Mitochondrial calcium uniporter

Overview
NameMitochondrial calcium uniporter
Smed IDSMED30026619
Length (bp)1190
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitochondrial calcium uniporter (SMED30026619) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitochondrial calcium uniporter (SMED30026619) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitochondrial calcium uniporter (SMED30026619) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitochondrial calcium uniporter (SMED30026619) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026619

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026619SMESG000000983.1 SmedASXL_006359SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30026619SMESG000000983.1 dd_Smed_v4_4033_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026619SMESG000000983.1 dd_Smed_v4_4033_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30026619SMESG000000983.1 dd_Smed_v4_4033_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30026619SMESG000000983.1 dd_Smed_v4_4033_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026619SMESG000000983.1 dd_Smed_v6_4033_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026619SMESG000000983.1 dd_Smed_v4_4033_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitochondrial calcium uniporter vs. Ensembl Human
Match: MCU (mitochondrial calcium uniporter [Source:HGNC Symbol;Acc:HGNC:23526])

HSP 1 Score: 239.195 bits (609), Expect = 6.379e-76
Identity = 124/254 (48.82%), Postives = 176/254 (69.29%), Query Frame = 1
Query:  133 LTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            +T+ Y  GLP   V LPSR+E C F LKPI+ +VG  +  ++EED GIDR+AIY+ DG R++ S  I  LL  DF LVIN+ TY V   +  + S E    LN +K ++ QL  T+ +++  L KE+EL  +LE ++ +L PLEK RI+I+ KA   T  + W GL  M  QFG+LARLTWWEYSWDIMEPVTYF+ YG+A+AMYAY+V+TRQEY +P+  DR+YL  F+  + +++FD+++YN+L++  A+ +
Sbjct:   26 VTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAE 279          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Human
Match: MCU (mitochondrial calcium uniporter [Source:HGNC Symbol;Acc:HGNC:23526])

HSP 1 Score: 239.965 bits (611), Expect = 1.293e-75
Identity = 129/283 (45.58%), Postives = 185/283 (65.37%), Query Frame = 1
Query:   61 NYHTFIKQNIFLFQKFCTNHKENVL-----TISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
             +H  + Q I  +Q     +   V+     T+ Y  GLP   V LPSR+E C F LKPI+ +VG  +  ++EED GIDR+AIY+ DG R++ S  I  LL  DF LVIN+ TY V   +  + S E    LN +K ++ QL  T+ +++  L KE+EL  +LE ++ +L PLEK RI+I+ KA   T  + W GL  M  QFG+LARLTWWEYSWDIMEPVTYF+ YG+A+AMYAY+V+TRQEY +P+  DR+YL  F+  + +++FD+++YN+L++  A+ +
Sbjct:   46 QHHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAE 328          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Human
Match: MCU (mitochondrial calcium uniporter [Source:HGNC Symbol;Acc:HGNC:23526])

HSP 1 Score: 203.371 bits (516), Expect = 1.068e-61
Identity = 113/283 (39.93%), Postives = 162/283 (57.24%), Query Frame = 1
Query:   61 NYHTFIKQNIFLFQKFCTNHKENVL-----TISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
             +H  + Q I  +Q     +   V+     T+ Y  GLP   V LPSR+E C F LKPI+ +VG  +  ++EED GIDR+AIY+ DG R++ S  I  LL  DF LVIN+ TY V   +        + Q NG + + S                           ++   +   RI+I+ KA   T  + W GL  M  QFG+LARLTWWEYSWDIMEPVTYF+ YG+A+AMYAY+V+TRQEY +P+  DR+YL  F+  + +++FD+++YN+L++  A+ +
Sbjct:   46 QHHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRVEMGFCHVGQ-NGFELLTSSYLPA--------------------SASQSAEIIAVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAE 307          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Human
Match: MCUB (mitochondrial calcium uniporter dominant negative beta subunit [Source:HGNC Symbol;Acc:HGNC:26076])

HSP 1 Score: 175.637 bits (444), Expect = 4.989e-51
Identity = 95/254 (37.40%), Postives = 153/254 (60.24%), Query Frame = 1
Query:  133 LTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            +T+ Y  GLP   + LPSR+E C F++KP+   VG  +  ++ ED GI   AI+  DG  IS S  +  LL +DF LVIN+  Y V   +    S E   ++  +K+++ +L   ++++E   ++E  L  K++ ++ +L PLE+ +  I   +   T  L W GL  + +Q G LA LTWW YSWDIMEPVTYF+ +  ++  +AY++VTRQ+Y +  V  R++L+ F+  S Q  FD+ +YN+L+E+ A+ +
Sbjct:   60 ITVIYRHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIFTADGNMISASTLMDILLMNDFKLVINKIAYDVQCPKREKPSNEHTAEMEHMKSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLEQVKAGIEAHSEAKTSGLLWAGLALLSIQGGALAWLTWWVYSWDIMEPVTYFITFANSMVFFAYFIVTRQDYTYSAVKSRQFLQFFHKKSKQQHFDVQQYNKLKEDLAKAK 313          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Human
Match: MCU (mitochondrial calcium uniporter [Source:HGNC Symbol;Acc:HGNC:23526])

HSP 1 Score: 100.908 bits (250), Expect = 9.515e-25
Identity = 53/120 (44.17%), Postives = 75/120 (62.50%), Query Frame = 1
Query:  133 LTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDE 492
            +T+ Y  GLP   V LPSR+E C F LKPI+ +VG  +  ++EED GIDR+AIY+ DG R++ S  I  LL  DF LVIN+ TY V   +  + S E    LN +K ++ QL  T+ +++
Sbjct:   40 VTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQ 159          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Celegans
Match: mcu-1 (Calcium uniporter protein, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q21121])

HSP 1 Score: 193.356 bits (490), Expect = 2.598e-58
Identity = 100/249 (40.16%), Postives = 150/249 (60.24%), Query Frame = 1
Query:  133 LTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSH-DFNLVINEHTYRVTASQPTIS--SEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNEL 870
            L+I +  GLP   VPLPSR E C F ++P++  +G L   +++ED GID +A+Y  +G +++   SI  LL    F L +N+  + VT  +        +K+ QL+ ++  ++ L   + VDE+ L +E++L ++LE  +T L PL   +  I  +   HT R+ W G  AMG+Q GL ARLTWWEYSWDIMEPVTYF  Y T  A + YY+ T+Q + +P   +R Y K+FY  + +  FDI++YN L
Sbjct:   51 LSIRFEYGLPLLDVPLPSRNEPCQFTMRPLSDTIGSLCEFLRQEDRGIDYVAVYGTNGVKLATCTSIEHLLQFGSFRLRLNDKFFDVTVPKTGTMPYDSDKLRQLDDLRATVASLHAALCVDEYKLSREKKLLLQLENAETLLAPLHDAKRKIEQECEAHTDRVMWAGFAAMGVQTGLFARLTWWEYSWDIMEPVTYFATYSTVCATFGYYLYTQQSFEYPSARERVYTKQFYRRAQKQNFDIEKYNRL 299          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Fly
Match: MCU (gene:FBgn0042185 transcript:FBtr0344294)

