beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3

Overview
Namebeta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
Smed IDSMED30026622
Length (bp)1438
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 (SMED30026622) t-SNE clustered cells

Violin plots show distribution of expression levels for beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 (SMED30026622) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 (SMED30026622) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 (SMED30026622) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026622

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026622SMESG000008883.1 SmedASXL_009074SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30026622SMESG000008883.1 SmedASXL_009073SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30026622SMESG000008883.1 dd_Smed_v4_12381_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30026622SMESG000008883.1 dd_Smed_v6_12381_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30026622SMESG000008883.1 SMED30026622smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026622SMESG000008883.1 SMED30026622smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30026622SMESG000008883.1 dd_Smed_v4_12381_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026622SMESG000008883.1 SMED_09489_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30026622SMESG000008883.1 SMED_09489_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT1 (glucosaminyl (N-acetyl) transferase 1 [Source:HGNC Symbol;Acc:HGNC:4203])

HSP 1 Score: 186.422 bits (472), Expect = 3.204e-53
Identity = 108/332 (32.53%), Postives = 170/332 (51.20%), Query Frame = 2
Query:  344 NIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEG---------VYKKRNE------ERIPHIKM--PFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQL--RIPGSYIGNPDEITS-------EYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            N+ S C +F+  + Y     SKEE  FP+++SI+       ++RLLR IY P N+YCIHVD KS+  +L A+  + +C    ++N+        V +   S + ADLNCMK+LY    +WKY INL G +FP+KTN E+V+ L    G NNLE           +KKR E           +KM  P     F GS +  V+R+++ Y+ ++ K + L+   +    PDE  ++T+   P++   +P S+  +  ++ +       +YF         YP      VR +CI+GAGDL  ++   +LFANKF  +     ++CL+  +  K 
Sbjct:   95 NMTSDCSSFIKRRKYIVEPLSKEEAEFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASC----FSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPEVPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT1 (glucosaminyl (N-acetyl) transferase 1 [Source:HGNC Symbol;Acc:HGNC:4203])

HSP 1 Score: 186.422 bits (472), Expect = 3.204e-53
Identity = 108/332 (32.53%), Postives = 170/332 (51.20%), Query Frame = 2
Query:  344 NIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEG---------VYKKRNE------ERIPHIKM--PFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQL--RIPGSYIGNPDEITS-------EYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            N+ S C +F+  + Y     SKEE  FP+++SI+       ++RLLR IY P N+YCIHVD KS+  +L A+  + +C    ++N+        V +   S + ADLNCMK+LY    +WKY INL G +FP+KTN E+V+ L    G NNLE           +KKR E           +KM  P     F GS +  V+R+++ Y+ ++ K + L+   +    PDE  ++T+   P++   +P S+  +  ++ +       +YF         YP      VR +CI+GAGDL  ++   +LFANKF  +     ++CL+  +  K 
Sbjct:   95 NMTSDCSSFIKRRKYIVEPLSKEEAEFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASC----FSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPEVPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT1 (glucosaminyl (N-acetyl) transferase 1 [Source:HGNC Symbol;Acc:HGNC:4203])

HSP 1 Score: 186.422 bits (472), Expect = 3.204e-53
Identity = 108/332 (32.53%), Postives = 170/332 (51.20%), Query Frame = 2
Query:  344 NIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEG---------VYKKRNE------ERIPHIKM--PFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQL--RIPGSYIGNPDEITS-------EYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            N+ S C +F+  + Y     SKEE  FP+++SI+       ++RLLR IY P N+YCIHVD KS+  +L A+  + +C    ++N+        V +   S + ADLNCMK+LY    +WKY INL G +FP+KTN E+V+ L    G NNLE           +KKR E           +KM  P     F GS +  V+R+++ Y+ ++ K + L+   +    PDE  ++T+   P++   +P S+  +  ++ +       +YF         YP      VR +CI+GAGDL  ++   +LFANKF  +     ++CL+  +  K 
Sbjct:   95 NMTSDCSSFIKRRKYIVEPLSKEEAEFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASC----FSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPEVPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 178.718 bits (452), Expect = 1.219e-50
Identity = 135/423 (31.91%), Postives = 204/423 (48.23%), Query Frame = 2
Query:   95 ISFRKFYLFFFTLLAICIIVGYFRSVLSPANQIVQSFKNLSIQSSEPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYK-----KRNE----------------ERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPG-----SYIGNPDEITSEYFMTRYKNW-GQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTG 1282
            ++F ++  F FTLL++ I V ++ S LSP     +S++ L+  SSE       +    N +L   EK  V L + +  S L       C  +L+  +Y ++  S+EE  FPL++ ++  K     ERL R IY P N YC+HVD K+  ++  ++  L++C     N  + +K    V +  +S L ADLNC+K+L      WKY IN  GQ+FPLKTN E+V+ L  +KG N   GV       KR +                  I     P  +  + G+ ++ + RDF+ ++    ++  LL   K    PDE F+ TLN      +PG     S+ GN   I       R+    G Y       V GICI+G GDL  LV +P+LFANKF     P T+ CLE    ++   +++T 
Sbjct:    1 MNFWRYCFFAFTLLSVVIFVRFYSSQLSPP----KSYEKLN-SSSE----RYFRKTACNHAL---EKMPVFLWENILPSPLRS---VPCKDYLTQNHYITSPLSEEEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQ---NAFIASKTE-SVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTRDFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTLNRVSG--VPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHY-------VHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETA 395          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 177.948 bits (450), Expect = 2.385e-50
Identity = 119/351 (33.90%), Postives = 175/351 (49.86%), Query Frame = 2
Query:  320 LTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVY---------KKRNEE----------RIPHIKMPFP--VVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPG--------SYIGNPDEITSEYFMTRYKN-WGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTG 1282
            L  ++L+ +  SSC  +L+  +Y +   SKEE +FPL++ ++         RL R IY P N YC+HVD K+  +F  A++ L++C    + N         V +G +S L ADLNC+++L      WKY IN  GQ+FPLKTN E+V+ L  +KG N   GV          K  ++E          R   +K P P  +  + GS ++ ++R+F  ++   P++  LL   K    PDE F+ TLN     RIPG        S+ GN   I       R+    G Y       V GICI+G GDL  LV +P+LFANKF     P T+ CLE    ++   +++T 
Sbjct:   59 LWKNKLMIHEKSSCKEYLTQSHYITAPLSKEEADFPLAYIMVIHHHFDTFARLFRAIYMPQNIYCVHVDEKATTEFKDAVEQLLSC----FPNAFLASKMEPVVYGGISRLQADLNCIRDLSAFEVSWKYVINTCGQDFPLKTNKEIVQYLKGFKGKNITPGVLPPAHAIGRTKYVHQEHLGKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLHDPRAVDLLQWSKDTFSPDEHFWVTLN-----RIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHY-------VHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETA 393          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-17 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:O02315])

HSP 1 Score: 146.362 bits (368), Expect = 3.730e-39
Identity = 101/320 (31.56%), Postives = 158/320 (49.38%), Query Frame = 2
Query:  344 NIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLE-GVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQL-RIPGSYIGNPDEITSEY--FMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRC-LERWIHDKVQKEAQTGTV 1288
            N    C T  S   +     S+EE  FPLSF +L +K  SQ+  LL +IY+P N YCI V   S   FL  +  L NC  + Y        R  +KWG   ++ +   C++ L     DWKYF  L+G + PLKTN E+V+IL    G  N+    Y+ R        + P P+  FK S+   + R    Y+  S   + LL  ++   + DE F+ TL  N  L  +PGS+  N D +T+ +  +++R++ W +  C  N +    C++G GD+P L+ +  L A+K + E +P    C L+R  H  +  +  + ++
Sbjct:   81 NSTDRCQTLTSMFRFNKVPLSEEEARFPLSFGLLVYKELSQVLFLLSSIYQPQNEYCIAVGENSAPAFLILLKELANCFPNVY-----FMKRPPIKWGSFEIINSVYGCLEFLSHLKSDWKYFQYLSGVDIPLKTNLEMVRILKRLNGTVNIGISTYEDRLLNGKNKTESPLPL--FKSSLSSLIPRKAANYLSSSSVPQQLLEFLRTTWVADEGFWGTLFGNKDLFNVPGSFNFN-DPLTNGWGNYVSRHQLWVESEC-HNYMKDRSCVFGIGDVPNLMKSRALVAHKLYIESEPEAFFCLLKRHRHRTINPDLTSDSL 391          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-16 (GLY-16; GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:G5EDP7])

HSP 1 Score: 143.28 bits (360), Expect = 9.203e-38
Identity = 123/416 (29.57%), Postives = 197/416 (47.36%), Query Frame = 2
Query:  155 GYFRSVLSPANQIVQSFKNLSIQSSEP--DCYELLKPNVEN--KSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLE-GVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQL-RIPGSY------------IGNPDEITSE--YFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEF----YSSLPFVK 1330
            G F  V    + ++ ++  ++  SS P  D  + L+ N  N  + L++ EK +  +N  + + +L  N    C T  S   +     S+EE  FPLS+ +L +K  SQ+  +L +IY+P N YCI V   S   FL  ++ L +C  +     V+   R  + WG   ++ +  +C+K L     +WKYF  L+G + PLKTN E+V+IL +  G  N+E  VY+ R        + P P+  FK S+   + R    Y+  S   + LL  ++   + DE F+ TL  N  L  +PGS               N  + T    Y+++R++ W +  C  N +  G C++G GD+  L+ A  L A+K +   +P    CL         KE +  T+  DS F    YS LP V+
Sbjct:    6 GSFSCVAVYGSLVIFTYLFVAKPSSRPPTDLLDDLEINCTNILQGLKN-EKQLELINTKMIEDKLW-NSTDRCHTVKSMFRFNEVPLSEEEARFPLSYGLLVYKELSQVLFMLSSIYQPQNEYCIAVGENSASTFLILLEELSDCFPN-----VHFMKRPPITWGSYEIINSVYDCLKFLSHLKSNWKYFQYLSGVDIPLKTNLEMVRILKSLNGTANVEIKVYENRRLLGQNETESPLPL--FKSSLSSLIPRKAANYLASSSIPQQLLEFLRNTWVADEGFWGTLFGNKGLFDVPGSLNFEEWIYFKENARANLTKPTDGWFYYISRHQIWFESGC-HNHMKDGSCVFGIGDVSNLLQAKALVAHKLYLTSEPEAYFCL--------LKEHRRRTLNPDSTFDASKYSELPQVE 403          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-1 (GLY-1; GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:G5ECK8])

HSP 1 Score: 142.124 bits (357), Expect = 5.993e-37
Identity = 104/436 (23.85%), Postives = 205/436 (47.02%), Query Frame = 2
Query:   83 IRMKISFRKFYL---FFFTLLAICIIV--GYFRSVLSPANQIVQSFKNLSIQSSEPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLE-GVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLR-IPGS------------------YIGNPDEITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSS 1315
            +++ ++ R+F +   F ++   + I++  G+    L P N+     +N+ +     +C  ++      + +  A +W    +    +    +N+ S+ D +    N+     S+EE  +PL++ ++ +K+  Q+   +   Y+P + +CI VD +S  ++ + I AL +C  + +  I         +WG   +L     C   L +  + WKY+  L+G + P++TN E+V+I  A  G+ N +   ++    + +  +  P PV  +K S+ + V R+   Y+  SP+ + LL  +    IPDE+F+ST+  +P L  +PGS                  Y    + I + Y + RY+ WG       K+    C++G  D+ +++T P L A+K + EFQPA   C+         KE +  ++  D+  +S+
Sbjct:   20 LQLGMNVRRFKIISQFLYSSFTVYIVLRLGFVDYSLVPENR---KLENIPL-----ECNSVINGTENRRKISRARQWDWHFDWVEHEIFNSRNVCSTIDKYF---NFTRIPSSREEAEYPLAYGLVVYKTIVQVLTQMSLFYQPQHMFCITVDDQSPNEYKSVIQALPSCFPNMHVFIGEPS-----QWGSFGILKNVYTCFNWLSKSKQKWKYYQYLSGTDLPIRTNLEMVRIFKALNGSMNTDVSTFEVDRYKNMEGVLPPMPV--YKSSMSVVVPREGADYLISSPRVQKLLKYLSKTWIPDESFWSTVLGSPALLPVPGSIRVRDILWLRKNFKLRPPYENTVNSIGTSY-IGRYQVWGWQKECFGKVKDFSCVFGVEDIEEIMTRPELVAHKLYLEFQPAAFMCM--------LKEVRRRSLSPDAHLFSA 428          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-18 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:Q19730])

