGGFQDYVHDWWNLMDFVMNSLYLATISLKVVAYLKYSGSN----ARESWDMWHPTLVAEAVFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETDASNSTKWCKGI---------------RCEHQNNAFTTLFETLQSLFWSIFGLIDLHVTNVGPDHRFTEFVGATMFGTYNIISLVVLLNMLIAMMNNSYQHIADHADIEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSVWYFVRWIKRNVFRVAATKTETFGTISRRAAENVRINH-QYQEVLRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRYEVMGMMKGN 759          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Cavefish
Match: trpc5b (transient receptor potential cation channel, subfamily C, member 5b [Source:ZFIN;Acc:ZDB-GENE-091112-24])

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 347/787 (44.09%), Postives = 476/787 (60.48%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNH--DHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEA---CKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEA--RHQIVMKDLIKRY---LIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYT 2681
             E ELS +ER YL +VE+GD   VK  L     Y  +NINC D LGR+AL IAIENE+ E++ELLLS+ +++ D+LL+AI +E + AVE+LL+      +K+    ++ +  + FT DITP++LAAH +NY IIK+L+ R  TIP+PH +RC C ECV S + DSLRHSRSR+N Y+ LASPSLI LSS+DPILTAF L WEL  L  +ENEF+ +YE L++QC+ FA DLL Q R S EL TILNH  DH             E  +  E   L++LKLAIKY QK FV  P+CQQLL++LWY+G PG RR  ++ +      I   FP  S+ Y+L+PKS LG  +K+PFIKF+CH  SY+ FL  L + +  +           L  +GPPP+I EW I+ ++ G+IW EIK+++  G   Y+ D WNL+DF+ N+LY A   L++ AY     S      R+ WE + P LI+E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y  +  +    CKG+                C  +   FS  F II  L  T F L  L +        F +    L        SI M +  FIAM     Q   + +D EWKFAR++LW+S+F+EGGT P PFNIIPSPKS  Y  + L   L  C     R + +   + +K+   K    R++++ ++L+KRY   +I+R K  E  G+TE++  E+K DISSFR+E++++  + N K P  T
Sbjct:   25 AEAELSAEERAYLTAVEKGDYAGVKMALQEAEIYYNININCLDPLGRSALLIAIENENLEVMELLLSHGVQVGDALLYAIRKEVVGAVELLLSHRKPSGEKQVPALMMDSQFSEFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKTLASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQARSSRELETILNHRDDHS------------EELDPRECRDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRRHWVVKLVTCFTIGLLFPVFSIIYLLAPKSALGFFIKKPFIKFICHTASYLTFLFLLLLASQHI-------VRTDLHVQGPPPTIVEWMILPWVLGFIWAEIKEMWDGGFTEYVHDWWNLMDFAMNSLYLATISLKMVAYLKYNSSRP----REEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETEAADEPNHCKGI---------------RCEKQNNAFST-FIIITFL--TVFALTALED-------TFKDLKIPL--------SIAMFITRFIAMFPLPPQ---DHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSVWYLCVWLHSRL--CGRGQPRQEEEHKHENLKEFTVKTVLLRNEVI-RNLVKRYVAAMIRRTKTDE--GLTEENFKELKQDISSFRYEVLDL--LGNRKPPRRT 745          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Cavefish
Match: trpc1 (transient receptor potential cation channel subfamily C member 1 [Source:NCBI gene;Acc:103046331])

HSP 1 Score: 487.649 bits (1254), Expect = 5.156e-157
Identity = 287/777 (36.94%), Postives = 456/777 (58.69%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLT---AMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGL--IDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQ-RQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMK 2666
             +E+ + DE+ +LL+ E+GD   VK +L+ K    LN+NC D LGR A+ IAIENE+ ++L+LLL +  +  D+LL AI  E + AV+ILL      +++P    L+  + N   + T D+ P+ILAAHR+NY I+ +LL +  ++P+PH + C C  C    K+DSLRHSR R++ YR LASPSLI L+ +DPIL AFELS +L  L ++E EF+ DYE LA+QC+ FA DLLAQ R S EL  ILNH   + +      L       EE M LSRLKLAIKY QK FV   +CQQ L+++W+  +   RR     +   +  +   +P +S+ Y+L P+S++G I+  PF+KF+ H  SY  FLL      + +  +++    ++ +  GP   + ++ +I+++ G +W ++K+L+  GL  +L +  N L F  N+LY A F L++ A+   K+  +   ERK W+A  P+L++E LFA AN+LS ++L FM+T +  LGPLQIS+G+ML++   F  +++LVL ++  G+ QL   Y   +++   G   T     +E E     +     F +      +L+W  F L  + L    + Y  +   F+G +++G+Y  + +I+L  + +AM++ S++ IA   DKEWKFAR++LW+S+F++  T P PFNI+PSPK+  Y +  L   +   + +    +  S+R+      + +  +Q +M  L+ RYL   RQK       T ++LN+++ D+S FR E+ ++      K
Sbjct:   38 VKEDTTLDEKLFLLACEKGDYYMVKKLLEEKRHGELNLNCVDVLGRDAVTIAIENENLDILQLLLEHGCQSTDALLVAIDSEVVGAVDILLNHRPRRSSKPSIAKLMQRIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDISLPRPHAVGCECTLCNAKNKKDSLRHSRFRLDIYRCLASPSLIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELAKQCKMFAKDLLAQARNSRELEVILNHTSSEDHVDKRGLL-------EERMNLSRLKLAIKYNQKEFVAQSNCQQFLNTVWFGEMASYRRKHTGLKMGTVLSVALLWPLLSVCYLLGPRSRVGQIIHTPFVKFIIHSASYFTFLL-----LLNLYSLVYNE--DKKNTMGPALEMIDYLLILWIIGMVWSDVKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHSKFKNVDE--TERKNWDASNPILVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQEFGKFLGLFLLVLFSFTIGLTQL---YGKDKKDTTTGKNGT-----EECEGINCPLQSNDTFHSFMGTCYALFWYIFSLAHVALYVTRITYTDELRSFVGAMIVGTYNIVVVIVLTKLLVAMLHKSFRQIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNILPSPKTLCYLVTSLSKWICSHTSTGKVKRQNSLREWRNLKQKHDENYQKIMCCLVHRYLTSTRQKMQSTDQATVENLNDLRQDLSKFRNEMRDLLGFRTSK 790          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Sea Lamprey
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 452.21 bits (1162), Expect = 2.735e-147
Identity = 247/589 (41.94%), Postives = 351/589 (59.59%), Query Frame = 3
Query:  675 GNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICAS----FPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFY---SHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCL 2420
            G+SS  FT D+TP+ILAAH +NY +IK+LL RG ++P+PH +RCAC +C    + D LRHSRSR+  YRALASP L+ L+S+DP LTAF LS EL  L  +ENEFK +YE L++QC++FA +LL QTR + EL  +LN+                + E+ +   L RLKLAIKY QK FV  P+CQQLL+SLWY+G PG RR       AV  + CA+    FP  S+ Y+L+P+S++   L++PFIKF+CH  SY+ FL  L + + ++            + +GP P++ EW I+ ++   IW EIKQ++  G   Y+ D WNL+DF  N+LY A   L++ AY     S      R+ WE + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y   + Q  + CKG+                C  +   FS +   ++ L+ +    + L        H FT       L  Y  I + +  ++ I   N +++   + +D EWKFAR++LW+S+FEEG T P PFNI+PSPKS  Y    ++ C+
Sbjct:    9 GHSSE-FTPDMTPIILAAHTNNYELIKLLLTRGVSVPRPHAVRCACLQCAAGSEADGLRHSRSRLAVYRALASPCLVALASEDPFLTAFTLSCELCELSRVENEFKAEYEELSQQCKQFAKELLDQTRSTRELEIVLNYKEESDG----------APEAPDAFNLERLKLAIKYHQKEFVAQPNCQQLLASLWYDGFPGWRR----RHWAVKLVTCATLGLLFPLFSVCYLLAPRSRMAFFLRKPFIKFICHTASYLTFLFLLLLASQQIA-------RTDPNMQGPSPTLVEWMILPWICRLIWAEIKQMWDGGFSEYVHDWWNLMDFVMNSLYLATISLKLVAYLKYSGSK----AREQWEMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETSAGQGNDTCKGI---------------RCEKQNNAFSTLCNCLKHLFPSVSICVHLCPSGSICFHLFTSVSICFHLFPYVSICVHLFPSVSITSCN-AFKNTVDHADIEWKFARTKLWMSYFEEGATLPPPFNIVPSPKSAWYLCRYVRACI 555          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Sea Lamprey
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 439.884 bits (1130), Expect = 9.405e-143
Identity = 241/591 (40.78%), Postives = 341/591 (57.70%), Query Frame = 3
Query:  696 TSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICAS----FPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFY---SHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLE---------YDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCL 2420
            T D+TP+ILAAH +NY +IK+LL RG ++P+PH +RCAC +C    + D LRHSRSR+  YRALASP L+ L+S+DP LTAF LS EL  L  +ENEFK +YE L++QC++FA +LL QTR + EL  +LN+                + E+ +   L RLKLAIKY QK FV  P+CQQLL+SLWY+G PG RR       AV  + CA+    FP  S+ Y+L+P+S++   L++PFIKF+CH  SY+ FL  L + + ++            + +GP P++ EW I+ ++   IW EIKQ++  G   Y+ D WNL+DF  N+LY A   L++ AY     S      R+ WE + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y   + Q  + CKG+                C  +   FS  F  +       F L    ++ +          Y  +    +    L    + S I+     I    +    + + +D EWKFAR++LW+S+FEEG T P PFNI+PSPKS  Y    ++ C+
Sbjct:    1 TPDMTPIILAAHTNNYELIKLLLTRGVSVPRPHAVRCACLQCAAGSEADGLRHSRSRLAVYRALASPCLVALASEDPFLTAFTLSCELCELSRVENEFKAEYEELSQQCKQFAKELLDQTRSTRELEIVLNYKEESDG----------APEAPDAFNLERLKLAIKYHQKEFVAQPNCQQLLASLWYDGFPGWRR----RHWAVKLVTCATLGLLFPLFSVCYLLAPRSRMAFFLRKPFIKFICHTASYLTFLFLLLLASQQIA-------RTDPNMQGPSPTLVEWMILPWICRLIWAEIKQMWDGGFSEYVHDWWNLMDFVMNSLYLATISLKLVAYLKYSGSK----AREQWEMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETSAGQGNDTCKGI---------------RCEKQNNAFSTWFTSVS----ICFHLFPYVSICVHLFPSVSIFFYTDKRKNMLNAAYLREMHFSSAIVACQTIIRASASDPNHVEDHADIEWKFARTKLWMSYFEEGATLPPPFNIVPSPKSAWYLCRYVRACI 547          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Sea Lamprey
Match: trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:ZFIN;Acc:ZDB-GENE-140129-1])