HSP 1 Score: 235.728 bits (600), Expect = 3.652e-74
Identity = 118/252 (46.83%), Postives = 169/252 (67.06%), Query Frame = 1
Query:  139 ISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            + Y  G+PH  V LPSR E C F LKPI+ NVGDL+  ++ ED GIDR A+ N  G RI+ S +I SLL   F++ IN  T  V   +    + E ++++  ++ +I+QL    NV E+ L+K  +L  +LE ++ EL PLE+++++++ KAA  T  +TW+GLG M +QFG+LARLTWWEYSWDIMEPVTYFV YGT +AMYAYY VT++EY    V +RE+    Y  + + +FD++ YNEL+   AE++
Sbjct:   75 VEYVNGMPHMTVRLPSRNELCQFALKPISHNVGDLLAMLRAEDRGIDRAAVINKHGVRIASSCTIESLLDDSFSIQINNRTLDVNPPKRDKVTLESMDKVGDVRKVIAQLYEAFNVGEYQLEKSNQLAKELETLRYELEPLEEKKLELSKKAARRTNFMTWMGLGLMSVQFGILARLTWWEYSWDIMEPVTYFVTYGTTMAMYAYYCVTKREYMMEDVKNREFSLSLYRNAKKVQFDVEHYNELKRKSAELE 326          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Fly
Match: MCU (gene:FBgn0042185 transcript:FBtr0076972)

HSP 1 Score: 235.728 bits (600), Expect = 3.679e-74
Identity = 118/252 (46.83%), Postives = 169/252 (67.06%), Query Frame = 1
Query:  139 ISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            + Y  G+PH  V LPSR E C F LKPI+ NVGDL+  ++ ED GIDR A+ N  G RI+ S +I SLL   F++ IN  T  V   +    + E ++++  ++ +I+QL    NV E+ L+K  +L  +LE ++ EL PLE+++++++ KAA  T  +TW+GLG M +QFG+LARLTWWEYSWDIMEPVTYFV YGT +AMYAYY VT++EY    V +RE+    Y  + + +FD++ YNEL+   AE++
Sbjct:   76 VEYVNGMPHMTVRLPSRNELCQFALKPISHNVGDLLAMLRAEDRGIDRAAVINKHGVRIASSCTIESLLDDSFSIQINNRTLDVNPPKRDKVTLESMDKVGDVRKVIAQLYEAFNVGEYQLEKSNQLAKELETLRYELEPLEEKKLELSKKAARRTNFMTWMGLGLMSVQFGILARLTWWEYSWDIMEPVTYFVTYGTTMAMYAYYCVTKREYMMEDVKNREFSLSLYRNAKKVQFDVEHYNELKRKSAELE 327          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Fly
Match: MCU (gene:FBgn0042185 transcript:FBtr0076971)

HSP 1 Score: 235.728 bits (600), Expect = 3.679e-74
Identity = 118/252 (46.83%), Postives = 169/252 (67.06%), Query Frame = 1
Query:  139 ISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            + Y  G+PH  V LPSR E C F LKPI+ NVGDL+  ++ ED GIDR A+ N  G RI+ S +I SLL   F++ IN  T  V   +    + E ++++  ++ +I+QL    NV E+ L+K  +L  +LE ++ EL PLE+++++++ KAA  T  +TW+GLG M +QFG+LARLTWWEYSWDIMEPVTYFV YGT +AMYAYY VT++EY    V +RE+    Y  + + +FD++ YNEL+   AE++
Sbjct:   76 VEYVNGMPHMTVRLPSRNELCQFALKPISHNVGDLLAMLRAEDRGIDRAAVINKHGVRIASSCTIESLLDDSFSIQINNRTLDVNPPKRDKVTLESMDKVGDVRKVIAQLYEAFNVGEYQLEKSNQLAKELETLRYELEPLEEKKLELSKKAARRTNFMTWMGLGLMSVQFGILARLTWWEYSWDIMEPVTYFVTYGTTMAMYAYYCVTKREYMMEDVKNREFSLSLYRNAKKVQFDVEHYNELKRKSAELE 327          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Fly
Match: MCU (gene:FBgn0042185 transcript:FBtr0076970)

HSP 1 Score: 235.728 bits (600), Expect = 3.679e-74
Identity = 118/252 (46.83%), Postives = 169/252 (67.06%), Query Frame = 1
Query:  139 ISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            + Y  G+PH  V LPSR E C F LKPI+ NVGDL+  ++ ED GIDR A+ N  G RI+ S +I SLL   F++ IN  T  V   +    + E ++++  ++ +I+QL    NV E+ L+K  +L  +LE ++ EL PLE+++++++ KAA  T  +TW+GLG M +QFG+LARLTWWEYSWDIMEPVTYFV YGT +AMYAYY VT++EY    V +RE+    Y  + + +FD++ YNEL+   AE++
Sbjct:   76 VEYVNGMPHMTVRLPSRNELCQFALKPISHNVGDLLAMLRAEDRGIDRAAVINKHGVRIASSCTIESLLDDSFSIQINNRTLDVNPPKRDKVTLESMDKVGDVRKVIAQLYEAFNVGEYQLEKSNQLAKELETLRYELEPLEEKKLELSKKAARRTNFMTWMGLGLMSVQFGILARLTWWEYSWDIMEPVTYFVTYGTTMAMYAYYCVTKREYMMEDVKNREFSLSLYRNAKKVQFDVEHYNELKRKSAELE 327          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Fly
Match: MCU (gene:FBgn0042185 transcript:FBtr0076973)

HSP 1 Score: 235.728 bits (600), Expect = 3.679e-74
Identity = 118/252 (46.83%), Postives = 169/252 (67.06%), Query Frame = 1
Query:  139 ISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            + Y  G+PH  V LPSR E C F LKPI+ NVGDL+  ++ ED GIDR A+ N  G RI+ S +I SLL   F++ IN  T  V   +    + E ++++  ++ +I+QL    NV E+ L+K  +L  +LE ++ EL PLE+++++++ KAA  T  +TW+GLG M +QFG+LARLTWWEYSWDIMEPVTYFV YGT +AMYAYY VT++EY    V +RE+    Y  + + +FD++ YNEL+   AE++
Sbjct:   76 VEYVNGMPHMTVRLPSRNELCQFALKPISHNVGDLLAMLRAEDRGIDRAAVINKHGVRIASSCTIESLLDDSFSIQINNRTLDVNPPKRDKVTLESMDKVGDVRKVIAQLYEAFNVGEYQLEKSNQLAKELETLRYELEPLEEKKLELSKKAARRTNFMTWMGLGLMSVQFGILARLTWWEYSWDIMEPVTYFVTYGTTMAMYAYYCVTKREYMMEDVKNREFSLSLYRNAKKVQFDVEHYNELKRKSAELE 327          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Zebrafish
Match: mcu (mitochondrial calcium uniporter [Source:NCBI gene;Acc:768182])