HSP 1 Score: 138.658 bits (348), Expect = 6.170e-36
Identity = 96/325 (29.54%), Postives = 162/325 (49.85%), Query Frame = 2
Query:  404 SKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLE-GVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQL-RIPGS-----YIGNPDEITS---------EYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSSLPFVK 1330
            S EE++FPLS+ +L +K  SQ+  +L +IY P N YCI V   S   F   +  L NC ++     ++   R  + WG   ++ +  +C++ L     DW+YF  L+G + PLKTN E+V+IL    G  N+E   Y+ +        + P P+  FK S+   + R+   ++  S   + LL  ++   I DE F+ TL  N  L  IPGS     +I   + + +          Y+++R + W + P   N +  G C++G GD+P+L+ +  L A+KF+ + +P    CL +    + ++      +  D+  YS LP V+
Sbjct:  111 SPEEESFPLSYGLLVYKELSQVLFMLSSIYHPQNEYCIAVGENSAPIFQNLLKELSNCFSN-----IHFMKRPPIDWGSHEIINSAYDCLEFLSHLKSDWRYFQYLSGVDIPLKTNLEMVQILKHLNGTANVEIKPYQYQRLRGKNETQSPLPL--FKSSLSSLIPREAANHLSSSSIPQQLLEFLRNTGIADEGFWGTLFGNKNLFDIPGSLNFKEWISYKNNVETNLTYPTDGWRYYISRDQIWSK-PNCHNYMKAGSCVFGIGDVPRLLKSKALVAHKFYLKSEPEAYFCLLK----EHRRRTCNPDLTFDASKYSELPQVE 423          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Match: gly-15 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:L8E6J1])

HSP 1 Score: 133.65 bits (335), Expect = 2.707e-34
Identity = 111/436 (25.46%), Postives = 194/436 (44.50%), Query Frame = 2
Query:   89 MKIS-FRKFYLFFFTLLAICIIVGYFRSVLSPANQIVQSFKNLSIQSSEPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQ---NIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGV---YKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNP-QLRIPGSY-------------------IGNPDEITSEYFMTRYKNWGQYPCVSNK--IVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFY 1309
            MK S F  F L F T L + +++       +PA+ I   F +L  Q              +   +  A   +   +D    +Q+L+     ++ C  F     +     S+EE  FPL++ +L      Q+  LL  IY+P N +C+ VD  S  +F+  +  L  C  +    I +     +++W    +LT+   C+  L +   DWKYF  L+G + PLK+N E+++IL A  G+ N E +   + + N +R     +P     +K S+  T +R    ++  S K    ++ ++G    DE+ ++T+  NP +L +PG +                    G   +I + Y+++RY+ +     V  K    R  C++G  DLP L+    L A+K +  +QPA   CL   + +  QK  +T   +  +E Y
Sbjct:    1 MKFSIFLGFLLIFVTFLPLVLVILEIFESQNPASII--DFSHLECQKM-----------FDGDPVSLARGALFKFDDREILAQILKLSGQENAQCAEFQKIFGFFQEPTSQEELEFPLAYGMLVHGDFVQLSLLLSAIYQPQNQFCLAVDGNSSVEFIGLVRMLSRCYGNIQYFITD-----EIRWCGYEILTSVFQCVDYLAKLPSDWKYFQYLSGVDAPLKSNLEMIRILKALNGSFNAEILPFEFYRLNRKRPWSSPLPL----YKTSLSATFSRKSANFMVNSEKVLEQIDFLRGTTCADESLWATIAGNPKELPMPGGFDAKAWIHKNYRRTRGKLGKYGENQKIDNGYYVSRYQQYVNRAPVKCKGYYYRLSCVFGVYDLPNLINRHELVAHKLYFSYQPAAFMCL---VENSRQKSMRTPQFDFSAEKY 411          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Fly
Match: oxt (gene:FBgn0015360 transcript:FBtr0072904)

HSP 1 Score: 101.679 bits (252), Expect = 1.743e-22
Identity = 106/409 (25.92%), Postives = 175/409 (42.79%), Query Frame = 2
Query:  146 IIVGYFRSVL---SPANQIVQSFKNLSIQSSEPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNY-----------ASNHPSKEEKNFPLSFSI-LAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNE------------------ERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKS----KTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPN---LFANKFHEEFQPATLRCLERWIH 1252
            ++ GY+ S     SPA  +      L +QS  P  Y  ++   E     D       L D+  +++ L N    C  F +   Y           A+  PS+E K   ++F + L  ++  Q+ RLL+ +Y P + Y IHVD + D  +   ++     L SK+ NI   + R    WG  S+LT  L CM++L +    W + INL+  +FP+KT  +LV  L+A  G N ++G  ++  +                   RI   K+P  +    GS  + ++R F+ Y+    +     + LL + +  L+P E+FF T+  N   +   SY+ N   +T+  +  +     QY  V +        +   D P+L         FA KF      A L  LE W++
Sbjct:  149 LLAGYYSSSKTSNSPAKCV-----ELCLQSGYP--YAGVQYGRECFCGYDPPPKASKLPDSSCNTKCLGNAKEICGGFYAMNIYETGIAKFTAQLAATTPSEETKRVRIAFLLTLNGRALRQVHRLLKALYAPEHVYYIHVDERQDYLYRKLLE-----LESKFPNIRLARKRFSTIWGGASLLTMLLQCMEDLLQSNWHWDFVINLSESDFPVKTLDKLVDFLSANPGRNFVKGHGRETQKFIQKQGLDKTFVECDTHMWRIGDRKLPAGIQVDGGSDWVALSRPFVGYVTHPREDDELLQALLKLFRHTLLPAESFFHTVLRNT--KHCTSYVDNNLHVTN--WKRKQGCKCQYKHVVDWCGCSPNDFKPEDWPRLQATEQKSLFFARKFEPVINQAVLLQLEEWLY 541          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt4b (glucosaminyl (N-acetyl) transferase 4b [Source:ZFIN;Acc:ZDB-GENE-091118-69])

HSP 1 Score: 181.415 bits (459), Expect = 1.220e-51
Identity = 125/422 (29.62%), Postives = 206/422 (48.82%), Query Frame = 2
Query:   83 IRMKISFRKFYLFFFTLLAICIIVGYFRSVLSPANQIVQSFKNLSIQSSEPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEER--IPHIKM--------------------PFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQ-----YPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQK 1267
            ++  I     +L+ FTLL I  ++   +  + P            I   EP   E+ K  V    ++  + +V P +      +++ N  S CD F+S+  Y +   ++ E+ FPL++S++  ++++ +ERLLR +Y P N YCIH D KS   F+ A++ L  C+ + +  I +  +R  V++  +S L ADLNC+ +L +    WKY INL GQ+FPL+TNAELV  L   KG N +E  +      R  + H+                      P+ +  F GS + T++R+F+ ++  S  ++  L   +    PDE F++TL   P   +PG    +  +I+     TR   W       YP  +   VR ICI+GA +L  L+   + FANK   +  P  + CLE  + +K +K
Sbjct:    1 LKYSIGLSSLHLWGFTLLKILCLLKRIKFTM-PRLTAKYGINCTRIYEMEP--VEVAKTLV----IRKQKSYVEPTD------EIIVNATSDCDQFVSSLGYDAIQVTESEREFPLAYSLVVHRNAALVERLLRAVYVPHNIYCIHYDRKSSTDFMLAMNGLARCIPNVF--IASKLER--VQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGAKNRRWSVHHLLKNKKFEFYNTPVSTSDKKRPPPYDIEMFVGSAYFTLSREFVYFVHWSYLARNFLAWSEDTFSPDEHFWATLVRVPG--VPGEVPRSEADISELISKTRLVKWSAFEGRLYPRCTGVHVRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLEEKLAEKRRK 403          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: gcnt4b (glucosaminyl (N-acetyl) transferase 4b [Source:ZFIN;Acc:ZDB-GENE-091118-69])

HSP 1 Score: 179.489 bits (454), Expect = 7.900e-51
Identity = 108/336 (32.14%), Postives = 174/336 (51.79%), Query Frame = 2
Query:  332 QLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEER--IPHIKM--------------------PFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQ-----YPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDK 1258
            +++ N  S CD F+S+  Y +   ++ E+ FPL++S++  ++++ +ERLLR +Y P N YCIH D KS   F+ A++ L  C+ + +  I +  +R  V++  +S L ADLNC+ +L +    WKY INL GQ+FPL+TNAELV  L   KG N +E  +      R  + H+                      P+ +  F GS + T++R+F+ ++  S  ++  L   +    PDE F++TL   P   +PG    +  +I+     TR   W       YP  +   VR ICI+GA +L  L+   + FANK   +  P  + CLE  + +K
Sbjct:   89 EIIVNATSDCDQFVSSLGYDAIQVTESEREFPLAYSLVVHRNAALVERLLRAVYVPHNIYCIHYDRKSSTDFMLAMNGLARCIPNVF--IASKLER--VQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGAKNRRWSVHHLLKNKKFEFYNTPVSTSDKKRPPPYDIEMFVGSAYFTLSREFVYFVHWSYLARNFLAWSEDTFSPDEHFWATLVRVPG--VPGEVPRSEADISELISKTRLVKWSAFEGRLYPRCTGVHVRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLEEKLAEK 418          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: si:dkeyp-87d8.8 (si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-161])

HSP 1 Score: 179.104 bits (453), Expect = 1.230e-50
Identity = 111/354 (31.36%), Postives = 181/354 (51.13%), Query Frame = 2
Query:  278 LQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEER--IPHIKM--------------------PFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQ-----YPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDK 1258
            ++  + +V P ++T+       N  S CD F+S+  Y +   ++ E+ FPL++S++  ++++ +ERLLR +Y P N YCIH D KS   F+ A++ L  C+ + +  I +  +R  V++  +S L ADLNC+ +L +    WKY INL GQ+FPL+TNAELV  L   KG N +E  +      R  + H+                      P+ +  F GS + T++R+F+ ++  S  ++  L   +    PDE F++TL   P   +PG    +  +I+     TR   W       YP  +   VR ICI+GA +L  L+   + FANK   +  P  + CLE  + +K
Sbjct:   85 IRKQKSYVEPTDETIV------NATSDCDQFVSSLGYDAIQVTESEREFPLAYSLVVHRNAALVERLLRAVYVPHNIYCIHYDRKSSTDFMLAMNGLARCMPNVF--IASKLER--VQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGAKNRRWSVHHLLKNKKFEFYNTPVSTSDKKRPPPYDIEMFVGSAYFTLSREFVYFVHWSYLARNFLAWSEDTFSPDEHFWATLVRVPG--VPGEVPRSEADISELISKTRLVKWSAFEGRLYPRCTGVHVRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLEEKLAEK 426          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: si:dkeyp-87d8.8 (si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-161])

HSP 1 Score: 179.489 bits (454), Expect = 1.360e-50
Identity = 111/354 (31.36%), Postives = 181/354 (51.13%), Query Frame = 2
Query:  278 LQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEER--IPHIKM--------------------PFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQ-----YPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDK 1258
            ++  + +V P ++T+       N  S CD F+S+  Y +   ++ E+ FPL++S++  ++++ +ERLLR +Y P N YCIH D KS   F+ A++ L  C+ + +  I +  +R  V++  +S L ADLNC+ +L +    WKY INL GQ+FPL+TNAELV  L   KG N +E  +      R  + H+                      P+ +  F GS + T++R+F+ ++  S  ++  L   +    PDE F++TL   P   +PG    +  +I+     TR   W       YP  +   VR ICI+GA +L  L+   + FANK   +  P  + CLE  + +K
Sbjct:   82 IRKQKSYVEPTDETIV------NATSDCDQFVSSLGYDAIQVTESEREFPLAYSLVVHRNAALVERLLRAVYVPHNIYCIHYDRKSSTDFMLAMNGLARCMPNVF--IASKLER--VQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGAKNRRWSVHHLLKNKKFEFYNTPVSTSDKKRPPPYDIEMFVGSAYFTLSREFVYFVHWSYLARNFLAWSEDTFSPDEHFWATLVRVPG--VPGEVPRSEADISELISKTRLVKWSAFEGRLYPRCTGVHVRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLEEKLAEK 423          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Match: si:dkeyp-87d8.8 (si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-161])

HSP 1 Score: 178.333 bits (451), Expect = 2.494e-50
Identity = 125/421 (29.69%), Postives = 206/421 (48.93%), Query Frame = 2
Query:   83 IRMKISFRKFYLFFFTLLAICIIVGYFRSVLSPANQIVQSFKNLSIQSSEPDCYEL--LKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEER--------------------IPHIKMPFP--VVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQ-----YPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDK 1258
            +++ +  R     F TL  +C  V + R         +   + L+++    +C ++  ++P    KSL   ++    +   LTD+ +  N    C+ F+S++ Y     ++ E+ FPL++S++  + ++ +ERLLR +Y P N YCIH D KS   F+ A++ L  C+ + +  I +  +R  V++  +S L ADLNC+ +L +    WKY INL GQ+FPL+TNAELV  L   KG N +E  +    + R                     P  K P P  +  F GS + T++R+F+ ++  S  +K  L   +    PDE F++TL   P   +PG    +  +I+     TR   W       YP  +   VR ICI+GA +L  L+   + FANK   +  P  + CLE  + +K
Sbjct:    4 LKLHLKLRNVIFVFGTLGLLCTTVIFLRGNGEKQEAGLSLRQQLTVKYG-INCTKIYEMEPVEVGKSLVIRKQ---KIYKGLTDAAI-ANATIDCEWFVSSQRYNDIQVTESEREFPLAYSLVVHQDAALVERLLRAVYVPHNIYCIHYDRKSSTDFMLAMNGLARCIPNVF--IASKLER--VQYAGISRLRADLNCLSDLLDSEVKWKYVINLCGQDFPLRTNAELVSDLKGLKGRNMVESKWPGGKKIRWSVHHLLKNNDSEYYDFPVSTPEEKPPPPHNIEMFVGSAYFTLSREFVYFVHWSSLAKDFLAWSEDTFSPDEHFWATLVRVPG--VPGEVPRSEADISELISKTRLVKWSAFEGRLYPRCTGVHVRKICIYGAAELRWLLNYGHWFANKVDPKVDPVLIECLEEKLAEK 413          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: ccdc77 (coiled-coil domain containing 77 [Source:Xenbase;Acc:XB-GENE-959311])