HSP 1 Score: 405.216 bits (1040), Expect = 2.177e-126
Identity = 273/827 (33.01%), Postives = 418/827 (50.54%), Query Frame = 3
Query:  366 LSDDERKYLLSVERGDAPYVKSIL-DNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNL--EIADSLLHAISEENIEAVEILLTAMATRPKKKDLL----------DLLGNSSNA--FTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAM-KVEFI-LFGNYVER------LSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIE----------------------RKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKS---------------CKY----FILILKHCLFCCSESHNRSKWKSIR----KLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIE 2642
            L+ +E ++L + E G+ P V+ +L D      LN+NC D +G+ A+ +A+ NEH E+ ELLL  +    + D+L+ AIS+  +  VE +L   A   +K+ +L          D      +   F+ DITP+ILAAH   Y I+ ILL RG  I +PHD  C C EC + Q+ D+  HSRSRINAYR LASP+ + LSS+DP+LTA ELS EL  L  +E EFK DY+ L+ QC+ F   LL   R + E+  ILN D        ++P     A   +   L RLKLAIKY+ K                                  IG +  S                      PF+KF+ H  S+ +FL  L + A  + E + L  N  E          +    + +E  I+ ++ G IW E K+L++ GL+ YL  +WN+LDF   +++ A+F  R+ A+    ++  R ++                      R +W   +P +ISE L++ A +LS  ++ ++   N   GPLQISLG+ ++DI  F  ++++V +A+  G+  L   YS+ R                            R F  + E  ++L+W+ FGL ++ ++ + Y+H+F E IG ++ G Y    +++LLNM IAM+N+SYQ I + SD EWKFAR++LWIS+FE+G T PVPFN++PSPKS               C++      L ++  +       N    +++R    + +  + +   R+Q +MK LIKRY+++ Q   EN  V E +L +IK DISS R+EL+E
Sbjct:   37 LTAEEERFLDAAEYGNIPVVRRMLEDGGAGRSLNVNCVDYMGQNAMQLAVGNEHLEVAELLLKRDKLSRVGDALMLAISKGYVRIVEAILAHPAFAGEKRLILSPREQETQDDDFYAYDEDGTRFSPDITPIILAAHCQEYEIVHILLRRGARIERPHDYFCKCGECTEKQRHDAFSHSRSRINAYRGLASPAYLSLSSEDPVLTALELSNELAMLANIEKEFKNDYKKLSVQCKDFVVGLLDLCRDTEEVEAILNGD------AELNP----PACDRQRAALIRLKLAIKYEVKK---------------------------------IGKVLRS----------------------PFMKFVAHAASFTIFLALLVLNASDRFEGVKLLPNETETDHPQQLFRIKTTSFTWTELLIVAWIIGMIWAECKELWAEGLKEYLFQLWNVLDFGMLSIFVASFTARLFAFLKASEA-QRFVDSEGFPNVSNATLPEHIRYFNLARSHWLPSDPQIISEGLYSIAIVLSFSRIAYILPANESFGPLQISLGQTVKDIFKFMVIFIMVFLAFMIGMFNL---YSYYRGAKV-----------------------NRAFVTVEESFKTLFWSIFGLSEVASVVINYNHKFIENIGYILYGVYNVTMVVVLLNMLIAMINSSYQEIEDDSDVEWKFARAKLWISYFEQGRTLPVPFNLVPSPKSAVQLLLAAARALGRLCRWRKHKGKLDVEMDMLDAKAKPNTLTQRALRSNMNRSMNSIGQHPTRYQQIMKRLIKRYVLKAQFDKENDEVNEGELKDIKQDISSLRYELLE 771          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007332.1 (pep scaffold:Pmarinus_7.0:GL483392:1130:9476:1 gene:ENSPMAG00000006613.1 transcript:ENSPMAT00000007332.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 2.825e-16
Identity = 141/609 (23.15%), Postives = 230/609 (37.77%), Query Frame = 3
Query:  636 ATRPKKKDLLDLLGNSSNAFTSD---ITPLILAAHRDNYPIIKILLDRGDT-IPKPHDLRCACHECVKSQKEDSL----RHSRSRINAYRALASPSLIC-------------LSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGL------PGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGS--YMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMW-NLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNL-NLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNII 2369
            AT    + L  LLG  ++   +D    TPL +AA     P ++ LL+ G     +  D R A            L    RHS              ++C             L +  P+  A +L+       + E E   D ++ A  CQ  ATDLL+   GS                 S     +  A  E  ++L  L + I+  Q++   HP  Q  LS +W  GL      P +  L F        L+C   P + + + L    +   I   P IKFLCH  S  ++L L  LT+    +  I  G+ +         PS +EW ++ +L G +  E++Q    G R  LA  W  LL    + L   A    ++A      S   +         E +     L A A     ++L+   + +   GP  I +  +++D+  F  +  +  VA+   +  L           C+ V       G                    ++   L+++ FG+ D  +L ++         +     G Y  +++I+L+N+ IAMM+ +YQ I  +SD +WKF R  L +       T P P N++
Sbjct:   81 ATAGHVETLRLLLGQGADINATDKSGCTPLHVAARAGRLPAVRALLESGAVGSAECRDGRTALEHAAGGGHRHVLALLLRHSTLTAQRLIHFVYDLMVCGRQCEFRVIDEFVLLAPAPLEAAVKLTRAFGAAALREKERSVDLDLAARHCQALATDLLSLAVGSQ----------------SAGAAALLQAVDERGLSL--LDVLIECHQRAVAAHPAVQHHLSDVWRGGLRWPSWCPALLLLGF--------LVC---PPLWVAFSLPLGHRFTRI---PIIKFLCHLASHLFLLSLFVLTVVWPPITPIAEGHLL---------PSWNEWLLLTWLLGLLLAELRQ---GGSRFGLA--WIRLLVLGLSGL---ALLCHLSALAFPAGSHALL---------ECLCARNVLLAKALAFCCVQLLDFLSFHHLFGPWAIIISDLMKDLARFGMVLGIFHVAFTLHLTAL-----------CQPVYPQGDPVGNS-STAAAAWDPSTAAQTTLDVTVLLFFSLFGMGDQNSLPDVSRSPSIVSTLVNATFGVYLIVTLIVLINLLIAMMSDTYQRIQAQSDTQWKFGRVVL-VREATRRTTPPAPLNVV 618          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007334.1 (pep scaffold:Pmarinus_7.0:GL483392:1130:8888:1 gene:ENSPMAG00000006613.1 transcript:ENSPMAT00000007334.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 3.400e-16
Identity = 141/609 (23.15%), Postives = 230/609 (37.77%), Query Frame = 3
Query:  636 ATRPKKKDLLDLLGNSSNAFTSD---ITPLILAAHRDNYPIIKILLDRGDT-IPKPHDLRCACHECVKSQKEDSL----RHSRSRINAYRALASPSLIC-------------LSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGL------PGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGS--YMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMW-NLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNL-NLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNII 2369
            AT    + L  LLG  ++   +D    TPL +AA     P ++ LL+ G     +  D R A            L    RHS              ++C             L +  P+  A +L+       + E E   D ++ A  CQ  ATDLL+   GS                 S     +  A  E  ++L  L + I+  Q++   HP  Q  LS +W  GL      P +  L F        L+C   P + + + L    +   I   P IKFLCH  S  ++L L  LT+    +  I  G+ +         PS +EW ++ +L G +  E++Q    G R  LA  W  LL    + L   A    ++A      S   +         E +     L A A     ++L+   + +   GP  I +  +++D+  F  +  +  VA+   +  L           C+ V       G                    ++   L+++ FG+ D  +L ++         +     G Y  +++I+L+N+ IAMM+ +YQ I  +SD +WKF R  L +       T P P N++
Sbjct:   81 ATAGHVETLRLLLGQGADINATDKSGCTPLHVAARAGRLPAVRALLESGAVGSAECRDGRTALEHAAGGGHRHVLALLLRHSTLTAQRLIHFVYDLMVCGRQCEFRVIDEFVLLAPAPLEAAVKLTRAFGAAALREKERSVDLDLAARHCQALATDLLSLAVGSQ----------------SAGAAALLQAVDERGLSL--LDVLIECHQRAVAAHPAVQHHLSDVWRGGLRWPSWCPALLLLGF--------LVC---PPLWVAFSLPLGHRFTRI---PIIKFLCHLASHLFLLSLFVLTVVWPPITPIAEGHLL---------PSWNEWLLLTWLLGLLLAELRQ---GGSRFGLA--WIRLLVLGLSGL---ALLCHLSALAFPAGSHALL---------ECLCARNVLLAKALAFCCVQLLDFLSFHHLFGPWAIIISDLMKDLARFGMVLGIFHVAFTLHLTAL-----------CQPVYPQGDPVGNS-STAAAAWDPSTAAQTTLDVTVLLFFSLFGMGDQNSLPDVSRSPSIVSTLVNATFGVYLIVTLIVLINLLIAMMSDTYQRIQAQSDTQWKFGRVVL-VREATRRTTPPAPLNVV 618          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Nematostella
Match: EDO45311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ7])