HSP 1 Score: 234.958 bits (598), Expect = 1.366e-73
Identity = 122/263 (46.39%), Postives = 175/263 (66.54%), Query Frame = 1
Query:  106 FCTNHKENVLTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
             C+   E+V ++ Y  GLP   V LPSR+E C F LKP++  VG  +  ++ ED GIDR+ IY+ DG RI+ S  I  LL  +F LVIN+ +Y V   +  +   E  E+LN +K ++ QL  T+ ++E  L KE+EL  +LE + ++L PLEK + +++ KA   T  + W G+  M  QFG+LARLTWWEYSWDIMEPVTYF+ YGTA+AMYAY+V+TRQEY +P   DR+YL  F+  + + +FDI++YN+L++  AE +
Sbjct:   91 LCSPAAEDV-SVVYHNGLPVISVRLPSRRERCQFTLKPLSDTVGVFLQQLQAEDRGIDRVTIYSADGARIASSTGIDILLMDNFKLVINDTSYLVQPPRRDLLPHEDGERLNDVKILVQQLYTTLRIEEHQLNKERELIGRLEDLNSQLKPLEKVKEELSKKAERRTTWVLWGGMAYMATQFGILARLTWWEYSWDIMEPVTYFITYGTAMAMYAYFVLTRQEYLYPDARDRQYLLFFHRGAKRTRFDIEKYNKLKDAIAEAE 352          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Xenopus
Match: tpsab1 (tryptase alpha/beta 1 [Source:Xenbase;Acc:XB-GENE-5892149])

HSP 1 Score: 234.187 bits (596), Expect = 9.482e-74
Identity = 125/265 (47.17%), Postives = 170/265 (64.15%), Query Frame = 1
Query:  106 FC-TNHKENVLTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRE--NQAEV 891
            FC T    + +T+ Y  GLP   V LPSR E C F LKPI+ +VG  +  +++ED GIDR+AIY+ DG R++ S  I  LL  DF L IN+ TY V   +  + S E    +N +K ++  L  T+ ++E  L KE+EL  +LE ++ +L PLEK R +I  +A   T  + W GL  M  QFG+LARLTWWEYSWDIMEPVTYF+ YG+A+AMYAY+V+TRQEY +P   DR+YL  F+  + +  FD++ YN L+    QAEV
Sbjct:   34 FCSTVSPSDDVTVVYQNGLPVISVSLPSRHERCRFTLKPISDSVGVFLQQLQQEDRGIDRVAIYSTDGTRVASSTGIEILLLDDFKLSINDKTYYVQPPKRELLSHEDATTMNDLKTLVQHLYSTLRIEEHQLNKERELNGRLEDLRGQLEPLEKLRQEIGRRAEKRTTWVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVLTRQEYIYPDARDRQYLHFFHKGAKKTSFDLEEYNRLKNAITQAEV 298          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Xenopus
Match: lsg1 (large 60S subunit nuclear export GTPase 1 [Source:Xenbase;Acc:XB-GENE-990730])

HSP 1 Score: 199.134 bits (505), Expect = 3.190e-60
Identity = 110/263 (41.83%), Postives = 159/263 (60.46%), Query Frame = 1
Query:  106 FCTNHKENVLTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            + T    + +T+ YS GLP   + LPSR E C F +KP+   +G  +  IK+ED GID IA  + D  + S S  +  LL +DF LVIN  TY V          +   +++ IK ++ +L   ++ +E+ L KEQEL  +L+ ++ +L PLE+ +  I  K+   T RL W+GL  M  Q G LA LTWW YSWDIMEPVTYF+ YG+AIA YAY+V+T+Q+Y +P + +R+ L  FY  +   +FD++ YN LRE  AE +
Sbjct:   34 YSTQFPSSDVTVQYSHGLPVITLTLPSRNERCQFTIKPLTTTLGTFLTDIKKEDRGIDVIAATSTDDTKFSNSTLMDVLLMNDFKLVINNSTYHVQPPSRDKPCPQDSSEMDTIKTLVHRLYAALHQEEYQLNKEQELLKRLDSLKEQLQPLEQMKSMILSKSDAKTTRLMWIGLALMSTQGGALAWLTWWVYSWDIMEPVTYFITYGSAIAFYAYFVLTKQDYVYPAIRERQLLNYFYKRAKTQRFDVNEYNRLREEFAETE 296          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Xenopus
Match: ENSXETT00000023422.1 (uncharacterized loc100124842 [Source:Xenbase;Acc:XB-GENE-5957221])

HSP 1 Score: 146.747 bits (369), Expect = 1.173e-41
Identity = 78/159 (49.06%), Postives = 107/159 (67.30%), Query Frame = 1
Query:  421 EKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRE--NQAEV 891
            E    +N +K ++  L  T+ ++E  L KE+EL  +LE ++ +L PLEK R +I  +A   T  + W GL  M  QFG+LARLTWWEYSWDIMEPVTYF+ YG+A+AMYAY+V+TRQEY +P   DR+YL  F+  + +  FD++ YN L+    QAEV
Sbjct:   18 EDATTMNDLKTLVQHLYSTLRIEEHQLNKERELNGRLEDLRGQLEPLEKLRQEIGRRAEKRTTWVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVLTRQEYIYPDARDRQYLHFFHKGAKKTSFDLEEYNRLKNAITQAEV 176          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Xenopus
Match: ENSXETT00000005020.1 (calcium uniporter protein, mitochondrial-like [Source:NCBI gene;Acc:108648166])

HSP 1 Score: 90.8929 bits (224), Expect = 5.418e-21
Identity = 51/125 (40.80%), Postives = 71/125 (56.80%), Query Frame = 1
Query:  106 FC-TNHKENVLTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVT 477
            FC T    + +T+ Y  GLP   V LPSR E C F LKPI+ +VG  +  +++ED GIDR+AIY+ DG R++ +  I  LL  DF L IN+ TY V   +      +  + LN    +I +LC T
Sbjct:   53 FCSTVSPSDDVTVVYQNGLPVISVSLPSRHERCRFTLKPISDSVGVFLQQLQQEDRGIDRVAIYSTDGTRVASATGIEILLLDDFKLSINDKTYYVQPPKRGKCFLQLAKNLN--PGLIPKLCST 175          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Mouse
Match: Mcu (mitochondrial calcium uniporter [Source:MGI Symbol;Acc:MGI:3026965])

HSP 1 Score: 239.58 bits (610), Expect = 1.354e-75
Identity = 124/254 (48.82%), Postives = 176/254 (69.29%), Query Frame = 1
Query:  133 LTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            +T+ Y  GLP   V LPSR+E C F LKPI+ +VG  +  ++EED GIDR+AIY+ DG R++ S  I  LL  DF LVIN+ TY V   +  + S E    LN +K ++ QL  T+ +++  L KE+EL  +LE ++ +L PLEK RI+I+ KA   T  + W GL  M  QFG+LARLTWWEYSWDIMEPVTYF+ YG+A+AMYAY+V+TRQEY +P+  DR+YL  F+  + +++FD+++YN+L++  A+ +
Sbjct:   74 VTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHEDAATLNDVKTLVQQLYTTLCIEQHQLNKERELVERLEDLKQQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAE 327          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Mouse
Match: Mcub (mitochondrial calcium uniporter dominant negative beta subunit [Source:MGI Symbol;Acc:MGI:1914065])