HSP 1 Score: 199.519 bits (506), Expect = 2.893e-58
Identity = 125/393 (31.81%), Postives = 194/393 (49.36%), Query Frame = 2
Query:  203 FKNLSIQSSEP----DCYELLKPNVENKSLQDAEKWVVPL-----NDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLE--------------------GVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPD-EITSEYFMTRYKNW----------GQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            F NL +    P    +C +++K +VE   +Q+A+  ++ +        LTD   + N+ + C+ F  ++ Y     SKEE+ FP+++SI+ +     +ERLLR+IY P NYYCIHVD KS   FL A+ A+ +C    + N+       +V +   + + ADLNCM +L+ K   WKY INL G +FP+KTN E+V++L   K  N+LE                       +K  E++ P    P     F GS +  V R F++YI E+ K +  L   K    PDE  ++TL   P   +PGS   N   +++      R+  W            YP  +   VR +C++GAGDL  ++   +LF NKF  +  P  ++CLE  +  K 
Sbjct:   39 FTNLELTEDNPIISANCTKIIKGDVE--EIQNAKLELLTVKYKSQQHQLTDEDYI-NMTNDCEAFTRDRKYLLYPLSKEEREFPIAYSIVVYHRIDMLERLLRSIYTPQNYYCIHVDKKSSTSFLNAVKAITSC----FENVFIASQLENVVYASWARVQADLNCMTDLHNKNAKWKYLINLCGMDFPIKTNREMVEMLKGLKSQNSLETEKMPPHKEVRWRKHYEIVDNAIRKTEEDKTPP---PLETPVFSGSAYFVVTRAFVSYILENEKIQRFLEWSKDTYSPDEFIWATLQRIPG--VPGSVPANSKYDVSDMNAYARFVKWAYLEGDVAKGAPYPPCAGNHVRSVCVFGAGDLEFMLQKHHLFGNKFDIDVDPTAIKCLEEHLRHKA 419          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: GCNT4 (glucosaminyl (N-acetyl) transferase 4 [Source:NCBI gene;Acc:100492495])

HSP 1 Score: 191.045 bits (484), Expect = 4.651e-55
Identity = 145/440 (32.95%), Postives = 216/440 (49.09%), Query Frame = 2
Query:  104 RKFYLFFFTLLAIC--IIVGYFR---------SVLSPANQIVQSFKNLSIQSSEP----DCYEL--LKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVY----KKR-------------NEERIP----HIKMPFP--VVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQ-----YPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTV 1288
            R+  L  F+ L +C   I+G  +          VL P   I QS ++ S+ + EP    +C  +  L+P    KSL+   K +V + D     + +  +   C+ +   + Y     S EEK+FP+++S++  K +  +ERLL TIY P N YCIH D KS   F  A+  L  CL + +  I +  +R  V +  ++ L ADLNC+K+L E    WKY INL GQ+ PLK+N ELV  L    G N LE       KKR             N +++P      KMP P  +  F GS +  ++  FI+YIF+SP  K  L   +    PDE F++TL   P   +PG    +  ++T     TR   WG      YP  +   VR +CI+GAG+L  L+T  + FANKF  +  P  ++CL   + ++ ++    G V
Sbjct:    3 RRRILKHFSFLVVCAIFILGILKLLQGDPDLTYVLDPNLLISQSVRSRSLTTKEPHGDINCTAIYELEPMEIGKSLELRRKHIVDIKD-----EDVVAMTDDCEAYRYQRQYDLKPLSPEEKDFPIAYSLVVHKDAISVERLLHTIYNPVNIYCIHYDQKSLPGFKRAMTNLAICLPNVF--IASKLER--VTYAHVTRLQADLNCLKDLLESSVQWKYVINLCGQDMPLKSNYELVAELKKLNGRNMLETSRPSDSKKRRFTFHHEVQNVNFNYQQMPVKSSVTKMPPPGNLQIFIGSAYFVLSHSFISYIFDSPVFKEFLTWSEDTFSPDEHFWATLVRMPG--VPGEIPRSQKDVTDLNSKTRLVKWGYLEGGLYPPCTGTHVRSVCIYGAGELRWLMTYGHWFANKFDPKVDPTLIKCLIEKLEEQQKQWVLLGLV 431          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: cnksr2 (connector enhancer of kinase suppressor of Ras 2 [Source:Xenbase;Acc:XB-GENE-490704])

HSP 1 Score: 179.874 bits (455), Expect = 8.248e-51
Identity = 112/337 (33.23%), Postives = 168/337 (49.85%), Query Frame = 2
Query:  344 NIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLE--------------------GVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSY-IGNPDEITSEYFMTRYKNWG----------QYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            N+ + C  F  N+ Y     SKEE+NFP+++S++  +     ERLLR IY P N YC+HVD KS   F  A++A+ +C    ++N+      V V +     + ADLNCM++L +    WKY +N  G +FPLKTNAE+V+ L +  G N++E                     + K   E+  P I  P     F G+ +I V R+F+ +IF +P++ TL+  VK    PDE  ++TLN  P   +PGS    +  E +    + R   WG           YP  +    R IC++G GDL  L+   ++ ANKF  +     L CLE ++  K 
Sbjct:   99 NMTTDCSYFKKNRKYMPFPMSKEEENFPIAYSMVIHEKIDMFERLLRAIYAPQNIYCVHVDEKSPAVFKEAVNAITSC----FDNVFIASKLVKVVYAAWPRVQADLNCMEDLLQSKVLWKYLLNTCGTDFPLKTNAEIVRTLKSLNGKNSMESEKPSSSKKTRWEFHFEVGDSISKTAIEKSPPPIDSPM----FTGNAYIVVCRNFVEHIFNNPQALTLIEWVKDTYSPDEHLWATLNRMPG--VPGSSPYSDKYEKSDMNAVARMVKWGYMEGDIAKGAPYPPCTGTHRRSICVYGTGDLYWLLEQHHVLANKFDPKVDNIALECLEEYLRHKT 425          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: gcnt2.2 (glucosaminyl (N-acetyl) transferase 2 (I blood group), gene 2 [Source:NCBI gene;Acc:100038221])

HSP 1 Score: 175.252 bits (443), Expect = 3.875e-49
Identity = 113/339 (33.33%), Postives = 170/339 (50.15%), Query Frame = 2
Query:  353 SSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGV-----------YKKRNE------ERIPHIKMPFP--VVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEI-TSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFY 1309
            SSC  ++   ++  +  S+EE  FPL++ +   K     ERL R IY P N YC+HVD K+   F+ A+D+LV C    + N         V +G +S L ADLNCMK+L      WKY INL GQ+FPLKTN E++  + ++KG N   GV           Y  R +       R   +K P P  +  + GS ++ + R+F  +I E  ++  LL   K    PDE ++ TLN      +PGS    PD     +    ++K+           VR ICI+G GDL  L+ + ++FANKF  +  P T+ CLE  + ++   +++   V +  E+Y
Sbjct:   91 SSCPEYVRQNHFIMSPLSQEEAAFPLAYILTVHKEFETFERLFRAIYMPQNIYCVHVDEKASADFMQAVDSLVQC----FPNTFLASKMEPVVYGGISRLQADLNCMKDLLASDVQWKYVINLCGQDFPLKTNKEIIHHIKSFKGKNITPGVLPPAHAIPRTKYVHREDIVNSRVVRTRVLKPPPPHNITIYFGSAYVALTREFTRFILEDQRATNLLLWSKDTYSPDEHYWVTLNRIAD--VPGS---APDASWEGQLRAVKWKDMKDQEKCHGHYVRDICIYGTGDLQWLMNSRSIFANKFEAKSYPPTVECLELKVRERTLNQSE---VTVPPEWY 417          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Match: slc24a4 (solute carrier family 24 member 4 [Source:Xenbase;Acc:XB-GENE-478288])

HSP 1 Score: 175.252 bits (443), Expect = 6.415e-49
Identity = 113/375 (30.13%), Postives = 180/375 (48.00%), Query Frame = 2
Query:  227 SEPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGV----YKKRNEERIPHIK---------------MPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEY-FMTRYKNWGQY-----------PCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDK 1258
             E +C+ +++ ++E       +  V      +   +   N  S C  F   + Y     SKEE++FP+++S++   +    ERLLR IY P N YC+H+D KS + F  A+ A+ +C    + N+      V+V +     + ADLNCM++L +    WKY IN  G +FP+KTNAE+VK L +  G N++E      +KKR  E    +K                P PV  F G+ +I V R+F+  +F +P  ++ +   K    PDE  ++TLN   ++  PG    +    TS+   + R   W              PC S    R +C++G GDL  L+   +LFANKF  +     ++CLE ++  K
Sbjct:   67 GEKNCHRIIQGDMEEVRRALIDNLVAKKKRVIMTDESFINATSDCKLFRQRRKYVMFSLSKEEQDFPIAYSMVIHDNIEMFERLLRAIYTPHNIYCVHMDKKSPESFHQAVRAITSC----FGNVFVASKLVNVVYASWRRVQADLNCMEDLLQSKVPWKYLINTCGTDFPIKTNAEMVKALKSLNGHNSMESEIPPNHKKRRWEYHFELKEDSNNIVLTNTRKKPSPLPVPVFSGNAYIVVTRNFVNALFVNPTVRSFITWAKDTYSPDEYLWATLNRFAEM--PGYMPAHQKYDTSDINAIARLVKWESLEGDMSKGAPYIPC-SGTHRRTVCVYGTGDLNWLLQQHHLFANKFDPKVDNNVIQCLEEYLRYK 434          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 190.274 bits (482), Expect = 6.411e-55
Identity = 107/334 (32.04%), Postives = 167/334 (50.00%), Query Frame = 2
Query:  344 NIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEER-----------------IPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSY-------IGNPDEITS----EYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            N+   C +F+  + Y     +KEE  FP+++SI+       ++RLLR IY P N+YCIHVD K+++ FL A+  + +C    ++N+        V +   S + ADLNCMK+LY    +WKY INL G +FP+KTN E+V+ L    G NNLE      N+E                  I     P     F GS +  V R+++ Y+ E+   + L+   +    PDE  ++T+   P+  +PGS+       + + + I      +YF     N   YP  S   VR +C++GAGDL  ++   +LFANKF  +  P  ++CL+  +  K 
Sbjct:   95 NMTRDCASFIRTRKYIVEPLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 190.274 bits (482), Expect = 6.411e-55
Identity = 107/334 (32.04%), Postives = 167/334 (50.00%), Query Frame = 2
Query:  344 NIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEER-----------------IPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSY-------IGNPDEITS----EYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            N+   C +F+  + Y     +KEE  FP+++SI+       ++RLLR IY P N+YCIHVD K+++ FL A+  + +C    ++N+        V +   S + ADLNCMK+LY    +WKY INL G +FP+KTN E+V+ L    G NNLE      N+E                  I     P     F GS +  V R+++ Y+ E+   + L+   +    PDE  ++T+   P+  +PGS+       + + + I      +YF     N   YP  S   VR +C++GAGDL  ++   +LFANKF  +  P  ++CL+  +  K 
Sbjct:   95 NMTRDCASFIRTRKYIVEPLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 190.274 bits (482), Expect = 6.411e-55
Identity = 107/334 (32.04%), Postives = 167/334 (50.00%), Query Frame = 2
Query:  344 NIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEER-----------------IPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSY-------IGNPDEITS----EYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            N+   C +F+  + Y     +KEE  FP+++SI+       ++RLLR IY P N+YCIHVD K+++ FL A+  + +C    ++N+        V +   S + ADLNCMK+LY    +WKY INL G +FP+KTN E+V+ L    G NNLE      N+E                  I     P     F GS +  V R+++ Y+ E+   + L+   +    PDE  ++T+   P+  +PGS+       + + + I      +YF     N   YP  S   VR +C++GAGDL  ++   +LFANKF  +  P  ++CL+  +  K 
Sbjct:   95 NMTRDCASFIRTRKYIVEPLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt1 (glucosaminyl (N-acetyl) transferase 1, core 2 [Source:MGI Symbol;Acc:MGI:95676])