HSP 1 Score: 260.381 bits (664), Expect = 5.030e-76
Identity = 167/546 (30.59%), Postives = 273/546 (50.00%), Query Frame = 3
Query:  711 PLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVL-ISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLW--FYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEG 2339
            PL++AA   NY ++ +L+ +G  + KPH++ C C EC    + D+ R S+ R++ YR LA+P  I ++S DP LTAFELS EL  +   E+E++ DY  L++QC +F   LL + R S E   ILN+           P    S E     +L  +  AI Y QK FV HP CQ L+    +  + G R   F+++ A +      FP +++ Y   P  ++G  +K+PF+KF+ H  S+++FL+ L + +     I F             PS  EW I  ++ G  W E KQ++  G R Y +  WN +D     L   AF L    +    DS  ++       A++ +L  ++ ++A   + S  +L+++  I+  LG LQ+SL RM+R I  F  +  +VL +++  +  L    F ++Q     K V  T  I           + +G  + N+   + +L W +  ++ L  LN+       +F    +   Y   S+++LLNM IAMM+ SYQ + +  + E+KFAR+QLW  +  + 
Sbjct:    1 PLVVAAQLGNYEVLNMLVSKGFQLVKPHNVLCRCEEC----QADNFRESQRRLDIYRGLANPVFISMTSNDPFLTAFELSSELEVIARREDEYEKDYLQLSQQCSQFTIGLLDECRTSREQRCILNY-----------PGENGSVEDYAENSLGLVNSAISYNQKEFVAHPFCQHLVMQHIFGDITGWRTNHFLYRIAYVLTQVIIFPVLAVIYFFMPFLEVGRKIKRPFVKFINHTSSFVVFLILLAVSSHHQFEIRFRKM----------PSGLEWLIFSWILGVAWSECKQVWHEGARRYFSSGWNWMDIGMVFLLLGAFVLWTIIFIVDFDSNAKL-------AHDVLLSTADGMYAFGVVASFFRLIYLCQISRYLGLLQLSLSRMVRVIFQFAFISCVVLWSFSVAMTMLYMSSFEAYQLPRPVKNV--TSDIDA--------ILDKG--YDNLLSTMVTLMWASLDMVGLDTLNVFKKQSLIQFWTAALFTLYHAASMVVLLNMLIAMMSNSYQQVEDNIETEYKFARTQLWTDYIGDA 502          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Nematostella
Match: EDO48346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJX1])

HSP 1 Score: 232.261 bits (591), Expect = 1.686e-65
Identity = 187/621 (30.11%), Postives = 314/621 (50.56%), Query Frame = 3
Query:  561 EIADSLLHAISEENIEAVEILLT------AMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASP---SLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEE-TMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQ-YCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLE--YDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKS 2384
            ++  +LL A+S++N+  V+ LL         + R      L    N SN +   +TPLILA+H ++Y I+K+LL +G TI + HD  C C  C   Q    +  S  R+  YRALASP   SL  LS KDP+  AFEL+ EL  L  +E EF++DY  L++QC++FA  LL Q R  SE+  +          MS+    M+ A ++  + +L  L  AI  K   FV HP+CQ +L+S+ Y       ++    +     L     P  ++ Y  +P S L   L  P +KF+ H G++ LFLL L + +++  FI    ++ +        + S+  I I++ G I QE+K ++  G   YL+  WNL+  +   L+  + G+   A   +  S +  +     E+Y  +L++   F    +L+ +       +N  LGPLQ+SL +M++DIL F  ++ L+ +A+   + ++   YS Q   A K        T   +  Y  +C  +G         ++ ++W  F   +L   N +  +  + T+  G+++   +   SI++ +NM IAMM+ S+Q +A+  D  WKF+R+++W+ +  +G   P PF+++PS  S
Sbjct:   13 DVGAALLQAVSKDNVLYVKALLAYENNNDRFSRRSSSCVNLSKNTNDSNRY---MTPLILASHNNSYDIVKLLLSKGHTIDRVHDRGCLCPWC---QSLGRIGTSLHRLYTYRALASPVYMSLTFLSCKDPVRQAFELNKELVELADIEYEFRSDYLQLSQQCEEFAVALLDQCRDMSEIEQM----------MSVPD--MDGALTKNGSKSLGVLDYAINNKNGRFVAHPYCQMMLNSVIYGDFHTWEKMGVTLKILFALLFTIFIPVWAIVYFFTPTSCLSQKLATPILKFIMHTGAFGLFLLLLILSSIQ-RFISSNTFLLKF-----LFNFSDILITIWIFGLIVQELKDMWRQGKERYLSQWWNLVTLAMLGLFIIS-GILWVAGSALSVSKEGSLA----ESYRFILLANAFFTIGVLLAFLHFSNAVQVNSTLGPLQLSLVKMVKDILKFLLLFFLIYLAFVVALRRV---YS-QYVWAGK--------TPHTISLYSVFCSVQGS--------MRLVFWAIFDKTELEEFNTDPSFPTKITQSTGEVLFALFNIASILVAINMLIAMMSNSFQKVADSEDFLWKFSRTRMWMEYIIKGSVLPAPFSVLPSIAS 584          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Nematostella
Match: EDO49302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH68])

HSP 1 Score: 166.007 bits (419), Expect = 3.591e-43
Identity = 133/528 (25.19%), Postives = 245/528 (46.40%), Query Frame = 3
Query:  369 SDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRS------RINAYRALASPSLICL------SSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFI--HQSAVIGLI-----CASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDIL 1895
            S DE+     V   D   V+S  D +  ++      D + R  L   I+    ++L++ L     I  +L +A+ + + + V+ +L  +++  K+ D+    G       + ++PL+LA H + + II++ L +G  + +PHD      +  +  + +      S      R+NAYRALASP  I         +  PI    EL+ +L      + EF  DY+ +++ CQ+FA DLL Q R + E   +L+  + ++  +     +           LS L LAI+      V HP  Q  L  + Y GL   +R P +  ++S   G +         P +++FYI++P  ++ ++LK P +KF  H G+++LF + L + + +  F          +D    P + +W  ++++ G   QE+K LY  G   Y+   WN++      L+  ++ LR+TAY + + S   + +     + +  L++   FA A + S + L     ++   GPLQ+SL  +  D++
Sbjct:   18 SADEQLLFDLVLNEDVEGVRSFFDLRPDFLFR--TRDFVTRALLSDTIDLNRGDILKIFLDEQARIGGALFNAVRKGSKDCVQTMLPYISS--KRGDI----GPEDVKPGAFVSPLMLAVHLEKFDIIELFLSKGYRVLEPHDDDDEDDDDEQLNRTNVGLELSSELSFNLRVNAYRALASPLYISYFFIMNPDALHPIFHVLELNKKLKNQMYRDFEFNNDYKQISKDCQRFAVDLLEQCRTTDETNVLLD-VYPEIQRVYEKDKKHIEGSHTAFKELSMLNLAIRNDMNELVAHPQSQLRLDKILYHGLYMFKREPRVWRYRSWYTGKLFWLRHTLLLPFLALFYIIAPDCRISNVLKTPMVKFYSHTGAFVLFAIALAVSSFEDHF----------TDYTLIPVLIDWGTLLFVLGLFLQEVKDLYFQGAFRYIRQWWNIISLLMVVLFLISYSLRLTAYLSPQTSPPHL-KNLAVRSSQLSLLANSFFAFAMVFSFIHLTNFLQVSDVFGPLQLSLYMLFADLI 525          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Nematostella
Match: EDO31100 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYW3])

HSP 1 Score: 88.5817 bits (218), Expect = 1.091e-17
Identity = 68/284 (23.94%), Postives = 131/284 (46.13%), Query Frame = 3
Query: 1527 PSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSP 2378
            P+  E+ I+++  G I  E++Q   +  + Y  DMWN LD +    Y     +RI            M +    +    +     ++    +  ++++  +  +N   GPLQ++L RML D+      +V+V++A++F I ++   Y  QR  A        + +G       +C   G   + + +  +SL W+ FGL DL ++    +++    +   +   +  I ++MLLN  +A++N +Y+ I   SD EWK+ R+ ++   +      P P N+I  P
Sbjct:  484 PTAVEYVILVFFLGRILAEVQQYQRSRSKIYFRDMWNYLDITIILCYITIVIVRIVT----------MAKSGPVQGNNLLAGVMYMYGINTLFLILRVSSVLELNRTTGPLQLALMRMLVDLWVIIVQFVVVILAFSFAITKV---YFAQRSLAMGQTETNATYSG-------FCPLDGG--NCLRKTTESLVWSLFGLTDLDSIAT--NNRAASTLAYYLYAIFLVICVVMLLNTLVALLNNTYEDIKSNSDTEWKYVRA-MYADQYNRCHPFPPPVNLITVP 742          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Nematostella
Match: EDO38427 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD04])