HSP 1 Score: 172.555 bits (436), Expect = 6.236e-50
Identity = 93/262 (35.50%), Postives = 158/262 (60.31%), Query Frame = 1
Query:  106 FCTNHKENVLTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEV 891
            + T   ++ +T++Y  GLP   + LPSR+E C F++KP+   VG  +  ++ ED GI   AI   DG  I  S  + +LL  DF L+IN+  Y +   +    S E + +L   K+++ +L   ++++E   ++E+ L  K++ +Q +L PLE+ +  I  ++  +T  L W GL  + +Q G LA LTWW YSWDIMEPVT+F+ +  +I  +AY+++TRQ Y +  +  R++L+ F+  S +  FD+++YN+L+E+ AE 
Sbjct:   60 YGTVEPQDEITVTYKHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIITADGSEIPASTLMDTLLMTDFKLIINKLRYDIRCHKKEEPSGEHMTELENTKSLVHRLFTILHLEEIQKRRERHLMAKIDHLQEQLRPLEQVKAAIEARSEANTSGLLWAGLALLSVQGGALAWLTWWVYSWDIMEPVTFFLSFANSIVFFAYFIITRQNYTYSSLRSRQFLQFFHKKSQRRCFDVEQYNKLKEDLAEA 321          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Mouse
Match: Mcu (mitochondrial calcium uniporter [Source:MGI Symbol;Acc:MGI:3026965])

HSP 1 Score: 157.918 bits (398), Expect = 5.132e-46
Identity = 79/160 (49.38%), Postives = 116/160 (72.50%), Query Frame = 1
Query:  415 SEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            S E    LN +K ++ QL  T+ +++  L KE+EL  +LE ++ +L PLEK RI+I+ KA   T  + W GL  M  QFG+LARLTWWEYSWDIMEPVTYF+ YG+A+AMYAY+V+TRQEY +P+  DR+YL  F+  + +++FD+++YN+L++  A+ +
Sbjct:   19 SHEDAATLNDVKTLVQQLYTTLCIEQHQLNKERELVERLEDLKQQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAE 178          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Mouse
Match: Mcub (mitochondrial calcium uniporter dominant negative beta subunit [Source:MGI Symbol;Acc:MGI:1914065])

HSP 1 Score: 72.0182 bits (175), Expect = 7.314e-14
Identity = 35/95 (36.84%), Postives = 54/95 (56.84%), Query Frame = 1
Query:  106 FCTNHKENVLTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRV 390
            + T   ++ +T++Y  GLP   + LPSR+E C F++KP+   VG  +  ++ ED GI   AI   DG  I  S  + +LL  DF L+IN+  Y +
Sbjct:   60 YGTVEPQDEITVTYKHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIITADGSEIPASTLMDTLLMTDFKLIINKLRYDI 154          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Mouse
Match: Mcub (mitochondrial calcium uniporter dominant negative beta subunit [Source:MGI Symbol;Acc:MGI:1914065])

HSP 1 Score: 46.9802 bits (110), Expect = 5.756e-6
Identity = 32/110 (29.09%), Postives = 60/110 (54.55%), Query Frame = 1
Query:  301 DGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGL 630
            DG  I  S  + +LL  DF L+IN+  Y +   +    S E + +L   K+++ +L   ++++E   ++E+ L  K++ +Q +L PLE+ +  I  ++  +T  L W GL
Sbjct:   40 DGSEIPASTLMDTLLMTDFKLIINKLRYDIRCHKKEEPSGEHMTELENTKSLVHRLFTILHLEEIQKRRERHLMAKIDHLQEQLRPLEQVKAAIEARSEANTSGLLWAGL 149          
BLAST of Mitochondrial calcium uniporter vs. UniProt/SwissProt
Match: sp|Q8NE86|MCU_HUMAN (Calcium uniporter protein, mitochondrial OS=Homo sapiens OX=9606 GN=MCU PE=1 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 6.209e-75
Identity = 129/283 (45.58%), Postives = 185/283 (65.37%), Query Frame = 1
Query:   61 NYHTFIKQNIFLFQKFCTNHKENVL-----TISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
             +H  + Q I  +Q     +   V+     T+ Y  GLP   V LPSR+E C F LKPI+ +VG  +  ++EED GIDR+AIY+ DG R++ S  I  LL  DF LVIN+ TY V   +  + S E    LN +K ++ QL  T+ +++  L KE+EL  +LE ++ +L PLEK RI+I+ KA   T  + W GL  M  QFG+LARLTWWEYSWDIMEPVTYF+ YG+A+AMYAY+V+TRQEY +P+  DR+YL  F+  + +++FD+++YN+L++  A+ +
Sbjct:   46 QHHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAE 328          
BLAST of Mitochondrial calcium uniporter vs. UniProt/SwissProt
Match: sp|Q3UMR5|MCU_MOUSE (Calcium uniporter protein, mitochondrial OS=Mus musculus OX=10090 GN=Mcu PE=1 SV=2)

HSP 1 Score: 239.58 bits (610), Expect = 9.474e-75
Identity = 124/254 (48.82%), Postives = 176/254 (69.29%), Query Frame = 1
Query:  133 LTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            +T+ Y  GLP   V LPSR+E C F LKPI+ +VG  +  ++EED GIDR+AIY+ DG R++ S  I  LL  DF LVIN+ TY V   +  + S E    LN +K ++ QL  T+ +++  L KE+EL  +LE ++ +L PLEK RI+I+ KA   T  + W GL  M  QFG+LARLTWWEYSWDIMEPVTYF+ YG+A+AMYAY+V+TRQEY +P+  DR+YL  F+  + +++FD+++YN+L++  A+ +
Sbjct:   74 VTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHEDAATLNDVKTLVQQLYTTLCIEQHQLNKERELVERLEDLKQQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAE 327          
BLAST of Mitochondrial calcium uniporter vs. UniProt/SwissProt
Match: sp|Q8IQ70|MCU_DROME (Calcium uniporter protein, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MCU PE=1 SV=2)

HSP 1 Score: 235.728 bits (600), Expect = 3.687e-73
Identity = 118/252 (46.83%), Postives = 169/252 (67.06%), Query Frame = 1
Query:  139 ISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            + Y  G+PH  V LPSR E C F LKPI+ NVGDL+  ++ ED GIDR A+ N  G RI+ S +I SLL   F++ IN  T  V   +    + E ++++  ++ +I+QL    NV E+ L+K  +L  +LE ++ EL PLE+++++++ KAA  T  +TW+GLG M +QFG+LARLTWWEYSWDIMEPVTYFV YGT +AMYAYY VT++EY    V +RE+    Y  + + +FD++ YNEL+   AE++
Sbjct:   76 VEYVNGMPHMTVRLPSRNELCQFALKPISHNVGDLLAMLRAEDRGIDRAAVINKHGVRIASSCTIESLLDDSFSIQINNRTLDVNPPKRDKVTLESMDKVGDVRKVIAQLYEAFNVGEYQLEKSNQLAKELETLRYELEPLEEKKLELSKKAARRTNFMTWMGLGLMSVQFGILARLTWWEYSWDIMEPVTYFVTYGTTMAMYAYYCVTKREYMMEDVKNREFSLSLYRNAKKVQFDVEHYNELKRKSAELE 327          
BLAST of Mitochondrial calcium uniporter vs. UniProt/SwissProt
Match: sp|Q08BI9|MCU_DANRE (Calcium uniporter protein, mitochondrial OS=Danio rerio OX=7955 GN=mcu PE=1 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 9.562e-73
Identity = 122/263 (46.39%), Postives = 175/263 (66.54%), Query Frame = 1
Query:  106 FCTNHKENVLTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
             C+   E+V ++ Y  GLP   V LPSR+E C F LKP++  VG  +  ++ ED GIDR+ IY+ DG RI+ S  I  LL  +F LVIN+ +Y V   +  +   E  E+LN +K ++ QL  T+ ++E  L KE+EL  +LE + ++L PLEK + +++ KA   T  + W G+  M  QFG+LARLTWWEYSWDIMEPVTYF+ YGTA+AMYAY+V+TRQEY +P   DR+YL  F+  + + +FDI++YN+L++  AE +
Sbjct:   91 LCSPAAEDV-SVVYQNGLPVISVRLPSRRERCQFTLKPLSDTVGVFLQQLQAEDRGIDRVTIYSADGARIASSTGIDILLMDNFKLVINDTSYLVQPPRRDLLPHEDGERLNDVKILVQQLYTTLRIEEHQLNKERELIGRLEDLNSQLQPLEKVKEELSKKAERRTTWVLWGGMAYMATQFGILARLTWWEYSWDIMEPVTYFITYGTAMAMYAYFVLTRQEYLYPDARDRQYLLFFHRGAKRTRFDIEKYNKLKDAIAEAE 352          
BLAST of Mitochondrial calcium uniporter vs. UniProt/SwissProt
Match: sp|Q21121|MCU_CAEEL (Calcium uniporter protein, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mcu-1 PE=1 SV=2)