HSP 1 Score: 190.274 bits (482), Expect = 6.411e-55
Identity = 107/334 (32.04%), Postives = 167/334 (50.00%), Query Frame = 2
Query:  344 NIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEER-----------------IPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSY-------IGNPDEITS----EYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            N+   C +F+  + Y     +KEE  FP+++SI+       ++RLLR IY P N+YCIHVD K+++ FL A+  + +C    ++N+        V +   S + ADLNCMK+LY    +WKY INL G +FP+KTN E+V+ L    G NNLE      N+E                  I     P     F GS +  V R+++ Y+ E+   + L+   +    PDE  ++T+   P+  +PGS+       + + + I      +YF     N   YP  S   VR +C++GAGDL  ++   +LFANKF  +  P  ++CL+  +  K 
Sbjct:   95 NMTRDCASFIRTRKYIVEPLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Match: Gcnt4 (glucosaminyl (N-acetyl) transferase 4, core 2 (beta-1,6-N-acetylglucosaminyltransferase) [Source:MGI Symbol;Acc:MGI:2684919])

HSP 1 Score: 171.014 bits (432), Expect = 1.816e-47
Identity = 113/361 (31.30%), Postives = 176/361 (48.75%), Query Frame = 2
Query:  269 NKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGV---------YKKRNEER-IPHIKMPFPVVW-------------FKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQ-----YPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQK 1267
             KSL+   + ++ L D    +     + S CD + + + Y     S+EE++FP+++S++  K +  +ERL+R IY   N YCIH D+KS   F  A++ L  C    + NI        V++  +S L AD NC+ +L +    WKY INL GQ+FPLK+N ELV  L + +G N LE V         +   +E R +P+  M  PV               F GS +  ++R F+ YIF S   +      K    PDE F++TL   P   IPG    +  +++     TR   W       YP  +   +R +CI+GA +L  L+   + FANKF  +  P  ++CL   + ++ +K
Sbjct:   86 GKSLEIRRRSIIDLEDGDVVA-----MTSDCDVYQTLRQYHEKLVSREEEDFPIAYSLVVHKDAIMVERLIRAIYNQHNLYCIHYDLKSPDTFKAAMNNLAKC----FPNIFIASKLETVEYAHISRLQADWNCLSDLLKSSVQWKYVINLCGQDFPLKSNFELVTELKSLQGRNMLETVRPPSAKTERFTYHHELRQVPYDYMKLPVKTNVSKGAPPHNIQVFVGSAYFVLSRAFVKYIFNSSLVEDFFAWSKDTYSPDEHFWATLIRIPG--IPGGISSSSQDVSDLQSKTRLVKWFYYEGFLYPNCTGSHLRSVCIYGAAELRWLLNEGHWFANKFDSKVDPILMKCLAEKLEEQQRK 435          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q09324|GCNT1_MOUSE (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Gcnt1 PE=1 SV=2)

HSP 1 Score: 190.274 bits (482), Expect = 4.485e-54
Identity = 107/334 (32.04%), Postives = 167/334 (50.00%), Query Frame = 2
Query:  344 NIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEER-----------------IPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSY-------IGNPDEITS----EYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            N+   C +F+  + Y     +KEE  FP+++SI+       ++RLLR IY P N+YCIHVD K+++ FL A+  + +C    ++N+        V +   S + ADLNCMK+LY    +WKY INL G +FP+KTN E+V+ L    G NNLE      N+E                  I     P     F GS +  V R+++ Y+ E+   + L+   +    PDE  ++T+   P+  +PGS+       + + + I      +YF     N   YP  S   VR +C++GAGDL  ++   +LFANKF  +  P  ++CL+  +  K 
Sbjct:   95 NMTRDCASFIRTRKYIVEPLTKEEVGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASC----FDNVFVASQLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGENNLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVLENENIQKLMEWAQDTYSPDEFLWATIQRIPE--VPGSFPSSNKYDLSDMNAIARFVKWQYFEGHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q02742|GCNT1_HUMAN (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=GCNT1 PE=1 SV=2)

HSP 1 Score: 186.422 bits (472), Expect = 1.539e-52
Identity = 108/332 (32.53%), Postives = 170/332 (51.20%), Query Frame = 2
Query:  344 NIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEG---------VYKKRNE------ERIPHIKM--PFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQL--RIPGSYIGNPDEITS-------EYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            N+ S C +F+  + Y     SKEE  FP+++SI+       ++RLLR IY P N+YCIHVD KS+  +L A+  + +C    ++N+        V +   S + ADLNCMK+LY    +WKY INL G +FP+KTN E+V+ L    G NNLE           +KKR E           +KM  P     F GS +  V+R+++ Y+ ++ K + L+   +    PDE  ++T+   P++   +P S+  +  ++ +       +YF         YP      VR +CI+GAGDL  ++   +LFANKF  +     ++CL+  +  K 
Sbjct:   95 NMTSDCSSFIKRRKYIVEPLSKEEAEFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSEDSYLAAVMGIASC----FSNVFVASRLESVVYASWSRVQADLNCMKDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDEYLWATIQRIPEVPGSLPASHKYDLSDMQAVARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFANKFDVDVDLFAIQCLDEHLRHKA 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q92180|GCNT1_BOVIN (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Bos taurus OX=9913 GN=GCNT1 PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 4.246e-51
Identity = 108/335 (32.24%), Postives = 165/335 (49.25%), Query Frame = 2
Query:  344 NIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEG-----------------VYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEY-FMTRYKNWGQY-----------PCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            N+   C +F+  + Y +   SKEE  FP+++SI+       ++RLLR IY P N+YCIHVD KS+K FL A   + +C    ++N+        V +   S + ADLNCM++LY+    WKY INL G +FP+KTN E+V+ L    G NNLE                  V  K        I  P     F GS H  V+R+++ Y+ ++   +  +   K    PDE  ++T+   P+  +PGS   +    TS+   + R+  W  +           PC  +  VR +C++GAGDL  L+   +LFANKF  +     ++CL+  +  K 
Sbjct:   95 NMTGDCASFIKKRKYITEPLSKEEAGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDAKSEKSFLAAAVGIASC----FSNVFVASQLESVVYASWSRVQADLNCMQDLYQMNAGWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETEKMPSHKKERWKKHYEVVNGKLTNMGTDKIHPPLETPLFSGSAHFVVSREYVEYVLQNQNIQKFMEWAKDTYSPDEYLWATIQRIPE--VPGSLSLSYKYDTSDMQAIARFVKWQYFEGDVSKGAPYPPCSVH--VRSVCVFGAGDLNWLLHVHHLFANKFDTDIDLFAIQCLDEHLRHKA 421          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q805R1|GCNT3_BHV4L (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Bovine herpesvirus 4 (strain LVR140) OX=436506 GN=Bo17 PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 6.536e-50
Identity = 118/343 (34.40%), Postives = 175/343 (51.02%), Query Frame = 2
Query:  320 LTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEG---------VYKKRNE---ERIPHIKMPFP----VVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPD-EITSEYFMTRYKNWGQY------------PCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            LTD+  L NI   C+ F + + +     SKEE +FP+++S++  +     ERLLR +Y P N YC+HVDVKS + F  A+ A+++C    + N+      V V +   S + ADLNCM++L +    WKY +N  G +FP+KTNAE+V  L   KG N++E           +K R E      P  KM  P    +  F G+ +   +R F+ ++ ++PKS+ L+  VK    PDE  ++TL   P +  PGS   +P   I+    + R   W QY            PC S    R ICI+GAGDL  ++   +L ANKF        L+CLE ++  K 
Sbjct:  101 LTDTYYL-NITRDCERFKAQRKFIQFPLSKEELDFPIAYSMVVHEKIENFERLLRAVYAPQNIYCVHVDVKSPETFKEAVKAIISC----FPNVFMASKLVPVVYASWSRVQADLNCMEDLLQSSVSWKYLLNTCGTDFPIKTNAEMVLALKMLKGKNSMESEVPSESKKNRWKYRYEVTDTLYPTSKMKDPPPDNLPMFTGNAYFVASRAFVQHVLDNPKSQILVEWVKDTYSPDEHLWATLQRAPWM--PGSVPSHPKYHISDMTAIARLVKW-QYHEGDVSMGAPYAPC-SGIHRRAICIYGAGDLYWILQNHHLLANKFDPRVDDNVLQCLEEYLRHKA 434          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Match: sp|Q9IZK2|GCNT3_BHV4V (Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase OS=Bovine herpesvirus 4 (strain V. test) OX=436507 GN=Bo17 PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 8.209e-50
Identity = 117/343 (34.11%), Postives = 176/343 (51.31%), Query Frame = 2
Query:  320 LTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVY---KKRNEERIPH-----------IKMPFP--VVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPD-EITSEYFMTRYKNWGQY------------PCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            LTD+  L NI   C+ F + + +     SKEE +FP+++S++  +     ERLLR +Y P N YC+HVDVKS + F  A+ A+++C    + N+      V V +   S + ADLNCM++L +    WKY +N  G +FP+KTNAE+V  L   KG N++E       K+N  +  +           IK P P  +  F G+ +   +R F+ ++ ++PKS+ L+  VK    PDE  ++TL   P +  PGS   +P   I+    + R   W QY            PC S    R ICI+GAGDL  ++   +L ANKF        L+CLE ++  K 
Sbjct:  101 LTDTYYL-NITRDCERFKAQRKFIQFPLSKEELDFPIAYSMVVHEKIENFERLLRAVYAPQNIYCVHVDVKSPETFKEAVKAIISC----FPNVFMASKLVPVVYASWSRVQADLNCMEDLLQSSVSWKYLLNTCGTDFPIKTNAEMVLALKMLKGKNSMESEVPSESKKNRWKYRYEVTDTLYPTSKIKDPPPDNLPMFTGNAYFVASRAFVQHVLDNPKSQILVEWVKDTYSPDEHLWATLQRAPWM--PGSVPSHPKYHISDMTAIARLVKW-QYHEGDVSMGAPYAPC-SGIHRRAICIYGAGDLYWILQNHHLLANKFDPRVDDNVLQCLEEYLRHKA 434          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A0B7AQP9 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF135715 PE=4 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 2.970e-99
Identity = 171/357 (47.90%), Postives = 221/357 (61.90%), Query Frame = 2
Query:  269 NKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQL-IPDETFFSTLNYNPQLRIPGSYIGNP--DEITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSSLPFVK 1330
            +KS  +  K +     T  D     N+ + C++F++ + Y  +  +KEE+ FPL+ SIL FK    +ERLL+ IYRP NYYC+HVD KS   F  A+ A+ NC    + N+  T  R+DV+WG  SVL  +L CMKEL+ +Y  WKYF++LTGQEFPLKTN+ELVKI TAY GAN++EG  K+ N+ER      P  +   KGSVHITVNRDF+ YI  +  +K LL  VK    +PDE FF+TLN+NPQL I GSY G P  D  T + F+TRYKNWG   C S   VRGICI   GDLP L  A + FANKF+       + CLE  I +  + E   G    D+ FY++L FVK
Sbjct:  110 SKSEIEKAKQISKTVSTPLDDAFYLNLTTDCNSFVTTRGYILSTLTKEEEEFPLAVSILVFKEVEMVERLLKAIYRPQNYYCVHVDYKSPDTFYRAVSAIANC----FPNVFLTSRRIDVQWGWFSVLEPELQCMKELW-RYPKWKYFLSLTGQEFPLKTNSELVKIFTAYDGANDIEGTIKRANKERFRSTP-PLGIRPVKGSVHITVNRDFVGYILHNETAKILLEWVKKDTSVPDEAFFATLNHNPQLGIRGSYKGEPETDWSTLKPFLTRYKNWGSSNCASGVYVRGICILSLGDLPSLGNARHYFANKFYLSQDRVVIGCLEEKIFNDTRDE-YLGVKTFDTTFYANLGFVK 459          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7P154 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12288 PE=4 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.116e-96
Identity = 156/369 (42.28%), Postives = 230/369 (62.33%), Query Frame = 2
Query:  230 EPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIPHIK-MPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPD-EITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSSLPFVK 1330
            E DC ++   + E  +        +P   T  D   +  +  +C  F+    +  N  ++EE+NFP+++SIL FK + Q+ +LL+ IYRP N YCIHVD K+D+ +   + A+ +C    ++N+  T   VDV+WG  +VL  +L CMK+L+  +K WKYFINLTGQEFPL+TN ELV+ILTAY GAN++E + K+ N+ER       P  ++  KGSVHI VNRDF+ Y+  SP ++  LN  +   +PDETFF++LN+NPQL I GSY G P+ +  ++ F+TR+KNWG YPC      R ICI   GDLP L T P +FANKF++++    L CL   +++  + E   G +E ++ +Y ++ FVK
Sbjct:    3 EIDCMKVFAGDQEELTRSKQVHKDLPALPTEKD---ITRLAKNCRNFVRVYGFIMNFLTEEERNFPIAYSILVFKDAHQVTQLLQAIYRPQNVYCIHVDQKADQSYRDTMAAIADC----FHNVFLTSRSVDVRWGTFTVLEPELICMKDLWH-FKKWKYFINLTGQEFPLRTNFELVRILTAYNGANDVESIVKRANKERWASAGPTPHGIIPVKGSVHIVVNRDFVDYVLHSPVAQDFLNWTRRVDVPDETFFASLNHNPQLGIRGSYKGYPETDPVTKPFLTRFKNWGDYPCAEGNFNRDICILSTGDLPLLDTRPEMFANKFYQDYSRVALECLHERLYNHTRDEF-LGMMEFNTSYYQNVSFVK 362          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7P144 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12287 PE=4 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 1.851e-96
Identity = 148/333 (44.44%), Postives = 219/333 (65.77%), Query Frame = 2
Query:  338 LQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIPHIK-MPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPD-EITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSSLPFVK 1330
            +  +  +C  F+    +  N  ++EE+NF +++SIL FK + Q+ +LL+ IYRP N YCIHVD K+D+ +   + A+ +C    ++N+  T   VDV+WG  +VL  +L CMK+L+  +K WKYFINLTGQEFPL+TN ELV+ILTAY GAN++E + K+ N+ER       P  ++  KG+VHI VNRDF+ Y+  SP ++  LN  +   IPDETFF++LN+NPQL I GSY G P+ +  ++ F+TR+KNWG YPC     +R ICI   GDLP L   P +FANKF++++    L CL + +++ ++ E   G +E D+ +Y ++ FVK
Sbjct:   41 ITRLAKNCRNFVRVYGFIMNFLTEEERNFSIAYSILVFKDAHQVTQLLQAIYRPQNVYCIHVDQKADQSYRDTMAAIADC----FHNVFLTSRSVDVRWGTFTVLEPELICMKDLWH-FKKWKYFINLTGQEFPLRTNFELVRILTAYNGANDVESIVKRANKERWASAGPTPHGIILVKGAVHIAVNRDFVDYVLHSPVAQDFLNWTRRVHIPDETFFASLNHNPQLGIRGSYKGYPETDPVTKPFLTRFKNWGDYPCAEGNWIRDICILSTGDLPLLDKRPEMFANKFYQDYSRVALECLHQRLYNHMRDEF-LGMMEFDTSYYQNVSFVK 367          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A2T7P139 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_12289 PE=4 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 1.679e-94
Identity = 154/369 (41.73%), Postives = 229/369 (62.06%), Query Frame = 2
Query:  230 EPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIPHIK-MPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPD-EITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSSLPFVK 1330
            E DC ++   + E  +        +P   T  D   +  +  +C  F+    +  N  ++EE+NFP+++SIL FK + Q+ +LL+ IYRP N YCIHVD K+D+ +   + A+V+C    ++N+      VDV+WG  +VL  +L CMK+L+  +K WKYFINLTGQEFPLKTN ELV+ILTAY GAN++E   +  N+ER       P  ++  KG+VHI VNRDF+ Y+  SP ++  LN  +   +PDETFF++LN+NPQL I GSY G P+ +  ++ F+TR+KNW Q+PC     +R ICI   GDLP L   P +FANKF++++    L CL + +++  + E   G +E D+ +Y ++ FVK
Sbjct:    3 EVDCMKVFAGDKEELTRSKQVHKDLPALPTEKD---ITRLAKNCSNFVRVYGFIMNFLTEEERNFPIAYSILVFKDAHQVTQLLQAIYRPQNVYCIHVDQKADQSYRDTMAAIVDC----FHNVFLASRSVDVQWGTFTVLEPELICMKDLW-PFKKWKYFINLTGQEFPLKTNFELVRILTAYNGANDVESTTETANKERWASAGPAPHGIIPVKGAVHIVVNRDFVDYVLHSPVAQDFLNWTRRVDVPDETFFASLNHNPQLGIRGSYKGYPETDPVTKPFLTRFKNWRQFPCAEEMRIRQICILSTGDLPLLDKRPEMFANKFYQDYSRVALECLHQRLYNHTRDEF-LGMMEFDTSYYQNVSFVK 362          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Match: A0A0B7AMK8 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF130617 PE=4 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 1.112e-93
Identity = 162/338 (47.93%), Postives = 211/338 (62.43%), Query Frame = 2
Query:  326 DSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQL-IPDETFFSTLNYNPQLRIPGSYIGNP--DEITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSSLPFVK 1330
            D     N+ S+C+ F + + Y  +  +KEE+ FPL+FSIL FK    +ERLLR IYRP NYYC+HVD K+   F  A+  L  C    + N++    R+DV+W   +VL  +L CM++L++ +  WKYF  LTGQEFPLKTN ELVKI+TAY GAN+LEG  K+ N ER   I  PF +   KGSVHITVNR+++ Y+  +  +K LL  VK     PDET+F+TLN+NPQL I GSY G P  DE T   F+TR+KNWG  PC S   VR ICI   GDLP+L  A + FANKF+       + CLE  I +  + E   G    D+ +Y+SL FVK
Sbjct:  130 DEAAYINLTSNCNKFQTERGYIMSSLTKEEEEFPLAFSILVFKEPEMVERLLRAIYRPQNYYCVHVDTKASDVFYNAMLGLSKC----FPNVIIASRRIDVQWATFTVLEPELLCMEDLWQ-FPSWKYFFTLTGQEFPLKTNLELVKIMTAYDGANDLEGTIKRANFERWRTI-APFGIRPIKGSVHITVNRNYVDYVLHNNTAKVLLEWVKRDTSFPDETYFATLNHNPQLGIRGSYKGEPETDEETKP-FLTRFKNWGHLPCASGNYVRAICILSLGDLPQLYHAKHYFANKFYLAEDRIVIGCLEEKIFNDTRDE-YLGLKNFDASYYASLDFVK 459          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: ENSAMXT00000050168.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001873.1:355693:357685:-1 gene:ENSAMXG00000033034.1 transcript:ENSAMXT00000050168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 197.208 bits (500), Expect = 1.100e-57
Identity = 118/346 (34.10%), Postives = 175/346 (50.58%), Query Frame = 2
Query:  320 LTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLE--------------------GVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPG--SYIGNPDEITSEYF--MTRYKNWGQ--------YPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            +TD   ++ +   C+ F   + Y     S EE+ FPL++SI+        ERLLR+IY P N+YCIHVD K+ +    AI+A V+C    ++N+       +V +   S + AD+NCMK+LY+    WKYFINL GQ+FP+KTN E+V+ L    G N+LE                    G  +  NE + P    P  +  F G  +I V+R FI ++ E PK++ L++  K    PDE  ++T+      RIPG   YI    +        ++R   W          YP      VR IC++G GDL  ++   +LFANKF  +F P  +RCLE+ + +K 
Sbjct:   80 MTDEHYIE-LTQDCERFRVTRKYMPFTLSAEEEAFPLAYSIVVHHKVQNFERLLRSIYAPQNFYCIHVDKKASESTRAAINATVSC----FDNVFIASQLEEVVYASWSRVQADINCMKDLYQISDRWKYFINLCGQDFPMKTNLEMVRALKGLHGGNSLETETMPSNKEYRWKKRHIVKNGAIQYTNEAKKPP---PSRIKMFSGGAYIVVSRAFIRFVLEDPKAQELISWSKDTYSPDEFLWATMQ-----RIPGVPGYIRAHHKFDRSDMNTISRLIKWAGHEGEFDAVYPPCQGTHVRAICVYGVGDLQWMLQQDHLFANKFDTDFDPIAIRCLEKHLRNKA 412          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: ENSAMXT00000026751.2 (glucosaminyl (N-acetyl) transferase 1 [Source:NCBI gene;Acc:103024919])