HSP 1 Score: 79.7221 bits (195), Expect = 5.575e-15
Identity = 72/332 (21.69%), Postives = 144/332 (43.37%), Query Frame = 3
Query: 1530 SISEWAIIIYLAGYIWQEIKQLYS----------------------------NGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFN-MKDSTDRMIERKYWEAYEPVLISECLFA-AANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSE 2435
            ++ EW I+++  G +  E  QL S                            + LR YL+D WN+LD  T   Y     LR+  + +  K S +R++            ++  L+   A +L++     M       G +QI+L +++  ++  F  ++   VA++  I ++              V  +Y+ T      + +C   G   +  +  ++ L W+  GL D ++L  +    F+E + K++ G +  + ++ML+NM IA+++ +YQ + + S  EW + ++ + I  +      PVPFNI+        F+L++ +    C +
Sbjct:  595 TVVEWLILVFFVGRLLNEAHQLISTKPGENNETSPNEDDSPKPDSRKKNERVDTLRKYLSDRWNILDLLTLLSYVIILILRVITWASRAKVSQNRLLA-----------VAGYLYGLNAMLLTLRVFGHMMESKKSTGAIQIALFQIIGAVVAIFGQFLAATVAFSLAITKIYM------------VEVSYA-TPSSNASHGFCSKPG--LNCWWGAVRHLSWSLLGLADTSSL--DSSDGFSEGLAKVLYGLFLIMGVVMLMNMMIALLSNTYQQVEDNSFYEWSYKKA-ITIRTYSGYHPVPVPFNIV------SLFVLLVGYLWKSCRQ 891          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Medaka
Match: trpc5a (short transient receptor potential channel 5 [Source:NCBI gene;Acc:101169488])

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 362/799 (45.31%), Postives = 511/799 (63.95%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEA---CKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFC------CSESHNRSKWKSIRKLVKKVNE---KEARHQIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPA--YTTLRNVTK 2702
             E ELS +ER YL +VE+GD   VK  L     Y  +++NC D LGR+ L IAIENE+ E++ELLL + +   D+LL+AI +E + AVE+LL+      +K+    ++ +  + FT DITP++LAAH +NY IIK+L+ R  TIP+PH +RC C ECV S + DSLRHSRSR+N Y+ALASPSLI LSS+DPILTAF L WEL  L  +ENEF+ +YE L++QC++FA DLL Q R S EL TILNH             + E  +  +   L++LKLAIKY QK FV  P+CQQLL++LWY+G PG RR  +  +     +I   FP  SM Y+L+PKS LG  +K+PFIKF+CH  SY+ FL  L + +  +           L  +GPPP++ EW I+ ++ G+IW EIK+++  G   Y+ D WNL+DF+ N+LY A   L+I AY     S      R+ WE + P LI+E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y  +  E    CKG+                C  +   FS +FE +QSL+W+ FGL++L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+F+EGGT P PFNIIPSPKS  Y ++ L H   C        ESH   K +++R+  ++  +   +   +Q V+++L+KRY+    + A  ++G+TE++  E+K DISSFR+E++++  + N + P   Y++    TK
Sbjct:   28 AEVELSAEERAYLTAVEKGDYAGVKHALREAEVYYNMDVNCLDPLGRSGLLIAIENENLEIMELLLDHGIHTGDALLYAIRKEVVGAVELLLSHRRPSGEKQVPSLMMDSQFSEFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKRFAKDLLDQARSSRELETILNHRDSD---------QSEELDPRQCHDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRHHWAVKLVTCFIIGLLFPVFSMIYLLAPKSALGRFIKKPFIKFICHTASYLTFLFLLLLASQHIART-------NLHMQGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNSSR----PREEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETKASEEPNNCKGI---------------RCERQNNAFSTLFETLQSLFWSIFGLLNLYVTNVKARHEFTEFVGATMFGTYNIISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSVWYLLMWL-HNRLCRRGQPPGEESH---KCENLREFTERHADSLIQNQHYQEVIRNLVKRYVAAMIRSAKTDEGLTEENFKELKQDISSFRYEVLDL--LGNRRPPRRNYSSSSETTK 785          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Medaka
Match: trpc4b (short transient receptor potential channel 4 [Source:NCBI gene;Acc:101154885])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 370/776 (47.68%), Postives = 501/776 (64.56%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKS-CKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEK-------EARHQIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFK 2651
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC DSLGRTAL IAIENE+ E++ELLLSYN+ + D+LLHAI +E + AVE+LL     R +K+    LL    + FT DITP+ILAAH +NY +IK+LL RG +IP+PH +RC+C EC+ S   D LR+SRSR+N Y+ALASPSLI LSS+DP LTAF+LSWEL  L  +ENEFK++YE L+  C++FA DLL QTR S EL  ILN+         I+P+  ES     T  L+RLKLAIKY QK FV  P+CQQLL+S WY+  PG RR  +  +      I   FP +S+FY++ PKS+ G ++++PF+KF+CH  SY+ FLL L + +  ++    G        +GPPP+  EW I+ ++ G+IW EIKQ++ NGL  Y  D WN++DF  N+LY A   L+I AY  MK           WE + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++Q L+FY    +++C G+                C+ +   FS +FE +QSL+W+ FGL+ L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ IA+ +D EWKFAR++LW+S+FEEGGT P PFNIIPSPKS C  F  I K   FC      R   K IR+  + +  +          +Q V+K+L+KRY+    + A   +G+TE++  E+K DISSFR+E++ + K
Sbjct:   25 AEAELSPMEKAYLGAVEKGDYGSVKQALEEAEIYFRININCIDSLGRTALLIAIENENLEIIELLLSYNVHVGDALLHAIRKEVVGAVELLLNHKKPRGEKQVPGILLDKQFSDFTPDITPIILAAHTNNYEVIKLLLQRGVSIPQPHAVRCSCVECMSSTDVDCLRYSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELKELSRVENEFKSEYEELSHTCKQFAKDLLDQTRSSKELEIILNYRD------DINPILDES-----TNDLARLKLAIKYCQKEFVAQPNCQQLLASRWYDKFPGWRRRHWAGKLITCFFIGLLFPLLSIFYLIFPKSRYGLLIRKPFVKFICHTASYLTFLLLLFLASQHIDST--GPNSLSHDVQGPPPTTVEWMILPWIIGFIWTEIKQMWDNGLEDYADDWWNIMDFIMNSLYLATIALKIVAYVKMKVLYVGCRPLDDWEVWHPTLLAESLFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQ-LYFYYATEEKSCYGI---------------RCLQQNNAFSTLFETVQSLFWSVFGLVSLYVTNVKPPHEFTEFVGTTMFGTYNIISLVVLLNMLIAMMNNSYQHIADHADMEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSVCYLFGWIRKR--FC------RKPAKRIRQTFETLGVRYFQSYLLNHEYQEVLKNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRYEVLGMMK 763          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Medaka
Match: trpc4b (short transient receptor potential channel 4 [Source:NCBI gene;Acc:101154885])

HSP 1 Score: 660.218 bits (1702), Expect = 0.000e+0
Identity = 370/777 (47.62%), Postives = 502/777 (64.61%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKS-CKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQI--------VMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFK 2651
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC DSLGRTAL IAIENE+ E++ELLLSYN+ + D+LLHAI +E + AVE+LL     R +K+    LL    + FT DITP+ILAAH +NY +IK+LL RG +IP+PH +RC+C EC+ S   D LR+SRSR+N Y+ALASPSLI LSS+DP LTAF+LSWEL  L  +ENEFK++YE L+  C++FA DLL QTR S EL  ILN+         I+P+  ES     T  L+RLKLAIKY QK FV  P+CQQLL+S WY+  PG RR  +  +      I   FP +S+FY++ PKS+ G ++++PF+KF+CH  SY+ FLL L + +  ++    G        +GPPP+  EW I+ ++ G+IW EIKQ++ NGL  Y  D WN++DF  N+LY A   L+I AY  MK   D       WE + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++Q L+FY    +++C G+                C+ +   FS +FE +QSL+W+ FGL+ L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ IA+ +D EWKFAR++LW+S+FEEGGT P PFNIIPSPKS C  F  I K   FC      R   K IR+  + +  +  +  +        V+K+L+KRY+    + A   +G+TE++  E+K DISSFR+E++ + K
Sbjct:   25 AEAELSPMEKAYLGAVEKGDYGSVKQALEEAEIYFRININCIDSLGRTALLIAIENENLEIIELLLSYNVHVGDALLHAIRKEVVGAVELLLNHKKPRGEKQVPGILLDKQFSDFTPDITPIILAAHTNNYEVIKLLLQRGVSIPQPHAVRCSCVECMSSTDVDCLRYSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELKELSRVENEFKSEYEELSHTCKQFAKDLLDQTRSSKELEIILNYRD------DINPILDES-----TNDLARLKLAIKYCQKEFVAQPNCQQLLASRWYDKFPGWRRRHWAGKLITCFFIGLLFPLLSIFYLIFPKSRYGLLIRKPFVKFICHTASYLTFLLLLFLASQHIDST--GPNSLSHDVQGPPPTTVEWMILPWIIGFIWTEIKQMWDNGLEDYADDWWNIMDFIMNSLYLATIALKIVAYVKMKVLDD-------WEVWHPTLLAESLFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQ-LYFYYATEEKSCYGI---------------RCLQQNNAFSTLFETVQSLFWSVFGLVSLYVTNVKPPHEFTEFVGTTMFGTYNIISLVVLLNMLIAMMNNSYQHIADHADMEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSVCYLFGWIRKR--FC------RKPAKRIRQTFETLGVRYFQSYLLNIYFFSEVLKNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRYEVLGMMK 757          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Medaka
Match: trpc4b (short transient receptor potential channel 4 [Source:NCBI gene;Acc:101154885])