HSP 1 Score: 193.356 bits (490), Expect = 3.304e-57
Identity = 100/249 (40.16%), Postives = 150/249 (60.24%), Query Frame = 1
Query:  133 LTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSH-DFNLVINEHTYRVTASQPTIS--SEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNEL 870
            L+I +  GLP   VPLPSR E C F ++P++  +G L   +++ED GID +A+Y  +G +++   SI  LL    F L +N+  + VT  +        +K+ QL+ ++  ++ L   + VDE+ L +E++L ++LE  +T L PL   +  I  +   HT R+ W G  AMG+Q GL ARLTWWEYSWDIMEPVTYF  Y T  A + YY+ T+Q + +P   +R Y K+FY  + +  FDI++YN L
Sbjct:   51 LSIRFEYGLPLLDVPLPSRNEPCQFTMRPLSDTIGSLCEFLRQEDRGIDYVAVYGTNGVKLATCTSIEHLLQFGSFRLRLNDKFFDVTVPKTGTMPYDSDKLRQLDDLRATVASLHAALCVDEYKLSREKKLLLQLENAETLLAPLHDAKRKIEQECEAHTDRVMWAGFAAMGVQTGLFARLTWWEYSWDIMEPVTYFATYSTVCATFGYYLYTQQSFEYPSARERVYTKQFYRRAQKQNFDIEKYNRL 299          
BLAST of Mitochondrial calcium uniporter vs. TrEMBL
Match: G4VQB8 (MCU domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_067580 PE=4 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 1.180e-91
Identity = 144/270 (53.33%), Postives = 195/270 (72.22%), Query Frame = 1
Query:   91 FLFQKFCTNHKENVLTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKI--EQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            FLF         + +++    GLP  ++PLPSR+E C F+LKP+   VGDL N IK ED G+DRI  ++ DG RI+KSNSI  LL+ DF+++IN+  Y V  S  +ISS+  +  + L  ++ ++S+L   ++VDEF  QK+Q+L+  +E +  +L P EK++  IA++AA  TR LTWLGLGAMG+QFGLLARLTWWEYSWDIMEPVTYFVGYGT++AMYAYYV+TRQ+Y  PQVFDREYLK FY  + ++ FD+ RYNELR+  A ++
Sbjct:   25 FLFYSTSITTSLDTVSVYSENGLPKIIIPLPSRREACSFVLKPLQHTVGDLSNFIKCEDSGVDRITFFSKDGTRIAKSNSISDLLTSDFHILINDQQYHVDTS--SISSQFSVLPKDLANVRELVSKLANAIHVDEFYAQKQQQLEKCIEDVNLQLEPFEKKKSVIAVQAAQRTRWLTWLGLGAMGIQFGLLARLTWWEYSWDIMEPVTYFVGYGTSMAMYAYYVITRQDYTLPQVFDREYLKSFYKSADKSSFDVQRYNELRDELAHLK 292          
BLAST of Mitochondrial calcium uniporter vs. TrEMBL
Match: A0A3Q0KH70 (MCU domain-containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 1.861e-91
Identity = 144/270 (53.33%), Postives = 195/270 (72.22%), Query Frame = 1
Query:   91 FLFQKFCTNHKENVLTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKI--EQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            FLF         + +++    GLP  ++PLPSR+E C F+LKP+   VGDL N IK ED G+DRI  ++ DG RI+KSNSI  LL+ DF+++IN+  Y V  S  +ISS+  +  + L  ++ ++S+L   ++VDEF  QK+Q+L+  +E +  +L P EK++  IA++AA  TR LTWLGLGAMG+QFGLLARLTWWEYSWDIMEPVTYFVGYGT++AMYAYYV+TRQ+Y  PQVFDREYLK FY  + ++ FD+ RYNELR+  A ++
Sbjct:   24 FLFYSTSITTSLDTVSVYSENGLPKIIIPLPSRREACSFVLKPLQHTVGDLSNFIKCEDSGVDRITFFSKDGTRIAKSNSISDLLTSDFHILINDQQYHVDTS--SISSQFSVLPKDLANVRELVSKLANAIHVDEFYAQKQQQLEKCIEDVNLQLEPFEKKKSVIAVQAAQRTRWLTWLGLGAMGIQFGLLARLTWWEYSWDIMEPVTYFVGYGTSMAMYAYYVITRQDYTLPQVFDREYLKSFYKSADKSSFDVQRYNELRDELAHLK 291          
BLAST of Mitochondrial calcium uniporter vs. TrEMBL
Match: A0A0V0J8I7 (Calcium uniporter protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=MCU PE=4 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 8.921e-91
Identity = 139/249 (55.82%), Postives = 185/249 (74.30%), Query Frame = 1
Query:  148 SGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            + GLP F +PLPSR+E C+F ++P++  VGDLI +I++ED GIDRIA+ + DG RI+K+NSI  LLS +F + IN+  Y V  S   +  +    +LN I+ +I QL   +N D+   ++E+EL+ ++E I  +L P E++R  +A  AA  TRRLTW+GLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGT +AMYAYYVVTRQ+Y FPQVFDREYLK FY  +S+  FD++RYN+L +  A ++
Sbjct:    3 TNGLPRFYIPLPSRKETCIFTMRPLSNTVGDLIEAIQKEDKGIDRIALLSSDGLRIAKANSIELLLSSNFTIEINDQKYSVDISSLDLPKDVSSSELNHIRTLIGQLNCALNADDVYAERERELRRRIEDITAKLEPFEQKRSQLAAIAAERTRRLTWIGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTTMAMYAYYVVTRQDYSFPQVFDREYLKIFYKKASEKGFDVERYNQLSDKLAALR 251          
BLAST of Mitochondrial calcium uniporter vs. TrEMBL
Match: A0A158QU23 (Uncharacterized protein (Fragment) OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5664 PE=4 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 3.243e-90
Identity = 132/248 (53.23%), Postives = 186/248 (75.00%), Query Frame = 1
Query:  151 GGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            GGLP F VPLPSR E C+F L+P++  +GDL+ +I+EED G+DR+   + DG R +K+N+I  LL++DF + IN+  + V+ +   +  +   ++L  ++ ++++L   +  D+ N + E+E+K ++  +Q +L P E++R+ +A KA+  TRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGT +AMYAYYVVTRQ+Y FPQVFDREYLK FY  +++  FD++RYN LR+  AE+Q
Sbjct:   32 GGLPRFHVPLPSRSETCIFALRPLSNTIGDLVKAIQEEDKGVDRVVFLSTDGLRFAKANNIEILLANDFVVEINDKKFPVSVANLGLPEDVTPQELGTVRVLVNRLNTVLTADDINAENEREIKRRIADVQHQLEPFEEKRLQLAEKASVRTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTTMAMYAYYVVTRQDYSFPQVFDREYLKTFYKSATEQGFDVERYNNLRDMLAELQ 279          
BLAST of Mitochondrial calcium uniporter vs. TrEMBL
Match: H2KP42 (Calcium uniporter protein OS=Clonorchis sinensis OX=79923 GN=mcu PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 3.798e-90
Identity = 139/256 (54.30%), Postives = 187/256 (73.05%), Query Frame = 1
Query:  127 NVLTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            N + ++   GLP F +PLPSR++ C+FI+KP+   VGDL N I  ED G+D +A  N +G RI+KSN+I  LL+ +F LVIN+  + V  +     S      L+  + M+S+L   ++ DEF+ Q+E EL+ ++E +  +L P E+ +  I+ +AA  TRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGT++AMYAYYV+TRQ+Y FPQVFDREYLKRFY  + ++ FD++RYNELRE  A+++
Sbjct:   37 NPVRVTVENGLPQFCIPLPSRRDTCMFIVKPLQHTVGDLTNFIMSEDRGVDYVAFINKNGTRIAKSNTIADLLTSNFQLVINKDVFHVDTTPLGTESGASSCDLSNTRLMVSRLANALHSDEFHKQQELELERRIEDVSYQLQPFEELKTMISKEAAKRTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTSMAMYAYYVLTRQDYSFPQVFDREYLKRFYKCADKHAFDVNRYNELREQLADLK 292          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Cavefish
Match: ENSAMXT00000031018.1 (calcium uniporter protein, mitochondrial [Source:NCBI gene;Acc:103042391])