HSP 1 Score: 196.823 bits (499), Expect = 1.625e-57
Identity = 122/343 (35.57%), Postives = 178/343 (51.90%), Query Frame = 2
Query:  320 LTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEE---RIPHI------------KMPFP--VVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPG--SYIGNPDEI--TSEYFMTRYKNW--------GQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            +TD   ++ +   C+ F   + Y     S EE+ FPL++SI+        ERLLR+IY P N+YCIHVD K+ +    AI+A V+C    ++N+       +V +   S + AD+NCMK+LY+    WKYFINL GQ+FP+KTN E+V+ L    G N+LE      N+E   +  HI            K P P  +  F G  +I V+R FI ++ E PK++ L+   K    PDE  ++T+      RIPG   YI    +   T    ++R   W          YP      VR IC++GAGDL  ++   +LFANKF  +F P  +RCLE+ + +K 
Sbjct:   86 MTDEHYIE-LTQDCERFRVTRKYMPFTLSAEEEAFPLAYSIVVHHKVQNFERLLRSIYAPQNFYCIHVDKKASESTRAAINATVSC----FDNVFIASQLEEVVYASWSRVQADINCMKDLYQISDRWKYFINLCGQDFPMKTNLEMVRALKGLHGGNSLETETMPSNKEYRWKKRHIVKNGDIHNTNEAKKPPPSGIKMFSGGAYIVVSRVFIRFVLEDPKAQELILWSKDTYSPDEFLWATMQ-----RIPGVPGYIRAHHKFDRTDMNTISRLIKWVYHEGDFDAVYPPCQGTHVRSICVYGAGDLQWMLQQDHLFANKFDTDFDPIAIRCLEKHLRNKA 418          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt4b (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4-like [Source:NCBI gene;Acc:103021884])

HSP 1 Score: 187.963 bits (476), Expect = 4.122e-54
Identity = 136/426 (31.92%), Postives = 215/426 (50.47%), Query Frame = 2
Query:  104 RKFYLFFFTLLAI-CIIVGYFRSVLSPANQIVQSFKNLSIQS--SEPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGV----YKKR-----------------NEERIPHIKMPFP--VVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNW----GQ-YPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTV 1288
            R    FFF++L I C+ + Y   V  P+    Q    L+ Q   S  D Y++  P    KSL    K V  L D     + + N    C  +L+++ + S   S+ E+ FPL++S++  K ++ +ER+L  IY P N YCIH D+KS  +F+ A+  L  CL + +  I +  +R  V++  ++ L ADLNC+ +L E    W+Y INL GQ+FPL++N ELV+ L A KGA+ LE       KKR                 +  +    K P P  +  F GS + T++R+F++++  SP  K  L+  +    PDE F++TL   P   +PG    +  +++     TR   W    G+ YP  +   +R +CI+GAG+L  L+   + FANK      P  + CLE    +K+ +  +T +V
Sbjct:   12 RILLCFFFSVLLIFCLTIRYVNKVPEPSPP--QRRPRLTEQHGISCSDIYDM-DPVAVGKSLSLRRKAVPMLED-----EDIANATLDCPRYLASRGFHSIRTSQIEREFPLAYSLVVHKEAAMVERILWAIYVPHNSYCIHYDLKSSPEFMAAMQGLALCLPNVF--IASKLER--VQYASITRLRADLNCLSDLMESKVKWRYVINLCGQDFPLRSNVELVEELKALKGASMLETARPSPLKKRRFSFSYTLKDVGSQYHQHPMKTDQAKSPPPHKLEMFVGSAYFTLSREFVSFVQWSPMVKDFLSWSEDTYSPDEHFWATLIRVPG--VPGELSRSDPDVSDLASRTRLVKWQYLEGKLYPACTGVHIRSVCIYGAGELRWLLNDGHWFANKLDPRVDPVLVECLE----EKLAERQRTMSV 419          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4 [Source:NCBI gene;Acc:103033386])