HSP 1 Score: 657.907 bits (1696), Expect = 0.000e+0
Identity = 369/777 (47.49%), Postives = 502/777 (64.61%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKS-CKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQI--------VMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFK 2651
             E ELS  E+ YL +VE+GD   VK  L+    Y  +NINC DSLGRTAL IAIENE+ E++ELLLSYN+ + D+LLHAI +E + AVE+LL     R +K+    LL    + FT DITP+ILAAH +NY +IK+LL RG +IP+PH +RC+C EC+ S   D LR+SRSR+N Y+ALASPSLI LSS+DP LTAF+LSWEL  L  +ENEFK++YE L+  C++FA DLL QTR S EL  ILN+         I+P+  ES     T  L+RLKLAIKY QK FV  P+CQQLL+S WY+  PG RR  +  +      I   FP +S+FY++ PKS+ G ++++PF+KF+CH  SY+ FLL L + +  ++    G        +GPPP+  EW I+ ++ G+IW EIKQ++ NGL  Y  D WN++DF  N+LY A   L+I AY  MK+          WE + P L++E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++Q L+FY    +++C G+                C+ +   FS +FE +QSL+W+ FGL+ L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ IA+ +D EWKFAR++LW+S+FEEGGT P PFNIIPSPKS C  F  I K   FC      R   K IR+  + +  +  +  +        V+K+L+KRY+    + A   +G+TE++  E+K DISSFR+E++ + K
Sbjct:   25 AEAELSPMEKAYLGAVEKGDYGSVKQALEEAEIYFRININCIDSLGRTALLIAIENENLEIIELLLSYNVHVGDALLHAIRKEVVGAVELLLNHKKPRGEKQVPGILLDKQFSDFTPDITPIILAAHTNNYEVIKLLLQRGVSIPQPHAVRCSCVECMSSTDVDCLRYSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELKELSRVENEFKSEYEELSHTCKQFAKDLLDQTRSSKELEIILNYRD------DINPILDES-----TNDLARLKLAIKYCQKEFVAQPNCQQLLASRWYDKFPGWRRRHWAGKLITCFFIGLLFPLLSIFYLIFPKSRYGLLIRKPFVKFICHTASYLTFLLLLFLASQHIDST--GPNSLSHDVQGPPPTTVEWMILPWIIGFIWTEIKQMWDNGLEDYADDWWNIMDFIMNSLYLATIALKIVAYVKMKNHC-----MDDWEVWHPTLLAESLFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQ-LYFYYATEEKSCYGI---------------RCLQQNNAFSTLFETVQSLFWSVFGLVSLYVTNVKPPHEFTEFVGTTMFGTYNIISLVVLLNMLIAMMNNSYQHIADHADMEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSVCYLFGWIRKR--FC------RKPAKRIRQTFETLGVRYFQSYLLNIYFFSEVLKNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRYEVLGMMK 759          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Medaka
Match: trpc5a (short transient receptor potential channel 5 [Source:NCBI gene;Acc:101169488])

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 361/796 (45.35%), Postives = 506/796 (63.57%), Query Frame = 3
Query:  354 TEEELSDDERKYLLSVERGDAPYVKSILDNKNKYV-LNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEA---CKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFC------CSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQR-QKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPA--YTTLRNVTK 2702
             E ELS +ER YL +VE+GD   VK  L     Y  +++NC D LGR+ L IAIENE+ E++ELLL + +   D+LL+AI +E + AVE+LL+      +K+    ++ +  + FT DITP++LAAH +NY IIK+L+ R  TIP+PH +RC C ECV S + DSLRHSRSR+N Y+ALASPSLI LSS+DPILTAF L WEL  L  +ENEF+ +YE L++QC++FA DLL Q R S EL TILNH             + E  +  +   L++LKLAIKY QK FV  P+CQQLL++LWY+G PG RR  +  +     +I   FP  SM Y+L+PKS LG  +K+PFIKF+CH  SY+ FL  L + +  +           L  +GPPP++ EW I+ ++ G+IW EIK+++  G   Y+ D WNL+DF+ N+LY A   L+I AY     S      R+ WE + P LI+E LFA ANI S ++L+ +FT N  LGPLQISLGRML DIL F  +Y LVL+A+A G++QL ++Y  +  E    CKG+                C  +   FS +FE +QSL+W+ FGL++L   N++  H+FTEF+G  M G+Y  IS+++LLNM IAMMN SYQ+IA+ +D EWKFAR++LW+S+F+EGGT P PFNIIPSPKS  Y ++ L H   C        ESH   K +++R+  +           V+++L+KRY+    + A  ++G+TE++  E+K DISSFR+E++++  + N + P   Y++    TK
Sbjct:   25 AEVELSAEERAYLTAVEKGDYAGVKHALREAEVYYNMDVNCLDPLGRSGLLIAIENENLEIMELLLDHGIHTGDALLYAIRKEVVGAVELLLSHRRPSGEKQVPSLMMDSQFSEFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKRFAKDLLDQARSSRELETILNHRDSD---------QSEELDPRQCHDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRHHWAVKLVTCFIIGLLFPVFSMIYLLAPKSALGRFIKKPFIKFICHTASYLTFLFLLLLASQHIART-------NLHMQGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNSSR----PREEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETKASEEPNNCKGI---------------RCERQNNAFSTLFETLQSLFWSIFGLLNLYVTNVKARHEFTEFVGATMFGTYNIISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSVWYLLMWL-HNRLCRRGQPPGEESH---KCENLREFTE-----------VIRNLVKRYVAAMIRSAKTDEGLTEENFKELKQDISSFRYEVLDL--LGNRRPPRRNYSSSSETTK 768          
BLAST of Short transient receptor potential channel 4 vs. Planmine SMEST
Match: SMESG000078533.1 (SMESG000078533.1)

HSP 1 Score: 1983.38 bits (5137), Expect = 0.000e+0
Identity = 988/991 (99.70%), Postives = 989/991 (99.80%), Query Frame = 3
Query:  246 QPPPGEIELRKKLSKMIDDLNFDIQTGLEKSGISSNTEEELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRHKGSKKGFNRIMRKTNLPGXXXXXXXXXXXXXXXXXLDNMIDKVSKFPNRSEIESTAKKKFPVAFDNEGFQSSESDLQLPTPLTQIIITEEDDTNMRKMSTNFNDASQQPLNVSRFLQDSNIYKRKPSFPSSGSKNDMKHAASADNVQNQTSQSPIGTKPLSEHRRVDMV 3218
            QPPPGEIELRKKLSKMIDDLNFDIQTGLEKSGISSNTEEELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIENEHNEMLELLLSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAII+YL GYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRHKGSKKGFNRIMRKTNLPGNSNNVNNNIINNNNNNNLDNMIDKVSKFPNRSEIESTAKKKFPVAFDNEGFQSSESDLQLPTPLTQIIITEEDDTNMRKMSTNFNDASQQPLNVSRFLQDSNIYKRKPSFPSSGSKNDMKHAASADNVQN TSQSPIGTKPLSEHRRVDMV
Sbjct:   18 QPPPGEIELRKKLSKMIDDLNFDIQTGLEKSGISSNTEEELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIENEHNEMLELLLSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIVYLTGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRHKGSKKGFNRIMRKTNLPGNSNNVNNNIINNNNNNNLDNMIDKVSKFPNRSEIESTAKKKFPVAFDNEGFQSSESDLQLPTPLTQIIITEEDDTNMRKMSTNFNDASQQPLNVSRFLQDSNIYKRKPSFPSSGSKNDMKHAASADNVQNPTSQSPIGTKPLSEHRRVDMV 1008          
BLAST of Short transient receptor potential channel 4 vs. Planmine SMEST
Match: SMESG000039904.1 (SMESG000039904.1)

HSP 1 Score: 928.702 bits (2399), Expect = 0.000e+0
Identity = 465/795 (58.49%), Postives = 598/795 (75.22%), Query Frame = 3
Query:  378 ERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEAC---KGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILK-HCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRHKGSKKGFNRIMRK 2750
            ER++LL+VER D   +K  LD+  K   NINC D LGR A+ IAIE EH E+LELLL Y+L++ D+LLHAI+EEN EAVEI++ A      +K   D   N S++FT DITP+ILA+HRDNY IIK+LLDRGD IPKPHDLRCAC  CV+SQK+DSLRHS+SRINAY+ALASPSLI LSSKDPILTAFELSWEL RLG LENEFK +YE+L+ +C+ FA  LL QTRGS ELA +LNH +G  +  +++    +S    +T  L+RLKLAIKY QKSFV HPHCQQLL+SLWYEGLPG RR PF+++  +I  I A FP ++  Y++ P+S    ++K+PFIKF+CH  SYMLFLL L + A+++E+    N++E    RG  P++ EW +IIY+AG+IWQE+K+L+ NG++ Y+ DMWNLLDF+TN+LY A   LR  AY+   +     + R  W++Y+P LISECLFAAANI S +KLV++FT+NP LGPLQISLGRML DI+ FF +Y+LVLVA+A G++QLLWFY+ +R E C   K   F  +    + E Y YC TRG+YF+++FEI+QSLYW+ +GL+DL+NLNLEY HQFTEF+GKLM G+Y +I++I+LLNM IAMMNTSYQ+IAE++D EWKFARS+LWIS+FE+G T PVPFNII SPK+  Y     K +CL  C     +S+W SI+K+V KVNE E R+Q VM +LI RYL+ RQKA +N+GVTEDDLNEIKGDIS+FRFEL++I K N M     +     +KLR KGSKK  +R+ ++
Sbjct:   58 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNAILIAIEYEHIELLELLLKYDLDLGDALLHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQALASPSLIALSSKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSL--IDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMLFLLLLILAALRIEY----NHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENIISMGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCL--CKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTVNVSSDRGLRSKLRRKGSKKSMSRLNQR 844          
BLAST of Short transient receptor potential channel 4 vs. Planmine SMEST
Match: SMESG000039904.1 (SMESG000039904.1)