HSP 1 Score: 212.231 bits (539), Expect = 9.890e-66
Identity = 103/260 (39.62%), Postives = 165/260 (63.46%), Query Frame = 1
Query:  112 TNHKENVLTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEV 891
            T    N + + Y  G P   +PLPSRQE CLF ++P+   V DLI  I++ED G+   +++  DG RI+    + +LL+ DF L INE  Y V ++Q    S EK+  L+ +K+ +  L   + + E +L +E++L  KL+ ++ EL P+E+ +  + L+A   + R+ W+GL  + +Q G LA LTWW YSWD+MEPVTYF+ Y T+I +YAYYV+T+Q+Y +P   DR++L+ FY  + +++F++ +YN+L+   A V
Sbjct:   46 TAASRNEIPVQYRHGRPVLALPLPSRQEKCLFFMRPMLTTVSDLIQDIQKEDSGVSSASVFTTDGVRIASGTPMDTLLNKDFQLHINEVIYNVLSTQKEPLSSEKLTNLSDVKDTVHMLHTALGLPEHHLVQERDLLQKLDILKQELTPMEQLKAQLDLRAERSSSRVLWMGLALLSVQGGALAWLTWWVYSWDVMEPVTYFITYSTSIGVYAYYVLTKQDYVYPDAKDRQFLRYFYRGARRHQFNVPKYNQLKNELASV 305          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Cavefish
Match: ENSAMXT00000010538.2 (calcium uniporter protein, mitochondrial [Source:NCBI gene;Acc:103042391])

HSP 1 Score: 213.001 bits (541), Expect = 1.076e-65
Identity = 103/261 (39.46%), Postives = 166/261 (63.60%), Query Frame = 1
Query:  112 TNHKENVLTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            T    N + + Y  G P   +PLPSRQE CLF ++P+   V DLI  I++ED G+   +++  DG RI+    + +LL+ DF L INE  Y V ++Q    S EK+  L+ +K+ +  L   + + E +L +E++L  KL+ ++ EL P+E+ +  + L+A   + R+ W+GL  + +Q G LA LTWW YSWD+MEPVTYF+ Y T+I +YAYYV+T+Q+Y +P   DR++L+ FY  + +++F++ +YN+L+   A V+
Sbjct:   46 TAASRNEIPVQYRHGRPVLALPLPSRQEKCLFFMRPMLTTVSDLIQDIQKEDSGVSSASVFTTDGVRIASGTPMDTLLNKDFQLHINEVIYNVLSTQKEPLSSEKLTNLSDVKDTVHMLHTALGLPEHHLVQERDLLQKLDILKQELTPMEQLKAQLDLRAERSSSRVLWMGLALLSVQGGALAWLTWWVYSWDVMEPVTYFITYSTSIGVYAYYVLTKQDYVYPDAKDRQFLRYFYRGARRHQFNVPKYNQLKNELASVE 306          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Cavefish
Match: mcu (mitochondrial calcium uniporter [Source:NCBI gene;Acc:768182])

HSP 1 Score: 181.8 bits (460), Expect = 2.731e-54
Identity = 95/198 (47.98%), Postives = 136/198 (68.69%), Query Frame = 1
Query:  301 DGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            DG RI+ S  I  LL  DF LVIN+ T+ V   +  + + E+ E+LN +K ++ QL  T+ ++E  L KE+EL  +LE + ++L PLEK + +++ KA   T  + W G+  M  QFG+LARLTWWEYSWDIMEPVTYF+ YGTA+AMYAY+V+TRQEY +P   DR+YL  F+    + +FDI++YN+L++  AE +
Sbjct:   56 DGARIASSTGIDILLLDDFKLVINDTTHLVRPPRRELMAHEEAERLNDVKFLVQQLYTTLRIEEHQLSKERELIGRLEDLNSQLRPLEKVKEELSKKAERRTTWVLWGGMAYMATQFGILARLTWWEYSWDIMEPVTYFITYGTAMAMYAYFVLTRQEYIYPDARDRQYLLFFHKGVKRTRFDIEKYNQLKDAIAEAE 253          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Sea Lamprey
Match: MCU (mitochondrial calcium uniporter [Source:HGNC Symbol;Acc:HGNC:23526])