HSP 1 Score: 184.111 bits (466), Expect = 1.170e-52
Identity = 126/425 (29.65%), Postives = 208/425 (48.94%), Query Frame = 2
Query:  107 KFYLFFFTLLAICIIVGYFRSVLSPANQIVQSFKNLSIQSSEP----------DCYELLK--PNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEG-----------VYKKRNEERIPH------IKM-------PFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNW-----GQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDK 1258
            KFYL FF L  +C++   +  V+      ++ +  +++ SS+           DC  + +  P    KSL+   + +V L+D     + +    + C  ++  + Y+    + EEKNFPL++S++  K+   +ER++R IY P N YCIH D KS + F+ A+  L  C    + NI        V++  ++ L ADLNC+ +L      WKY INL GQ+FPL++N ELV+ L    GAN LE            V++ + ++ +P+      IK        P  +  F GS +  ++RDF+ Y+  +  +K  L+       PDE F++TL   P   +PG    +  ++T     TR   W       YP  +   +R +CI+GA +L  L+   + FANKF  +  P  ++CLE  + +K
Sbjct:   12 KFYLIFFPLFIVCLLTLVYVKVVVRKKFYIEPY-GITLHSSKAQANKDVKDVIDCMAIYQQDPVEIGKSLEIRRRDIVDLDD-----ESITAFTADCPRYVKARGYSDISVTDEEKNFPLAYSLVVHKNMPMVERIIRAIYAPTNIYCIHYDQKSSESFIAAVKNLAKC----FPNIFIASKLESVEYAHITRLNADLNCLSDLMSSEVKWKYAINLCGQDFPLRSNYELVEELKKLNGANMLESSRPSELKRERFVFQHKLQD-VPYEYHKLPIKTTNAKSAPPHDIEMFIGSAYFVLSRDFVHYVQTAQVAKDFLDWSADTYSPDEHFWATLARVPG--VPGEIPRSEPDVTDLKSKTRLVKWEYLEGSLYPGCTGTHMRSVCIYGAAELRWLLDDGHWFANKFDPKVDPVLIKCLEEILEEK 423          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 175.252 bits (443), Expect = 2.167e-49
Identity = 110/352 (31.25%), Postives = 172/352 (48.86%), Query Frame = 2
Query:  320 LTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGV----YKKRN----------------EERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYI--GNPDE---------ITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTG 1282
            LT+S  L      C  ++S + + +   S EE++FP++FS++  +     ERLLR IY P N YC+HVD KS K+F+ A+ A+ +CL     N+        V +   S + AD+NCM++L +    W+Y +N  G +FP+KTNAE+V+ L    G N++E      YKK+                 ++  P IK P     F G+ +  V+R+F+ ++F SP+    +   K    PDE  ++TL   P +  PGS    G  DE         +   Y     +    YP  +      +C++GAGD+  +V   +LFANKF  E     ++CLE ++        QTG
Sbjct:   85 LTESYYLSAT-KDCPAYISERGFLTTPLSIEERDFPIAFSMVIHEKIEMFERLLRAIYSPQNIYCVHVDTKSSKEFMEAVKAITSCL----PNVFVASKLESVVYASWSRVQADINCMQDLLKSSVQWRYLLNTCGADFPIKTNAEMVRTLKQLNGRNSMESEATNDYKKQRWVYQHNVTTSVIRTSIKKTDPPIKSPM----FTGNAYFVVSREFVEHMFSSPEILNFMEWEKDTYSPDEHMWATLQRMPNM--PGSNPPNGKYDESDMLAIARLVKWSYLEGDLRKGAPYPPCTGAHRHAVCVYGAGDIKWIVRQKHLFANKFDPEVDDIAIKCLEAYL------SGQTG 419          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 191.43 bits (485), Expect = 1.027e-56
Identity = 121/369 (32.79%), Postives = 186/369 (50.41%), Query Frame = 2
Query:  239 CYELLK--PNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLE----GVYKK----------RNEERIPHIK--------MPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQ-----YPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDK 1258
            C E+L+  P    K+L+   K +V L D   D  LL      C  FL  + Y S H S EE++FP+++SI+  K+++ +ERLLR I+ P N YC+HVD KS   F +A+ +L  C    ++N+       +V +  +S L AD+NC+ +L +    WKY INL GQ+FPL++N ELV  L + +G + LE      YK+          R +  +P ++         P  +  F GS +  ++R+F+ +   S  +   L        PDE F++TL  +PQ   PG   G   +++     TR   W       YP  S + VR +CI+GA +L  L+   + FANKF     P  ++CLE  I  +
Sbjct:    3 CSEILQQDPREIGKTLKIRRKTIVDLTDE--DMLLLTE---DCPVFLETRKYFSKHVSAEERDFPIAYSIVVHKNAATLERLLRAIFVPQNVYCVHVDTKSSTTFKSAVQSLAKC----FDNVFVASKLEEVHYAHISRLQADINCLADLLKSPVRWKYAINLCGQDFPLRSNRELVSELKSLQGRSMLETGKPSAYKQQRFTHKFVLERRDSSLPALQHTQTALAPAPHGLEVFVGSAYFVLSREFVRFAITSAVAADFLRWCADTYSPDEHFWATLARSPQ--APGGGGGGKADVSDLQSKTRLVKWSYLEGRLYPVCSGRHVRSVCIYGAAELGWLLRDGHWFANKFDPHVDPVVVKCLEEEISSR 360          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt4a (glucosaminyl (N-acetyl) transferase 4a [Source:NCBI gene;Acc:324510])

HSP 1 Score: 191.045 bits (484), Expect = 1.217e-56
Identity = 121/369 (32.79%), Postives = 186/369 (50.41%), Query Frame = 2
Query:  239 CYELLK--PNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLE----GVYKK----------RNEERIPHIK--------MPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQ-----YPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDK 1258
            C E+L+  P    K+L+   K +V L D   D  LL      C  FL  + Y S H S EE++FP+++SI+  K+++ +ERLLR I+ P N YC+HVD KS   F +A+ +L  C    ++N+       +V +  +S L AD+NC+ +L +    WKY INL GQ+FPL++N ELV  L + +G + LE      YK+          R +  +P ++         P  +  F GS +  ++R+F+ +   S  +   L        PDE F++TL  +PQ   PG   G   +++     TR   W       YP  S + VR +CI+GA +L  L+   + FANKF     P  ++CLE  I  +
Sbjct:    4 CSEILQQDPREIGKTLKIRRKTIVDLTDE--DMLLLTE---DCPVFLETRKYFSKHVSAEERDFPIAYSIVVHKNAATLERLLRAIFVPQNVYCVHVDTKSSTTFKSAVQSLAKC----FDNVFVASKLEEVHYAHISRLQADINCLADLLKSPVRWKYAINLCGQDFPLRSNRELVSELKSLQGRSMLETGKPSAYKQQRFTHKFVLERRDSSLPALQHTQTALAPAPHGLEVFVGSAYFVLSREFVRFAITSAVAADFLRWCADTYSPDEHFWATLARSPQ--APGGGGGGKADVSDLQSKTRLVKWSYLEGRLYPVCSGRHVRSVCIYGAAELGWLLRDGHWFANKFDPHVDPVVVKCLEEEISSR 361          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 184.882 bits (468), Expect = 1.587e-53
Identity = 112/349 (32.09%), Postives = 165/349 (47.28%), Query Frame = 2
Query:  320 LTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKD--WKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKR--------------NEERIPHIKM---PFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNP-DEITSEYFMTRYKNW-----------GQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEA 1273
            L +++LL  +   CD F   + Y     S+EE+ FP+++S++A      +ERLLR +Y P N YC+HVD KS + +L A  AL  C    + N+        V +   S + ADLNCM EL    +   W+YFINL G++FP+KTN E+V+ L    G N+LE V   R              NE R   +     P P   F GS ++ V R F+ ++   P ++ L+        PDE  ++TL   P   +PGS   +   ++T    + R   W             YP      VR +C++GAGDL  ++   +LFANK         + CLE  +  K   EA
Sbjct:   91 LGEAELLA-MTRDCDAFRRARRYVLVPLSREEEAFPIAYSVVAHHRVDMLERLLRAVYAPQNLYCLHVDAKSPRAYLEAARALAAC----FPNVFVAAHLERVVYASWSRVQADLNCMSELVAMAERVPWRYFINLCGRDFPIKTNLEMVRALRTLNGRNSLETVRMPRGKRARWTLSYKVAGNEIRSTGLTKRPPPIPTPMFAGSAYVVVTRAFVEHVLSDPAARALIEWAGDTYSPDEHLWATLQRMPG--VPGSTPAHRIHDVTDAAALARLVKWSAFEGDVAGGGAAYPPCRGTHVRDVCVYGAGDLAWVLRQHHLFANKVDTAVDHVAVHCLEHHLRKKALAEA 432          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:ZFIN;Acc:ZDB-GENE-110411-253])

HSP 1 Score: 172.17 bits (435), Expect = 7.017e-49
Identity = 105/336 (31.25%), Postives = 160/336 (47.62%), Query Frame = 2
Query:  359 CDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVY--------------------KKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFM--TRYKNW----------GQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKE 1270
            CD F  ++ Y +   S+EE  FP+++S++A      +ERLLR IY P N YC+HVD KS   +  A+ AL  C    + N+     +  V +     + ADLNCM++L    + WKYFINL G +FP+KTN E+V+ L A  G N++E ++                    +   E++ P    P P   F G+ +I V R F+ ++   P ++ L+   K    PDE  ++TL   P   +PGS   + D+   E  M   R   W            YP      +R ICI  A DL  ++   +LF NK   +     + CLER++  K  ++
Sbjct:  100 CDAFKRDRRYVTVPLSEEEAAFPIAYSVVAHHRVDMLERLLRAIYAPQNVYCLHVDQKSPPPYQEAVRALAAC----FPNVFMASRQERVVYTSWLRVQADLNCMRDLVAAPQPWKYFINLCGLDFPIKTNLEMVRALRALNGENSMESMHTPGGKVGRWQIRHEIVNDGLRSTGEKKSPP---PIPTPMFSGNAYIVVTRAFVEHVLSDPTARALMEWEKDTFSPDEHLWATLQRLPG--VPGSTPPH-DKYDVEDMMAIARLVRWSYMEGDTLQGAAYPPCRGTHMRAICINSAKDLAWVLKQRHLFVNKLDSDVDELAVHCLERYLRRKALRQ 425          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Match: GCNT2 (glucosaminyl (N-acetyl) transferase 2 (I blood group) [Source:HGNC Symbol;Acc:HGNC:4204])

HSP 1 Score: 171.4 bits (433), Expect = 8.185e-49
Identity = 108/333 (32.43%), Postives = 161/333 (48.35%), Query Frame = 2
Query:  356 SCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKIL-TAYKGANNLEGVYK-------------------KRNEERIPHIKMPFP--VVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQ----YPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQ 1276
            +C  F+  ++Y +   SKEE++FPL++ I   K       L R IY P N YCIHVDVKS + F  ++  L  C    ++N+        V +   S L AD+NCM++L  +   WKY +NL GQ+FPL+TN E+V+IL   ++G N   G+++                   K+   R    K P P  +    G+ +  V R+F+ Y+ +  K++ LL   +    PDE +F TLN  P    PG+     + + S    TR   W      +       VR IC++G GDL  L    +LFANKF  +  P  L CLE W   +   E++
Sbjct:   70 NCSAFIEKQSYITEALSKEEQDFPLAYIITVHKDFETFSILFRNIYMPQNIYCIHVDVKSSESFKKSMQRLAGC----FDNVFLASRSETVVYAGFSRLKADINCMRDLATRPTPWKYVLNLCGQDFPLRTNQEIVRILKNKWRGKNITPGIFQPPHMKWRTQYVYKEVVDKDKKQMIRTNVAKGPPPHGINLCFGTAYYAVTREFVQYVLDDKKAQDLLEWSQETFSPDEHYFVTLNSLPD--APGA-----NTVPSWEGNTRAVKWRDGEKTHKGCKGHYVRDICVYGEGDLEWLTKRSDLFANKFEMQRYPLVLECLEHWARQRTLNESE 391          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO39617 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9I5])

HSP 1 Score: 162.925 bits (411), Expect = 1.115e-46
Identity = 100/285 (35.09%), Postives = 152/285 (53.33%), Query Frame = 2
Query:  386 YASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGV-YKKRNEERIPHIKM----------PFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPN---LFANK 1198
            Y    P++ E +FP+++ IL +K     ERLL+ +Y P NYYCIH+D K++  F+ A   +V CL     N+   K RV+VKWG++S++ A+L+CM EL + +K WKY+INL GQ+FPL  N E+V++L +  G NN+E +     N  R+  ++           P  ++  KGSVH  + R F  ++     ++ LL  ++     DE FF+TL Y+     PG   G   E      + R K W    C + + VR IC     DL  +++  N   LF NK
Sbjct:    7 YPHPTPTRTELDFPIAYGILIYKGLPLFERLLQALYMPQNYYCIHIDKKTNSYFVDAAQRMVACL----PNVFIAKTRVNVKWGEISLVKAELSCMTEL-QTFK-WKYYINLVGQDFPLYNNMEIVRVLKSLHGLNNIESIEMPAYNVHRVEFVRHGQKLLRKSPPPHGLIIRKGSVHGILTRKFTEFVLRDKVARDLLKWLEDVFAADEIFFATLQYDQA--TPGGIHGQQPEC-----IARVKRWRPGYC-AGRYVRNICWIDIRDLTWVLSEGNNRKLFVNK 277          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO37446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFS7])

HSP 1 Score: 147.902 bits (372), Expect = 6.510e-41
Identity = 83/294 (28.23%), Postives = 146/294 (49.66%), Query Frame = 2
Query:  413 EKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGV--------------YKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPN---LFANKFHEEFQPATLRCLER 1243
            E++FPL+F I+ +      ERLL+ IY P N YCIH+D K+ + F  A+  +++CL     N+      V V WG+ S++ A +NC++ L +    WKY++++ GQ+FPL TN E+V+ +      NN+E +                 R   +I     PF +   KG++H  + R F+ ++ ES  +   ++      +PDETFF+++  +P    PG  +G+        ++ +   W  +     +I+R +C     DL  +++  N   LF +K   ++    L CL +
Sbjct:    2 ERDFPLAFGIMIYNGLPLFERLLQEIYMPHNVYCIHIDRKTRQSFHKAVKQMISCLP----NVFIASKLVKVYWGEFSIVQAKMNCLRNLLKSPVKWKYYLHMIGQDFPLYTNHEMVRAIKTLNYTNNMESIKVPISNRDRTEYVYIGSRTRTKILKPPPPFNITLRKGNIHAMLTRGFVEFLLESEIANAFIDWCNDTSVPDETFFASMQNHPG--APGGVVGDQPP-----YIFKLIRWYWFDRCYGRIIRQVCWIDIKDLRSVLSQFNLSFLFVHKIPFDYDIELLDCLSQ 284          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Match: EDO36835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI4])