HSP 1 Score: 927.546 bits (2396), Expect = 0.000e+0
Identity = 465/795 (58.49%), Postives = 598/795 (75.22%), Query Frame = 3
Query:  378 ERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEAC---KGVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILK-HCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRHKGSKKGFNRIMRK 2750
            ER++LL+VER D   +K  LD+  K   NINC D LGR A+ IAIE EH E+LELLL Y+L++ D+LLHAI+EEN EAVEI++ A      +K   D   N S++FT DITP+ILA+HRDNY IIK+LLDRGD IPKPHDLRCAC  CV+SQK+DSLRHS+SRINAY+ALASPSLI LSSKDPILTAFELSWEL RLG LENEFK +YE+L+ +C+ FA  LL QTRGS ELA +LNH +G  +  +++    +S    +T  L+RLKLAIKY QKSFV HPHCQQLL+SLWYEGLPG RR PF+++  +I  I A FP ++  Y++ P+S    ++K+PFIKF+CH  SYMLFLL L + A+++E+    N++E    RG  P++ EW +IIY+AG+IWQE+K+L+ NG++ Y+ DMWNLLDF+TN+LY A   LR  AY+   +     + R  W++Y+P LISECLFAAANI S +KLV++FT+NP LGPLQISLGRML DI+ FF +Y+LVLVA+A G++QLLWFY+ +R E C   K   F  +    + E Y YC TRG+YF+++FEI+QSLYW+ +GL+DL+NLNLEY HQFTEF+GKLM G+Y +I++I+LLNM IAMMNTSYQ+IAE++D EWKFARS+LWIS+FE+G T PVPFNII SPK+  Y     K +CL  C     +S+W SI+K+V KVNE E R+Q VM +LI RYL+ RQKA +N+GVTEDDLNEIKGDIS+FRFEL++I K N M     +     +KLR KGSKK  +R+ ++
Sbjct:   55 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNAILIAIEYEHIELLELLLKYDLDLGDALLHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQALASPSLIALSSKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSL--IDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMLFLLLLILAALRIEY----NHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENIISMGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCL--CKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTVNVSSDRGLRSKLRRKGSKKSMSRLNQR 841          
BLAST of Short transient receptor potential channel 4 vs. Planmine SMEST
Match: SMESG000077497.1 (SMESG000077497.1)

HSP 1 Score: 867.07 bits (2239), Expect = 0.000e+0
Identity = 431/769 (56.05%), Postives = 578/769 (75.16%), Query Frame = 3
Query:  378 ERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIE-RKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGV---VFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTP 2672
            ER +L++VER D   VKS LDN      NINC DSLGR A+ IAI+NEH ++L+LLL Y ++++D+LL AI EE++E+VE+++ A +T+ + K++ +   +  ++FT DITP+ILAAH+DNY IIK+LLDRGD IPKPHDLRC+C  CV++QK DSL HS SRINAY+ALASP LI LSSKDP+LTAFELSWEL+RL  LENEF ++YE L+++C++FAT LL QTR SSELA +LNH     N+ S+    +   +S +T +L+RLKLAIKY QKSFV +PHCQQLL+S WYEGLPG RR PFI++  +I  +   FP + + Y++ P+SK+G ++++PFIKF+CH  SY++FL  L + A+++EF       E +  R  PP+  E  +++Y+ G+IWQEIK+L+  G++ Y+ DMWNLLDF+TNALY A   LR  AY+   +  + + E R  W++Y+P+LISECLF+AANI S +KLV +FT+NP LGPLQISLGRML DIL FF +Y+LVL+A+A G++QLLWFY+ +R++ C       F  S      + Y YC TRG+YF+N+FEI+QSLYW+ +GL+DLT LNLEY H+FTEF+GKLM G Y  I++++LLNM IAMMNTSYQII EK+D EWKFARS+LWIS+FE+G T PVPFNII SPK+  YF+  +    FC S+   +SKW+SI+K+V KVNE E R+Q VM++L+ RYL+ RQK  + Q VTEDD+NEIKGDIS+FR+EL++I K N M  P
Sbjct:   24 ERLFLMAVERSDISTVKSYLDNAAVLNFNINCRDSLGRNAVLIAIDNEHTDLLQLLLQYEMDLSDALLRAIDEEHLESVELIIAAQSTKTEDKNIDESRSSLISSFTPDITPIILAAHKDNYEIIKVLLDRGDRIPKPHDLRCSCQICVEAQKIDSLHHSMSRINAYKALASPCLIALSSKDPVLTAFELSWELSRLSRLENEFASEYEKLSKKCEEFATALLEQTRESSELAVLLNH-----NSTSVGVNDINYGDSFQTHSLTRLKLAIKYNQKSFVANPHCQQLLASFWYEGLPGFRRKPFIYKLTIISALGFMFPGLGVVYLVFPRSKIGRLMRKPFIKFICHSASYIIFLALLILAALRIEF----TNSEVMESRQNPPTAIECLLVVYICGFIWQEIKELWIAGVKCYIMDMWNLLDFATNALYVATISLRAVAYYKFNNVENLLQEQRPKWDSYDPILISECLFSAANIFSTLKLVSIFTMNPHLGPLQISLGRMLNDILKFFCVYMLVLIAFACGLNQLLWFYAKKRRDICAKSSHRFFQPSEKEPVSDLYNYCATRGKYFTNLFEIVQSLYWSTYGLVDLTYLNLEYPHEFTEFVGKLMFGVYSVITLVVLLNMLIAMMNTSYQIIVEKADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKAIYYFLRWIHLNWFCKSKGR-KSKWQSIKKIVTKVNEMEQRYQKVMENLVMRYLMLRQKKEDKQEVTEDDINEIKGDISAFRYELLDILKSNGMDIP 782          
BLAST of Short transient receptor potential channel 4 vs. Planmine SMEST
Match: SMESG000077497.1 (SMESG000077497.1)