HSP 1 Score: 233.802 bits (595), Expect = 3.337e-74
Identity = 118/250 (47.20%), Postives = 167/250 (66.80%), Query Frame = 1
Query:  145 YSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            Y+ GLP   + LPSR+E C F L+P+ +NVGD + S++ ED GIDR AIY +DG R++ S  +  LL  DF LVINE +Y V   +    S +    L  +K ++ Q+  T+ ++E  LQ+E+EL  KL+ ++ ++ PLEK + D+ LKA   TR + W GL  M  QFG LARLTWWEYSWDIMEPVTYFV YG+AIAMYAY+++TRQEY +    DR+YL  F+  + + +FD   YN+L+++ A+ +
Sbjct:   72 YANGLPVVSITLPSRKERCQFTLRPVLENVGDFLRSLQAEDRGIDRAAIYTLDGTRVAASTGVDILLLDDFKLVINEESYLVQPPKRGSLSADDATALGEVKVLVQQMYTTLRIEEHQLQRERELLTKLDNLRVQIEPLEKVKRDLKLKAEKRTRLVLWGGLAYMATQFGFLARLTWWEYSWDIMEPVTYFVTYGSAIAMYAYFILTRQEYIYQDARDRQYLHFFHRHAEKTRFDFAAYNKLKDDIAQAE 321          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Nematostella
Match: EDO31988 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWC7])

HSP 1 Score: 240.736 bits (613), Expect = 6.644e-77
Identity = 120/254 (47.24%), Postives = 174/254 (68.50%), Query Frame = 1
Query:  133 LTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            + + +  G P   VPLPSR+E C F L+P++++V D I ++KEED GI+R+A+Y+  G RIS S  +  L+  +F LVIN+  Y V        +E+    L  +K +I QL  ++N++E  LQKE++L  KLE+I+ +L P+EK + ++  KAA     L W GLG M +QFGLLARLTWWEYSWDIMEPVTYFVGYGTA+A YAY+V+TRQEY +P   DR++L  F+ +S +  FD+++YN L++  A+++
Sbjct:   49 IQVHFKSGFPVVTVPLPSRRELCQFTLRPLSESVKDFIENVKEEDGGIERVAVYDPSGSRISGSTKVDVLMKSNFKLVINDVEYDVKVPDTVAIAEDDQRSLAHVKTLIHQLYSSMNIEEHQLQKEEKLLSKLEEIKADLQPMEKLKSELNDKAAKRANFLVWGGLGFMAVQFGLLARLTWWEYSWDIMEPVTYFVGYGTAMACYAYFVITRQEYLYPDARDRQHLLAFHKLSKKKSFDVEKYNHLKDCMAKIE 302          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Medaka
Match: mcu (mitochondrial calcium uniporter [Source:NCBI gene;Acc:768182])

HSP 1 Score: 241.506 bits (615), Expect = 1.116e-76
Identity = 123/254 (48.43%), Postives = 176/254 (69.29%), Query Frame = 1
Query:  133 LTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            +T+ Y  GLP   V LPSR+E C F LKP++  VG  +  ++ ED GIDR+AIY++DG R++ S  I  LL  DF LVIN+ T+ V   +  +   E+ E+LN +K ++ QL  T+ ++E  L KE+EL ++LE + ++L PLEK R +++ KA   T  + W G+  M  QFG+LARLTWWEYSWDIMEPVTYF+ YGTA+AMYAY+V+TRQEY +P   DR+YL  F+    + +FDI++YN+L+++ AEV+
Sbjct:   54 VTVVYQNGLPVISVSLPSRRERCQFTLKPLSDCVGVFLQQLQAEDRGIDRVAIYSMDGARVASSTGIDILLLDDFKLVINDTTHLVRPPRREVLPNEEAERLNDVKFLVQQLYTTLRIEEHQLGKERELILRLEDLNSQLRPLEKVREELSKKAERRTTWVLWGGMAYMATQFGILARLTWWEYSWDIMEPVTYFITYGTAMAMYAYFVLTRQEYVYPDARDRQYLLFFHKGVKRTRFDIEKYNKLKDDIAEVE 307          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Medaka
Match: ENSORLT00000024381.2 (mitochondrial calcium uniporter dominant negative beta subunit [Source:NCBI gene;Acc:101157186])

HSP 1 Score: 212.616 bits (540), Expect = 1.636e-65
Identity = 107/254 (42.13%), Postives = 164/254 (64.57%), Query Frame = 1
Query:  133 LTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            L++ Y  G     VPLPSR E CLF L+P+  NVGDLI  ++ ED G+   A+ + DG+R++ S  I +LL  DF LVIN+  Y V   +   ++ E    +  +K+++  L   +++ E +L +E++L  KL+ ++ EL PLEK +  ++  A  H+ R+ W G+  + +Q G LA LTWW YSWD+MEPVTYF+ YGT+I ++AYYV+T+Q+Y +P   DR++L  FY  + + +FD+ RYNEL+E  AEV+
Sbjct:   62 LSLEYKHGRLVLEVPLPSRHEKCLFFLRPMLMNVGDLITDLQREDSGLT-AAVLSKDGERVANSTLIEALLGKDFLLVINDVCYNVCPPEKVFATSEHATDIEDMKHVVHLLHTALHLPEHHLLRERQLLEKLDNLKQELTPLEKMKAQLSQTAEFHSSRVLWTGMALLSVQGGALAWLTWWVYSWDVMEPVTYFITYGTSIGIFAYYVLTKQDYVYPDAKDRQFLHYFYKGARKRRFDVKRYNELKEELAEVE 314          
BLAST of Mitochondrial calcium uniporter vs. Ensembl Medaka
Match: ENSORLT00000002869.2 (calcium uniporter protein, mitochondrial-like [Source:NCBI gene;Acc:101160267])

HSP 1 Score: 157.532 bits (397), Expect = 1.419e-44
Identity = 88/252 (34.92%), Postives = 149/252 (59.13%), Query Frame = 1
Query:  139 ISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            + +S G P   + LP+  E   F L P+   V DL+  I+ +D GI   A+ + DG+RIS   S+ ++L+ DF LV+N+  Y + +    +S E  I  L+ +K ++  L   + + +    +  +L +K E+++ +L PLEK R+ IA KA      L W+GL  + LQ G L  LTW+ ++WD+MEPVT+F+   T++  +AYY++T+Q+  FP + DR +L  F+  ++  KFD+ +YN L++  A+V+
Sbjct:   44 VRHSFGRPVLSLRLPAGHEG-RFTLTPMLTTVDDLLKDIRAKDPGIHTAALLSDDGQRISLCTSMETVLNKDFQLVLNDTIYNIRSLGRGMSREH-ILGLDDMKYLVHLLHTALTLPQQLHIQHSQLLVKQEQLRQQLEPLEKVRVQIAEKAEVRASMLGWMGLAYLSLQGGFLGYLTWYVFAWDVMEPVTFFISCTTSMIFFAYYILTKQDIIFPDIRDRHFLFYFHKKAALQKFDVLKYNMLKDELAKVE 293          
BLAST of Mitochondrial calcium uniporter vs. Planmine SMEST
Match: SMESG000000983.1 (SMESG000000983.1)