HSP 1 Score: 64.6994 bits (156), Expect = 4.899e-11
Identity = 54/207 (26.09%), Postives = 94/207 (45.41%), Query Frame = 2
Query:  443 LAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWK--YFINLTGQEFPLKTNAELVKILTAYKGAN----------------NLEGVYKKRNEE--RIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKS--KTLLNIVKGQLIPDETFFST 997
            L  ++  QI RL + IY   +Y+  H+D +SD      +   V+ +   + N       +   WG  ++L   L  M++L  + K+WK  +FINL+G +FP+K N  L   L +++  N                 L+  + + +E   R+   K+P  +    GS  I +NR +  Y+  S       L ++ +  L+P E+FF T
Sbjct:   86 LHGRALRQIRRLFKVIYHTHHYFYFHIDTRSD-----YLRREVSNMIKDFPNAALAPWSMATIWGGATLLQMLLKSMEDLIAR-KEWKWDFFINLSGNDFPIKVNTVLSSFLRSHRDVNFLKPHGRDIARFIKKQGLDRTFLQCDEHMWRLGDRKLPADLDIDGGSDWIALNRKYCDYLVTSRDELVTGLKHMYRYTLLPAESFFHT 286          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: ENSORLT00000007218.2 (glucosaminyl (N-acetyl) transferase 1 [Source:NCBI gene;Acc:101157299])

HSP 1 Score: 187.578 bits (475), Expect = 5.445e-54
Identity = 110/343 (32.07%), Postives = 167/343 (48.69%), Query Frame = 2
Query:  344 NIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLE--------------------GVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPD-EITSEYFMTRYKNW-----------GQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQ 1276
            N    C  F+  + Y +   SKEE++FPL++S++        ERLLR IY P N+YC+HVD K++     AI A+ +C    + N+      VDV +     + ADLNCM +LY   + WKYF+NL GQ+FPLKTN E+V+IL    G N++E                    G  + + E + P    PF +    G+ +I  +R +I  +    + + L+  +K    PDE  ++T+   P   +PGS   N   +++    + R   W             YP      VR IC++GAGDL  L+   + FANKF  +  P  + CLER++  K   E +
Sbjct:   94 NATEDCRLFIKTRKYITFPLSKEEEDFPLAYSMIVHHKVQNFERLLRAIYAPQNFYCVHVDKKAEPSVFAAILAISSC----FPNVFLVSQSVDVVYAGWPRVQADLNCMADLYNTSRRWKYFLNLCGQDFPLKTNLEMVRILKTLNGGNSMESENMPPEKKWRVTNAHQIVDGKIQAKGEAKSPS---PFNLPIMSGNAYIVASRGYIHSVLHDKRIQALIEWMKDTYSPDEAIWATIQRIPG--VPGSTRPNRKYDVSDINALARLVKWQWHEGSQDSLDALYPVCHGNHVRAICVYGAGDLQWLLENHHFFANKFDTDTDPIAIYCLERYLRKKALAELE 427          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: gcnt3 (glucosaminyl (N-acetyl) transferase 3, mucin type [Source:NCBI gene;Acc:101155272])

HSP 1 Score: 174.096 bits (440), Expect = 6.372e-49
Identity = 113/371 (30.46%), Postives = 176/371 (47.44%), Query Frame = 2
Query:  233 PDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLE----GVYKKRNEE-----------RIPHIKMPFPVV--WFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSE-----------YFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKV 1261
            P C  +L  NV +++ +     V     +L   +   N    C  F++ + + +   S+EEK FP+++S++  +     ERLLR IY P N YC+HVD KS  ++ TA+  +V+C    + NI        V +   S + ADLNCMK+L      WKY +N  G +FP+KTN E+V  L    G N++E      YKK   E           R    K P P+    + G+ +  V+R F+ ++ +  +++ L++  K    PDE  ++TL   PQ  +PGS   N    TS+           Y     +    YP  +    R +C++G GDL  L+   +LFANKF  E     +RC+E  +  K 
Sbjct:   48 PACLAILTGNVGSQNPELDLLLVSRERKSLLSEEFYLNATKDCPAFIAKRGFITEPLSEEEKKFPIAYSMVIHEKIEMFERLLRAIYAPQNVYCVHVDQKSSPEYQTAVKRIVSC----FPNIFIASKLERVVYASWSRVQADLNCMKDLLNSDVPWKYLLNTCGTDFPIKTNREMVSALKLLNGRNSMETEVTNDYKKGRWEYHHNVTDTSVIRTGVKKSPPPISSPMYSGNAYFIVSRAFVKHLMKDEEAQRLIDWEKDTYSPDEHLWATLQRMPQ--VPGSLPFNSKYDTSDMLAFARAVKWVYHTGDVRKGAPYPPCTGTYRRAVCVYGVGDLLWLLQTHHLFANKFDPEVDDIAIRCMESILRSKA 412          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: si:dkeyp-87d8.8 (glucosaminyl (N-acetyl) transferase 4 [Source:NCBI gene;Acc:101166645])

HSP 1 Score: 174.096 bits (440), Expect = 6.533e-49
Identity = 113/335 (33.73%), Postives = 165/335 (49.25%), Query Frame = 2
Query:  338 LQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLE-----GVYKKR------------NEERIP----HIKMPFP--VVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQ-----YPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDK 1258
            L     +C +F+  + Y     S +EK+FPL++S++  K++  +ERLLR  Y P N YCIH D KS  QF  A++ L  CL     N+     R  V +  +S L ADLNC+ +L E    WKY INL GQ+FPLK+N ELV  L    G+N LE      + K R              +++P      K P P  +  F G+ +  ++R+FI ++  S  +    +  K    PDE F++TL   P    PG       +IT     TR   W       YP  + + VR +CI+G G+L  L+   + FANKF  +  P  ++CLE  + +K
Sbjct:   89 LAEFTENCPSFIKIRGYDDVCFSDQEKDFPLAYSLVVHKNAWMVERLLRATYSPVNVYCIHYDQKSTPQFTAAMEGLARCL----PNVFIASKRESVFYASISRLQADLNCLHDLVESEVKWKYVINLCGQDFPLKSNMELVSELRKLNGSNMLETSRPSNIKKDRFSFHHELKDASFEYQKLPVRTDQAKSPPPHGIEMFIGNAYFVLSREFILHMTSSVIAMDFFDWSKDTYSPDEHFWATLVRVPGF--PGEVAREKPDITDLMSKTRLVKWSYLEGSLYPLCTGEHVRSVCIYGCGELRWLLNYGHWFANKFEPKVDPVLIQCLEERLEEK 417          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: gcnt7 (beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 7-like [Source:NCBI gene;Acc:101157298])

HSP 1 Score: 155.992 bits (393), Expect = 2.821e-42
Identity = 105/344 (30.52%), Postives = 168/344 (48.84%), Query Frame = 2
Query:  326 DSQLLQNI---HSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTA--YKGANNLEGV-----YKKRNEERIPHI-----------KMPFP---VVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNY---NPQLRIPGSYIGNPDEITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQ 1276
            D Q++ +I   +  C   + + ++ +   S+EE+++PL+F +   K      R LR IY P N YCIH+D K+  ++   +  LV C    + NI  +     V +G  S L ADLNCMK+L      WK  +NL GQ+FP+K+N ELV+ + +  ++  N   GV      + R E +   I           K P P    ++F G+ +  + R F+ ++ +SP +  LL   K    PDE ++ TLN+    P  R+ G + G+   I       + +    +       VR IC++G GD+  ++   N+FANKF     P  L CLE+W   KV  +A+
Sbjct:   67 DCQVVNHILKDNQPCVELIRDLHFITRPLSQEEEDYPLAFIMTIHKDLEMFVRTLRAIYMPQNVYCIHIDAKAPLEYKKVVRGLVGC----FENIFLSSQSETVTYGGYSRLQADLNCMKDLIRSNVGWKKVVNLCGQDFPIKSNLELVQYMQSKEWRDKNLTPGVKQPAHIRSRTEFQHQEIVGSHVIQKGEKKEPPPDNLQIYF-GTAYYALTRAFVDFVLKSPIALNLLKWSKDAYSPDEHYWVTLNHLKEAPGSRVDGGWEGDIRAIK-----WKDQEGTNHQGCKGHYVRDICVYGMGDIEWIINNNNMFANKFESNAYPEALDCLEQWHRSKVLNQAK 400          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Match: ENSORLT00000033084.1 (xylosyltransferase 1 [Source:NCBI gene;Acc:100049491])

HSP 1 Score: 83.5741 bits (205), Expect = 1.525e-16
Identity = 64/213 (30.05%), Postives = 104/213 (48.83%), Query Frame = 2
Query:  440 ILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYK-DWKYFINLTGQEFPLKTNAELVKILTAYK--------GANNLEGVYKKRNEE----------RIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKG----QLIPDETFFSTLNYN 1009
            ++  ++S Q++RL + IY   +YY IHVD +SD  FL      V  L  +Y N+  T  R+   WG  S+LT  L  M++L       W +FINL+  +FP++TN +LV  L+ ++        G +N   + K+  +           R+   K+P  +    GS    ++R F+ Y+  S     L+N +K      L+P E+FF T+  N
Sbjct:  352 VVHGRASRQLQRLFKAIYHTSHYYYIHVDQRSD--FL---HREVLSLARQYPNVRVTPWRMATIWGGASLLTMYLRSMEDLLSMTDWSWDFFINLSAADFPIRTNEQLVAFLSKHRSKNFIKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRKIPEGIAVDGGSDWFLLSRSFVDYVVNS--GDELVNSMKRFYAYTLLPAESFFHTVLEN 557          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000008883.1 (SMESG000008883.1)

HSP 1 Score: 867.455 bits (2240), Expect = 0.000e+0
Identity = 418/422 (99.05%), Postives = 421/422 (99.76%), Query Frame = 2
Query:   89 MKISFRKFYLFFFTLLAICIIVGYFRSVLSPANQIVQSFKNLSIQSSEPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSSLPFVKYQYNPSND 1354
            MKISFRKFYLFFFTLLAICIIVGYFRSVLSPANQIVQSFKNLSIQSSEPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTK+RVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDF+A+IFESPKSKTLLNIVK QLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSSLPFVKYQYNPSND
Sbjct:    1 MKISFRKFYLFFFTLLAICIIVGYFRSVLSPANQIVQSFKNLSIQSSEPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKNRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFVAFIFESPKSKTLLNIVKSQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSSLPFVKYQYNPSND 422          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000043068.1 (SMESG000043068.1)

HSP 1 Score: 533.102 bits (1372), Expect = 0.000e+0
Identity = 247/376 (65.69%), Postives = 300/376 (79.79%), Query Frame = 2
Query:  236 DCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHP-SKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSEY-----FMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSSLPFVKYQYNP 1345
            DC  LL  NV  K L+ A+ W    N++ TDSQ+ QNIH +C  FL N+NY    P + EE+NF ++F+I+ FKS SQIERLLRTIYRPWNYYCIH+D KSDK+F  A++ LV CLNS+Y NI+NT++RVDV+WGKMSVLTADLNCMKELYE++KDWKY INLTGQEFPLKTN ELVKIL AYKGANNLEG YK+RNE R+P +KMPFP++W+KGSVH+TVNRDFI +IF SPKS+ LL  +KGQ +PDE FF+TLN+NPQ RIPGS+IG+PD++  E      FMTRYKNWG+Y C S  IVRGICIWG GD+PKLV  P+LF NKF+E+FQPATLRC+E W +DK+ KE Q   V I+  FYS+LPFV +Q+ P
Sbjct:   35 DCAALLHSNVNQKKLEYAKTWQPLRNESFTDSQMYQNIHQNCSNFLENQNYFLQFPNTTEEENFRIAFTIVTFKSGSQIERLLRTIYRPWNYYCIHIDKKSDKKFTEALEELVKCLNSRYKNIINTENRVDVQWGKMSVLTADLNCMKELYERFKDWKYLINLTGQEFPLKTNKELVKILKAYKGANNLEGTYKRRNEYRVPTVKMPFPLIWYKGSVHVTVNRDFIKFIFGSPKSQDLLKALKGQHVPDEQFFATLNHNPQFRIPGSFIGDPDDLELEKQPLINFMTRYKNWGEYTCESKLIVRGICIWGVGDIPKLVKVPHLFTNKFYEDFQPATLRCMEEWYYDKINKEIQNNGVNINETFYSTLPFVVHQFIP 410          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000051787.1 (SMESG000051787.1)

HSP 1 Score: 530.791 bits (1366), Expect = 0.000e+0
Identity = 248/386 (64.25%), Postives = 302/386 (78.24%), Query Frame = 2
Query:  203 FKNLSIQSSEPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSE-----YFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSSLPFVKYQYNP 1345
            F NL+I  +EP+C EL + ++    +  +  W    N++ TD Q+ Q I+ SC  F+ NK Y     SKEEK+F ++FSI+ +K++SQ+ERLLRTIYRPWNYYCIHVD KS  +F+ AI  L  CLNSK+NN++NT +RVDV+WGKMSVLTADLNCMKELY++YK+WKYFINLTGQEFPLKTNAELVKIL A+KGAN++E  YK+R + RIP +KMPFP++W+ GSVHI VN DF+++IFESP SK LL+ +    IPDETFFSTLNYNPQLRI GSY+GNPDEI S+     Y  TRYKNWGQYPC S KIVR ICI G GDLP++V APNLFANKF+EEFQPATLRCLERWI+DKV KE + GT  ID  FY  LPFVK++Y P
Sbjct:   39 FANLNIALTEPNCNELFRTDISKSVINSSINWKWFPNESFTDYQMYQVINKSCSNFIMNKKYLLKELSKEEKDFRIAFSIVVYKNASQVERLLRTIYRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFKGANHVEAYYKRRFDNRIPTVKMPFPIIWYTGSVHIIVNLDFVSFIFESPVSKVLLDSLNNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKIVRDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKEFRKGTAAIDDSFYKLLPFVKFRYIP 424          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000051787.1 (SMESG000051787.1)