HSP 1 Score: 865.914 bits (2236), Expect = 0.000e+0
Identity = 431/769 (56.05%), Postives = 578/769 (75.16%), Query Frame = 3
Query:  378 ERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRTALHIAIXXXXXXXXXXXXSYNLEIADSLLHAISEENIEAVEILLTAMATRPKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPHDLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFELSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHDHGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLSSLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQPFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEWAIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRITAYFNMKDSTDRMIE-RKYWEAYEPVLISECLFAAANILSVMKLVFMFTINPRLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACKGV---VFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLNLEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEWKFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHNRSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDLNEIKGDISSFRFELIEIFKMNNMKTP 2672
            ER +L++VER D   VKS LDN      NINC DSLGR A+ IAI+NEH ++L+LLL Y ++++D+LL AI EE++E+VE+++ A +T+ + K++ +   +  ++FT DITP+ILAAH+DNY IIK+LLDRGD IPKPHDLRC+C  CV++QK DSL HS SRINAY+ALASP LI LSSKDP+LTAFELSWEL+RL  LENEF ++YE L+++C++FAT LL QTR SSELA +LNH     N+ S+    +   +S +T +L+RLKLAIKY QKSFV +PHCQQLL+S WYEGLPG RR PFI++  +I  +   FP + + Y++ P+SK+G ++++PFIKF+CH  SY++FL  L + A+++EF       E +  R  PP+  E  +++Y+ G+IWQEIK+L+  G++ Y+ DMWNLLDF+TNALY A   LR  AY+   +  + + E R  W++Y+P+LISECLF+AANI S +KLV +FT+NP LGPLQISLGRML DIL FF +Y+LVL+A+A G++QLLWFY+ +R++ C       F  S      + Y YC TRG+YF+N+FEI+QSLYW+ +GL+DLT LNLEY H+FTEF+GKLM G Y  I++++LLNM IAMMNTSYQII EK+D EWKFARS+LWIS+FE+G T PVPFNII SPK+  YF+  +    FC S+   +SKW+SI+K+V KVNE E R+Q VM++L+ RYL+ RQK  + Q VTEDD+NEIKGDIS+FR+EL++I K N M  P
Sbjct:   11 ERLFLMAVERSDISTVKSYLDNAAVLNFNINCRDSLGRNAVLIAIDNEHTDLLQLLLQYEMDLSDALLRAIDEEHLESVELIIAAQSTKTEDKNIDESRSSLISSFTPDITPIILAAHKDNYEIIKVLLDRGDRIPKPHDLRCSCQICVEAQKIDSLHHSMSRINAYKALASPCLIALSSKDPVLTAFELSWELSRLSRLENEFASEYEKLSKKCEEFATALLEQTRESSELAVLLNH-----NSTSVGVNDINYGDSFQTHSLTRLKLAIKYNQKSFVANPHCQQLLASFWYEGLPGFRRKPFIYKLTIISALGFMFPGLGVVYLVFPRSKIGRLMRKPFIKFICHSASYIIFLALLILAALRIEF----TNSEVMESRQNPPTAIECLLVVYICGFIWQEIKELWIAGVKCYIMDMWNLLDFATNALYVATISLRAVAYYKFNNVENLLQEQRPKWDSYDPILISECLFSAANIFSTLKLVSIFTMNPHLGPLQISLGRMLNDILKFFCVYMLVLIAFACGLNQLLWFYAKKRRDICAKSSHRFFQPSEKEPVSDLYNYCATRGKYFTNLFEIVQSLYWSTYGLVDLTYLNLEYPHEFTEFVGKLMFGVYSVITLVVLLNMLIAMMNTSYQIIVEKADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKAIYYFLRWIHLNWFCKSKGR-KSKWQSIKKIVTKVNEMEQRYQKVMENLVMRYLMLRQKKEDKQEVTEDDINEIKGDISAFRYELLDILKSNGMDIP 769          
The following BLAST results are available for this feature:
BLAST of Short transient receptor potential channel 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPC40.000e+046.92transient receptor potential cation channel subfam... [more]
TRPC40.000e+046.92transient receptor potential cation channel subfam... [more]
TRPC40.000e+046.55transient receptor potential cation channel subfam... [more]
TRPC50.000e+044.83transient receptor potential cation channel subfam... [more]
TRPC40.000e+047.62transient receptor potential cation channel subfam... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp-20.000e+046.50TRP (Transient receptor potential) channel family;... [more]
trp-20.000e+046.96TRP (Transient receptor potential) channel family;... [more]
trp-12.196e-16636.56Transient-receptor-potential-like protein [Source... [more]
trp-11.644e-16337.08Transient-receptor-potential-like protein [Source... [more]
spe-413.502e-2520.99TRP homologous cation channel protein; TRP-3 chann... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpgamma0.000e+049.14gene:FBgn0032593 transcript:FBtr0335144[more]
Trpgamma0.000e+048.54gene:FBgn0032593 transcript:FBtr0080945[more]
Trpgamma0.000e+048.54gene:FBgn0032593 transcript:FBtr0080946[more]
trpl0.000e+043.72gene:FBgn0005614 transcript:FBtr0088471[more]
trpl0.000e+043.72gene:FBgn0005614 transcript:FBtr0301662[more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc4b0.000e+046.34transient receptor potential cation channel, subfa... [more]
trpc4b0.000e+046.34transient receptor potential cation channel, subfa... [more]
trpc5a0.000e+045.14transient receptor potential cation channel, subfa... [more]
trpc5a0.000e+045.24transient receptor potential cation channel, subfa... [more]
trpc5a0.000e+045.24transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hint10.000e+047.23histidine triad nucleotide binding protein 1 [Sour... [more]
TRPC50.000e+044.93transient receptor potential cation channel, subfa... [more]
TRPC16.484e-16638.31transient receptor potential cation channel, subfa... [more]
TRPC11.530e-16538.50transient receptor potential cation channel, subfa... [more]
TRPC17.425e-16538.50transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpc40.000e+045.71transient receptor potential cation channel, subfa... [more]
Trpc40.000e+046.79transient receptor potential cation channel, subfa... [more]
Trpc50.000e+044.96transient receptor potential cation channel, subfa... [more]
Trpc14.189e-16839.03transient receptor potential cation channel, subfa... [more]
Trpc11.138e-15736.75transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VJJ7|TRPG_DROME0.000e+048.54Transient receptor potential-gamma protein OS=Dros... [more]
sp|Q9QUQ5|TRPC4_MOUSE0.000e+045.71Short transient receptor potential channel 4 OS=Mu... [more]
sp|P79100|TRPC4_BOVIN0.000e+046.79Short transient receptor potential channel 4 OS=Bo... [more]
sp|Q9UBN4|TRPC4_HUMAN0.000e+046.92Short transient receptor potential channel 4 OS=Ho... [more]
sp|O35119|TRPC4_RAT0.000e+046.66Short transient receptor potential channel 4 OS=Ra... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FS730.000e+060.63ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267DGY40.000e+060.63ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267F9690.000e+060.48Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DBT50.000e+060.08ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A4Z2DCP60.000e+056.55Transient receptor potential-gamma protein OS=Schi... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc4b0.000e+046.99short transient receptor potential channel 4-like ... [more]
trpc5a0.000e+045.14short transient receptor potential channel 5-like ... [more]
trpc4a0.000e+046.44short transient receptor potential channel 4-like ... [more]
trpc5b0.000e+044.09transient receptor potential cation channel, subfa... [more]
trpc15.156e-15736.94transient receptor potential cation channel subfam... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc4b2.735e-14741.94transient receptor potential cation channel, subfa... [more]
trpc4b9.405e-14340.78transient receptor potential cation channel, subfa... [more]
trpc32.177e-12633.01transient receptor potential cation channel, subfa... [more]
ENSPMAT00000007332.12.825e-1623.15pep scaffold:Pmarinus_7.0:GL483392:1130:9476:1 gen... [more]
ENSPMAT00000007334.13.400e-1623.15pep scaffold:Pmarinus_7.0:GL483392:1130:8888:1 gen... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO453115.030e-7630.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483461.686e-6530.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493023.591e-4325.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311001.091e-1723.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384275.575e-1521.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc5a0.000e+045.31short transient receptor potential channel 5 [Sour... [more]
trpc4b0.000e+047.68short transient receptor potential channel 4 [Sour... [more]
trpc4b0.000e+047.62short transient receptor potential channel 4 [Sour... [more]
trpc4b0.000e+047.49short transient receptor potential channel 4 [Sour... [more]
trpc5a0.000e+045.35short transient receptor potential channel 5 [Sour... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078533.10.000e+099.70SMESG000078533.1[more]
SMESG000039904.10.000e+058.49SMESG000039904.1[more]
SMESG000039904.10.000e+058.49SMESG000039904.1[more]
SMESG000077497.10.000e+056.05SMESG000077497.1[more]
SMESG000077497.10.000e+056.05SMESG000077497.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026628 ID=SMED30026628|Name=Short transient receptor potential channel 4|organism=Schmidtea mediterranea sexual|type=transcript|length=3375bp
TAATATTTTGAGAGATTTTATTCGTTGTTTTCCACAAGAGAAAGAGATAT
CTCTCGATGCATTCTCAATTCTCTACATATACTCAGCACATGAGATTATT
GGCTAGGGCGGTTACCCATTTATGCAATAGCTTTCTCAATTACTAAATTT
CCAATTAACACTTCCGATTCCCAGATTGAACAATTCAAAAACAAATGAGT
GATTCCAATAACAGTAATGATAATGGTAATAATTTGAATGACTTGCAACC
ACCCCCCGGTGAAATTGAATTGAGAAAAAAATTATCAAAAATGATTGATG
ATTTGAATTTTGATATTCAAACCGGTCTGGAAAAGTCAGGAATCTCATCG
AACACAGAGGAAGAATTGTCAGATGACGAGAGGAAATATTTACTATCTGT
CGAAAGAGGTGACGCTCCGTATGTGAAATCGATACTTGACAACAAAAATA
AATATGTTTTGAATATCAACTGTGCCGATTCGTTGGGAAGAACTGCCTTG
CACATTGCCATCGAGAATGAACACAACGAAATGCTGGAGCTTTTATTGTC
ATACAATTTAGAAATCGCCGATTCTCTACTACATGCCATTTCAGAAGAAA
ATATCGAAGCAGTGGAAATTCTTCTAACAGCAATGGCCACCAGACCTAAA
AAGAAAGATTTACTTGATTTATTGGGGAATTCTTCTAACGCATTTACATC
TGATATTACTCCTTTAATTCTCGCGGCTCATAGAGACAATTATCCCATTA
TTAAAATTCTTCTCGATCGCGGTGACACAATTCCTAAACCCCATGACCTT
CGATGCGCTTGTCATGAATGCGTAAAATCTCAAAAAGAGGACAGCTTGAG
ACATTCTCGATCACGTATTAACGCATACAGAGCTCTAGCAAGTCCATCAC
TTATTTGCTTGTCTAGTAAGGATCCTATATTAACTGCATTCGAGCTTAGC
TGGGAGTTGAATAGACTGGGGATTTTAGAAAACGAATTTAAAACTGACTA
CGAAATGCTTGCAGAGCAATGCCAAAAGTTTGCAACAGACCTATTAGCCC
AAACTCGTGGATCGTCAGAGCTAGCGACAATACTCAATCATGACCATGGG
CAAGTGAATACGATGTCAATTAGTCCTTTGAGAATGGAATCAGCTGAATC
CGAAGAAACGATGACTTTATCCCGACTGAAGTTAGCGATTAAATACAAAC
AAAAAAGTTTTGTGGTACATCCTCATTGCCAACAACTGCTCTCGTCTCTT
TGGTATGAGGGTCTCCCAGGTATTCGCCGTTTACCTTTCATCCATCAGAG
TGCCGTTATTGGGTTGATATGTGCCTCTTTTCCCGCAATTTCTATGTTTT
ATATTTTATCTCCGAAGAGCAAATTAGGATCAATATTGAAACAGCCCTTC
ATTAAGTTTCTTTGCCATCAAGGCAGCTACATGCTATTTCTATTATTTCT
TACAATATGCGCAATGAAAGTGGAGTTCATTCTTTTCGGGAACTACGTAG
AGCGACTAAGTGATCGCGGTCCCCCTCCAAGCATTTCCGAGTGGGCCATT
ATTATATATCTGGCGGGATATATTTGGCAAGAAATAAAACAGCTATATTC
AAATGGACTACGAGCCTACCTAGCTGACATGTGGAATTTGTTGGATTTCT
CCACTAATGCTCTATATAGTGCCGCATTTGGATTGAGAATAACAGCTTAT
TTTAATATGAAAGACAGTACGGATCGAATGATTGAGAGAAAGTACTGGGA
AGCATACGAGCCTGTGCTTATTTCCGAATGTCTGTTTGCTGCTGCCAATA
TTTTGAGTGTTATGAAGCTAGTATTTATGTTTACAATCAACCCAAGACTT
GGACCATTACAGATTTCACTGGGAAGGATGCTCAGAGACATTTTAAATTT
TTTCTCCATGTATGTACTAGTATTGGTTGCATACGCCTTTGGAATTCATC
AATTGTTATGGTTTTATTCACACCAGAGGCAAGAGGCTTGTAAAGGTGTT
GTATTTACTTATTCAATTACTGGCCAAGAACTTGAAAGATATCAGTATTG
CATAACAAGAGGTCGTTATTTTTCAAATATTTTTGAGATAATCCAATCTC
TCTATTGGACTGCATTCGGACTGATAGATTTGACGAATCTCAATTTGGAG
TATGACCACCAATTTACTGAATTCATAGGCAAACTTATGTTGGGATCATA
CTGCTATATATCAATTATAATGCTGCTAAATATGTTTATTGCCATGATGA
ATACTTCTTATCAAATTATAGCCGAAAAATCAGACAAAGAATGGAAATTT
GCAAGATCCCAGCTGTGGATAAGTTTCTTTGAAGAAGGAGGAACTACTCC
AGTTCCATTTAACATTATCCCTTCACCAAAATCTTGCAAATACTTCATTC
TTATACTAAAACATTGTCTGTTCTGTTGCAGTGAGAGTCACAATAGGAGT
AAATGGAAAAGTATCAGGAAATTGGTCAAAAAAGTCAATGAAAAAGAAGC
CAGGCATCAAATCGTTATGAAAGACTTAATCAAGAGATATCTTATTCAAA
GACAGAAAGCAGGAGAAAATCAAGGAGTTACAGAAGATGATCTCAATGAA
ATTAAAGGAGATATTAGTTCATTTCGGTTTGAGCTCATTGAAATATTTAA
AATGAACAACATGAAAACTCCAGCATATACAACATTGAGAAATGTGACCA
AATTAAGGCACAAAGGAAGTAAAAAAGGATTTAATCGAATAATGCGCAAA
ACAAATCTGCCCGGGAATTCCAACAATGTGAATAATAATATTATTAATAA
CAATAACAATAACAATCTTGACAATATGATTGATAAAGTATCAAAATTCC
CAAATAGAAGTGAAATTGAATCGACCGCCAAAAAGAAATTTCCTGTGGCT
TTTGACAATGAAGGATTTCAAAGTTCCGAATCAGATTTGCAACTACCGAC
TCCATTAACTCAGATTATAATTACGGAAGAAGATGATACCAATATGAGAA
AAATGAGCACAAACTTTAACGATGCAAGCCAGCAACCACTGAATGTATCA
AGGTTTCTTCAAGATTCCAATATTTATAAGAGAAAGCCTAGCTTTCCCTC
TTCTGGTAGTAAAAATGACATGAAACATGCAGCGAGTGCCGATAATGTCC
AGAATCAAACTTCACAATCACCCATTGGCACTAAACCCTTATCAGAACAT
CGTCGAGTTGATATGGTTTAAATTCAACATTATGTTTGGCCTATGCCACT
TGGACTTGCCTTATGAAACCTATTGGATATTCTTTCTGCACACAGCTTTA
AAAAAGGCATGGAACCAATTCCAATGAATATTTTCACATCGTTCTATCTA
TAAACACTAAATAAAATGTCTCAGC
back to top