HSP 1 Score: 530.791 bits (1366), Expect = 0.000e+0
Identity = 248/386 (64.25%), Postives = 302/386 (78.24%), Query Frame = 2
Query:  203 FKNLSIQSSEPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSE-----YFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSSLPFVKYQYNP 1345
            F NL+I  +EP+C EL + ++    +  +  W    N++ TD Q+ Q I+ SC  F+ NK Y     SKEEK+F ++FSI+ +K++SQ+ERLLRTIYRPWNYYCIHVD KS  +F+ AI  L  CLNSK+NN++NT +RVDV+WGKMSVLTADLNCMKELY++YK+WKYFINLTGQEFPLKTNAELVKIL A+KGAN++E  YK+R + RIP +KMPFP++W+ GSVHI VN DF+++IFESP SK LL+ +    IPDETFFSTLNYNPQLRI GSY+GNPDEI S+     Y  TRYKNWGQYPC S KIVR ICI G GDLP++V APNLFANKF+EEFQPATLRCLERWI+DKV KE + GT  ID  FY  LPFVK++Y P
Sbjct:   38 FANLNIALTEPNCNELFRTDISKSVINSSINWKWFPNESFTDYQMYQVINKSCSNFIMNKKYLLKELSKEEKDFRIAFSIVVYKNASQVERLLRTIYRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFKGANHVEAYYKRRFDNRIPTVKMPFPIIWYTGSVHIIVNLDFVSFIFESPVSKVLLDSLNNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKIVRDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKEFRKGTAAIDDSFYKLLPFVKFRYIP 423          
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Match: SMESG000051810.1 (SMESG000051810.1)

HSP 1 Score: 527.324 bits (1357), Expect = 0.000e+0
Identity = 247/386 (63.99%), Postives = 301/386 (77.98%), Query Frame = 2
Query:  203 FKNLSIQSSEPDCYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNYASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSDKQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYEKYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIPHIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETFFSTLNYNPQLRIPGSYIGNPDEITSE-----YFMTRYKNWGQYPCVSNKIVRGICIWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTVEIDSEFYSSLPFVKYQYNP 1345
            F NL+I  +EP+C EL + ++    +  +  W    N++ TD Q+ Q I+ SC  F+ NK Y     SKEEK+F ++FSI+ +K++SQ+ERLLRTIYRPWNYYCIHVD KS  +F+ AI  L  CLNSK+NN++NT +RVDV+WGKMSVLTADLNCMKELY++YK+WKYFINLTGQEFPLKTNAELVKIL A+KGAN++E  YK+R + RIP +KMPFP++W+ GSVHI VN DF+++IFESP SK LL+ +    IPDETFFSTLNYNPQLRI GSY+GNPDEI S+     Y  TRYKNWGQYPC S KIV  ICI G GDLP++V APNLFANKF+EEFQPATLRCLERWI+DKV KE + GT  ID  FY  LPFVK++Y P
Sbjct:   39 FANLNIALTEPNCNELFRTDISKSVINSSINWKWFPNESFTDYQMYQVINKSCSNFIMNKKYLLKELSKEEKDFRIAFSIVVYKNASQVERLLRTIYRPWNYYCIHVDTKSKPEFVKAIGKLTECLNSKHNNVINTDNRVDVQWGKMSVLTADLNCMKELYQRYKNWKYFINLTGQEFPLKTNAELVKILKAFKGANHVEAYYKRRFDNRIPTVKMPFPIIWYTGSVHIIVNLDFVSFIFESPVSKVLLDSLNNHFIPDETFFSTLNYNPQLRISGSYVGNPDEIQSQNDSLGYMKTRYKNWGQYPCESKKIVPDICILGVGDLPRIVNAPNLFANKFYEEFQPATLRCLERWIYDKVDKEFRKGTAAIDDSFYKLLPFVKFRYIP 424          
The following BLAST results are available for this feature:
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GCNT13.204e-5332.53glucosaminyl (N-acetyl) transferase 1 [Source:HGNC... [more]
GCNT13.204e-5332.53glucosaminyl (N-acetyl) transferase 1 [Source:HGNC... [more]
GCNT13.204e-5332.53glucosaminyl (N-acetyl) transferase 1 [Source:HGNC... [more]
GCNT21.219e-5031.91glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
GCNT22.385e-5033.90glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gly-173.730e-3931.56GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
gly-169.203e-3829.57GLY-16; GLYcosylation related [Source:UniProtKB/T... [more]
gly-15.993e-3723.85GLY-1; GLYcosylation related [Source:UniProtKB/Tr... [more]
gly-186.170e-3629.54GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
gly-152.707e-3425.46GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oxt1.743e-2225.92gene:FBgn0015360 transcript:FBtr0072904[more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcnt4b1.220e-5129.62glucosaminyl (N-acetyl) transferase 4b [Source:ZFI... [more]
gcnt4b7.900e-5132.14glucosaminyl (N-acetyl) transferase 4b [Source:ZFI... [more]
si:dkeyp-87d8.81.230e-5031.36si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-1... [more]
si:dkeyp-87d8.81.360e-5031.36si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-1... [more]
si:dkeyp-87d8.82.494e-5029.69si:dkeyp-87d8.8 [Source:ZFIN;Acc:ZDB-GENE-041111-1... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc772.893e-5831.81coiled-coil domain containing 77 [Source:Xenbase;A... [more]
GCNT44.651e-5532.95glucosaminyl (N-acetyl) transferase 4 [Source:NCBI... [more]
cnksr28.248e-5133.23connector enhancer of kinase suppressor of Ras 2 [... [more]
gcnt2.23.875e-4933.33glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
slc24a46.415e-4930.13solute carrier family 24 member 4 [Source:Xenbase;... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gcnt16.411e-5532.04glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt16.411e-5532.04glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt16.411e-5532.04glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt16.411e-5532.04glucosaminyl (N-acetyl) transferase 1, core 2 [Sou... [more]
Gcnt41.816e-4731.30glucosaminyl (N-acetyl) transferase 4, core 2 (bet... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q09324|GCNT1_MOUSE4.485e-5432.04Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q02742|GCNT1_HUMAN1.539e-5232.53Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q92180|GCNT1_BOVIN4.246e-5132.24Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q805R1|GCNT3_BHV4L6.536e-5034.40Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
sp|Q9IZK2|GCNT3_BHV4V8.209e-5034.11Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7AQP92.970e-9947.90Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A2T7P1541.116e-9642.28Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2T7P1441.851e-9644.44Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2T7P1391.679e-9441.73Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A0B7AMK81.112e-9347.93Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000050168.11.100e-5734.10pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000026751.21.625e-5735.57glucosaminyl (N-acetyl) transferase 1 [Source:NCBI... [more]
gcnt4b4.122e-5431.92beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
gcnt4a1.170e-5229.65glucosaminyl (N-acetyl) transferase 4 [Source:NCBI... [more]
gcnt32.167e-4931.25glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcnt4a1.027e-5632.79glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
gcnt4a1.217e-5632.79glucosaminyl (N-acetyl) transferase 4a [Source:NCB... [more]
gcnt31.587e-5332.09glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
gcnt37.017e-4931.25glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
GCNT28.185e-4932.43glucosaminyl (N-acetyl) transferase 2 (I blood gro... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO396171.115e-4635.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374466.510e-4128.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368354.899e-1126.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000007218.25.445e-5432.07glucosaminyl (N-acetyl) transferase 1 [Source:NCBI... [more]
gcnt36.372e-4930.46glucosaminyl (N-acetyl) transferase 3, mucin type ... [more]
si:dkeyp-87d8.86.533e-4933.73glucosaminyl (N-acetyl) transferase 4 [Source:NCBI... [more]
gcnt72.821e-4230.52beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1... [more]
ENSORLT00000033084.11.525e-1630.05xylosyltransferase 1 [Source:NCBI gene;Acc:1000494... [more]
back to top
BLAST of beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008883.10.000e+099.05SMESG000008883.1[more]
SMESG000043068.10.000e+065.69SMESG000043068.1[more]
SMESG000051787.10.000e+064.25SMESG000051787.1[more]
SMESG000051787.10.000e+064.25SMESG000051787.1[more]
SMESG000051810.10.000e+063.99SMESG000051810.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026622 ID=SMED30026622|Name=beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1438bp
CGAAAACAAAGCGCGACTTAATGATAGAGAAACAAAATTAAAATTTTAAT
TTACTAAGTTAAGTTATTTCTTTTATATTGAAATAAGAATGAAAATTTCA
TTCCGAAAATTTTATTTATTTTTTTTTACACTGTTAGCAATATGCATTAT
TGTAGGGTATTTTCGCTCAGTCCTTTCACCAGCAAATCAGATTGTTCAAA
GTTTTAAAAATTTATCTATCCAATCATCTGAGCCAGATTGCTATGAATTA
TTAAAACCGAATGTTGAAAACAAATCACTCCAGGATGCCGAGAAATGGGT
TGTTCCATTAAATGATACATTAACAGATTCTCAATTGCTTCAAAATATTC
ACTCAAGTTGTGATACTTTTTTATCAAATAAAAATTACGCGTCTAACCAT
CCTTCAAAAGAGGAAAAAAATTTCCCACTTTCTTTCAGCATTCTTGCATT
CAAAAGCTCATCTCAAATCGAAAGATTATTAAGAACGATTTATCGCCCAT
GGAATTATTACTGTATTCATGTCGATGTAAAATCAGATAAGCAATTTCTA
ACAGCTATAGATGCATTGGTGAATTGTCTGAATTCAAAATATAATAACAT
TGTCAATACAAAAGATCGAGTTGATGTCAAATGGGGTAAAATGTCAGTTT
TAACAGCAGATTTAAATTGCATGAAAGAACTGTATGAAAAATACAAAGAT
TGGAAATATTTTATCAATTTGACCGGACAAGAGTTTCCATTAAAAACGAA
TGCGGAATTAGTAAAGATTCTCACTGCTTATAAAGGTGCAAATAACTTAG
AAGGAGTATATAAAAAGCGAAACGAAGAACGAATTCCACATATTAAAATG
CCATTTCCGGTTGTTTGGTTCAAAGGCTCGGTTCACATTACCGTCAATCG
AGATTTCATAGCTTATATATTCGAATCTCCGAAATCAAAAACTTTACTTA
ACATTGTGAAAGGTCAATTGATTCCAGATGAAACTTTCTTTTCAACTCTT
AATTATAATCCTCAGTTACGAATTCCAGGTTCATATATTGGTAATCCTGA
TGAAATTACATCTGAATACTTTATGACTCGATATAAAAATTGGGGTCAAT
ATCCATGTGTAAGCAACAAGATAGTTAGAGGGATATGCATTTGGGGAGCT
GGGGATTTACCCAAATTGGTGACTGCACCAAATTTATTCGCTAATAAATT
CCATGAGGAATTTCAACCTGCTACATTGAGATGTTTGGAAAGATGGATCC
ATGATAAAGTTCAAAAAGAAGCTCAAACCGGTACTGTGGAAATCGATTCG
GAGTTCTACAGTTCTTTGCCATTTGTGAAATATCAGTACAATCCATCCAA
TGATTATTAGATGCTCCCACTTATTTATATATGCCTTTTACTTTTTTATT
GAAATTTGATTTTTTGAAATACATATTCTATTATTGGA
back to top

protein sequence of SMED30026622-orf-1

>SMED30026622-orf-1 ID=SMED30026622-orf-1|Name=SMED30026622-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=424bp
MKISFRKFYLFFFTLLAICIIVGYFRSVLSPANQIVQSFKNLSIQSSEPD
CYELLKPNVENKSLQDAEKWVVPLNDTLTDSQLLQNIHSSCDTFLSNKNY
ASNHPSKEEKNFPLSFSILAFKSSSQIERLLRTIYRPWNYYCIHVDVKSD
KQFLTAIDALVNCLNSKYNNIVNTKDRVDVKWGKMSVLTADLNCMKELYE
KYKDWKYFINLTGQEFPLKTNAELVKILTAYKGANNLEGVYKKRNEERIP
HIKMPFPVVWFKGSVHITVNRDFIAYIFESPKSKTLLNIVKGQLIPDETF
FSTLNYNPQLRIPGSYIGNPDEITSEYFMTRYKNWGQYPCVSNKIVRGIC
IWGAGDLPKLVTAPNLFANKFHEEFQPATLRCLERWIHDKVQKEAQTGTV
EIDSEFYSSLPFVKYQYNPSNDY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000421tail
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR003406Glyco_trans_14
Vocabulary: molecular function
TermDefinition
GO:0008375acetylglucosaminyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003406Glycosyl transferase, family 14PFAMPF02485Branchcoord: 115..360
e-value: 6.6E-37
score: 127.3
NoneNo IPR availablePANTHERPTHR19297GLYCOSYLTRANSFERASE 14 FAMILY MEMBERcoord: 8..396
NoneNo IPR availableTMHMMTMhelixcoord: 7..29