protein sequence of SMED30026628-orf-1

>SMED30026628-orf-1 ID=SMED30026628-orf-1|Name=SMED30026628-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1009bp
MSDSNNSNDNGNNLNDLQPPPGEIELRKKLSKMIDDLNFDIQTGLEKSGI
SSNTEEELSDDERKYLLSVERGDAPYVKSILDNKNKYVLNINCADSLGRT
ALHIAIENEHNEMLELLLSYNLEIADSLLHAISEENIEAVEILLTAMATR
PKKKDLLDLLGNSSNAFTSDITPLILAAHRDNYPIIKILLDRGDTIPKPH
DLRCACHECVKSQKEDSLRHSRSRINAYRALASPSLICLSSKDPILTAFE
LSWELNRLGILENEFKTDYEMLAEQCQKFATDLLAQTRGSSELATILNHD
HGQVNTMSISPLRMESAESEETMTLSRLKLAIKYKQKSFVVHPHCQQLLS
SLWYEGLPGIRRLPFIHQSAVIGLICASFPAISMFYILSPKSKLGSILKQ
PFIKFLCHQGSYMLFLLFLTICAMKVEFILFGNYVERLSDRGPPPSISEW
AIIIYLAGYIWQEIKQLYSNGLRAYLADMWNLLDFSTNALYSAAFGLRIT
AYFNMKDSTDRMIERKYWEAYEPVLISECLFAAANILSVMKLVFMFTINP
RLGPLQISLGRMLRDILNFFSMYVLVLVAYAFGIHQLLWFYSHQRQEACK
GVVFTYSITGQELERYQYCITRGRYFSNIFEIIQSLYWTAFGLIDLTNLN
LEYDHQFTEFIGKLMLGSYCYISIIMLLNMFIAMMNTSYQIIAEKSDKEW
KFARSQLWISFFEEGGTTPVPFNIIPSPKSCKYFILILKHCLFCCSESHN
RSKWKSIRKLVKKVNEKEARHQIVMKDLIKRYLIQRQKAGENQGVTEDDL
NEIKGDISSFRFELIEIFKMNNMKTPAYTTLRNVTKLRHKGSKKGFNRIM
RKTNLPGNSNNVNNNIINNNNNNNLDNMIDKVSKFPNRSEIESTAKKKFP
VAFDNEGFQSSESDLQLPTPLTQIIITEEDDTNMRKMSTNFNDASQQPLN
VSRFLQDSNIYKRKPSFPSSGSKNDMKHAASADNVQNQTSQSPIGTKPLS
EHRRVDMV*
back to top
Aliases
The feature 'Short transient receptor potential channel 4' has the following synonyms
Synonym
trpc-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002153TRPC_channel
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR005821Ion_trans_dom
IPR013555TRP_dom
Vocabulary: biological process
TermDefinition
GO:0070588calcium ion transmembrane transport
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0006816calcium ion transport
GO:0006828manganese ion transport
GO:0014051gamma-aminobutyric acid secretion
GO:0048709oligodendrocyte differentiation
GO:0051480regulation of cytosolic calcium ion concentration
GO:0070509calcium ion import
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0005901caveola
GO:0005911cell-cell junction
GO:0009986cell surface
GO:0016021integral component of membrane
GO:0016323basolateral plasma membrane
GO:0030863cortical cytoskeleton
GO:0034704calcium channel complex
GO:0043234protein complex
GO:0045121membrane raft
Vocabulary: molecular function
TermDefinition
GO:0005262calcium channel activity
GO:0005515protein binding
GO:0005216ion channel activity
GO:0008013beta-catenin binding
GO:0015279store-operated calcium channel activity
GO:0045296cadherin binding
GO:0070679inositol 1,4,5 trisphosphate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002153Transient receptor potential channel, canonicalPRINTSPR01097TRNSRECEPTRPcoord: 689..702
score: 62.18
coord: 717..730
score: 73.53
coord: 667..688
score: 52.41
IPR002153Transient receptor potential channel, canonicalPANTHERPTHR10117TRANSIENT RECEPTOR POTENTIAL CHANNELcoord: 51..883
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 169..198
e-value: 0.084
score: 22.0
coord: 97..126
e-value: 5.1E-4
score: 29.3
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 97..124
score: 9.671
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 413..696
e-value: 5.8E-24
score: 84.7
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 71..146
e-value: 1.7E-6
score: 28.5
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 90..201
score: 11.771
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 40..311
e-value: 1.2E-18
score: 69.3
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 69..193
IPR013555Transient receptor ion channel domainPFAMPF08344TRP_2coord: 204..266
e-value: 3.1E-29
score: 101.0
NoneNo IPR availableTIGRFAMTIGR00870TIGR00870coord: 51..813
e-value: 2.8E-215
score: 714.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..17
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 955..1008
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 955..997
NoneNo IPR availablePANTHERPTHR10117:SF51TRANSIENT RECEPTOR POTENTIAL PROTEINcoord: 51..883
NoneNo IPR availableTMHMMTMhelixcoord: 367..389
NoneNo IPR availableTMHMMTMhelixcoord: 524..546
NoneNo IPR availableTMHMMTMhelixcoord: 664..683
NoneNo IPR availableTMHMMTMhelixcoord: 410..432
NoneNo IPR availableTMHMMTMhelixcoord: 569..591
NoneNo IPR availableTMHMMTMhelixcoord: 625..644
NoneNo IPR availableTMHMMTMhelixcoord: 482..504