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 283/285 (99.30%), Postives = 284/285 (99.65%), Query Frame = 1
Query:   40 MKTIKFLNYHTFIKQNIFLFQKFCTNHKENVLTISYSGGLPHFLVPLPSRQEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNXXXXXXXXXXXXXXXTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 894
            MKTIKFLNYHTFIKQNIFLFQKFCTNHKENVLTISYSGGLPHFLVPLPSRQE+CLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRV ASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNLQKEQELKMKLEKIQTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ
Sbjct:    1 MKTIKFLNYHTFIKQNIFLFQKFCTNHKENVLTISYSGGLPHFLVPLPSRQEECLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFSLLSHDFNLVINEHTYRVPASQPTISSEEKIEQLNGIKNMISQLCVTVNVDEFNLQKEQELKMKLEKIQTELNPLEKQRIDIALKAATHTRRLTWLGLGAMGLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQVFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQ 285          
The following BLAST results are available for this feature:
BLAST of Mitochondrial calcium uniporter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MCU6.379e-7648.82mitochondrial calcium uniporter [Source:HGNC Symbo... [more]
MCU1.293e-7545.58mitochondrial calcium uniporter [Source:HGNC Symbo... [more]
MCU1.068e-6139.93mitochondrial calcium uniporter [Source:HGNC Symbo... [more]
MCUB4.989e-5137.40mitochondrial calcium uniporter dominant negative ... [more]
MCU9.515e-2544.17mitochondrial calcium uniporter [Source:HGNC Symbo... [more]
back to top
BLAST of Mitochondrial calcium uniporter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mcu-12.598e-5840.16Calcium uniporter protein, mitochondrial [Source:... [more]
back to top
BLAST of Mitochondrial calcium uniporter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MCU3.652e-7446.83gene:FBgn0042185 transcript:FBtr0344294[more]
MCU3.679e-7446.83gene:FBgn0042185 transcript:FBtr0076972[more]
MCU3.679e-7446.83gene:FBgn0042185 transcript:FBtr0076971[more]
MCU3.679e-7446.83gene:FBgn0042185 transcript:FBtr0076970[more]
MCU3.679e-7446.83gene:FBgn0042185 transcript:FBtr0076973[more]
back to top
BLAST of Mitochondrial calcium uniporter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mcu1.366e-7346.39mitochondrial calcium uniporter [Source:NCBI gene;... [more]
back to top
BLAST of Mitochondrial calcium uniporter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tpsab19.482e-7447.17tryptase alpha/beta 1 [Source:Xenbase;Acc:XB-GENE-... [more]
lsg13.190e-6041.83large 60S subunit nuclear export GTPase 1 [Source:... [more]
ENSXETT00000023422.11.173e-4149.06uncharacterized loc100124842 [Source:Xenbase;Acc:X... [more]
ENSXETT00000005020.15.418e-2140.80calcium uniporter protein, mitochondrial-like [Sou... [more]
back to top
BLAST of Mitochondrial calcium uniporter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcu1.354e-7548.82mitochondrial calcium uniporter [Source:MGI Symbol... [more]
Mcub6.236e-5035.50mitochondrial calcium uniporter dominant negative ... [more]
Mcu5.132e-4649.38mitochondrial calcium uniporter [Source:MGI Symbol... [more]
Mcub7.314e-1436.84mitochondrial calcium uniporter dominant negative ... [more]
Mcub5.756e-629.09mitochondrial calcium uniporter dominant negative ... [more]
back to top
BLAST of Mitochondrial calcium uniporter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NE86|MCU_HUMAN6.209e-7545.58Calcium uniporter protein, mitochondrial OS=Homo s... [more]
sp|Q3UMR5|MCU_MOUSE9.474e-7548.82Calcium uniporter protein, mitochondrial OS=Mus mu... [more]
sp|Q8IQ70|MCU_DROME3.687e-7346.83Calcium uniporter protein, mitochondrial OS=Drosop... [more]
sp|Q08BI9|MCU_DANRE9.562e-7346.39Calcium uniporter protein, mitochondrial OS=Danio ... [more]
sp|Q21121|MCU_CAEEL3.304e-5740.16Calcium uniporter protein, mitochondrial OS=Caenor... [more]
back to top
BLAST of Mitochondrial calcium uniporter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VQB81.180e-9153.33MCU domain-containing protein OS=Schistosoma manso... [more]
A0A3Q0KH701.861e-9153.33MCU domain-containing protein OS=Schistosoma manso... [more]
A0A0V0J8I78.921e-9155.82Calcium uniporter protein (Fragment) OS=Schistocep... [more]
A0A158QU233.243e-9053.23Uncharacterized protein (Fragment) OS=Mesocestoide... [more]
H2KP423.798e-9054.30Calcium uniporter protein OS=Clonorchis sinensis O... [more]
back to top
BLAST of Mitochondrial calcium uniporter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000031018.19.890e-6639.62calcium uniporter protein, mitochondrial [Source:N... [more]
ENSAMXT00000010538.21.076e-6539.46calcium uniporter protein, mitochondrial [Source:N... [more]
mcu2.731e-5447.98mitochondrial calcium uniporter [Source:NCBI gene;... [more]
back to top
BLAST of Mitochondrial calcium uniporter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MCU3.337e-7447.20mitochondrial calcium uniporter [Source:HGNC Symbo... [more]
back to top
BLAST of Mitochondrial calcium uniporter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitochondrial calcium uniporter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO319886.644e-7747.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitochondrial calcium uniporter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mcu1.116e-7648.43mitochondrial calcium uniporter [Source:NCBI gene;... [more]
ENSORLT00000024381.21.636e-6542.13mitochondrial calcium uniporter dominant negative ... [more]
ENSORLT00000002869.21.419e-4434.92calcium uniporter protein, mitochondrial-like [Sou... [more]
back to top
BLAST of Mitochondrial calcium uniporter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000000983.10.000e+099.30SMESG000000983.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026619 ID=SMED30026619|Name=Mitochondrial calcium uniporter|organism=Schmidtea mediterranea sexual|type=transcript|length=1190bp
ATTAGCAATTTTTATTATTTGAAATGTTTTTAATTAATCATGAAAACTAT
TAAGTTTTTGAATTATCATACTTTCATAAAACAAAATATTTTTCTTTTTC
AAAAATTTTGTACTAATCACAAGGAAAATGTTCTAACGATTAGTTATAGT
GGTGGGCTTCCACATTTTTTAGTTCCATTACCATCTCGACAGGAGGATTG
CTTATTCATATTGAAACCAATTGCACAAAATGTTGGAGATTTAATTAACT
CAATTAAGGAAGAAGATCTTGGAATTGATAGAATAGCTATATATAATATA
GATGGTAAGCGAATATCCAAATCAAACTCTATTTTCTCACTCTTATCACA
CGATTTTAATTTGGTGATTAATGAACATACCTACCGCGTTACAGCCTCAC
AGCCAACAATATCCTCAGAAGAAAAAATAGAACAACTCAATGGAATCAAA
AACATGATTTCTCAATTGTGCGTCACTGTGAATGTTGATGAGTTTAATTT
GCAGAAAGAACAAGAGTTGAAAATGAAGTTAGAAAAAATTCAGACGGAAT
TAAATCCATTGGAGAAGCAAAGAATAGACATTGCATTGAAGGCAGCAACA
CATACACGTCGATTGACATGGTTAGGCTTGGGAGCGATGGGTTTACAATT
TGGATTACTAGCACGACTTACTTGGTGGGAGTATTCCTGGGATATCATGG
AACCAGTTACATATTTCGTTGGCTACGGAACTGCAATAGCAATGTATGCA
TATTACGTGGTCACCAGGCAGGAATATTGTTTTCCTCAAGTCTTCGATAG
AGAATATTTGAAAAGGTTTTATTTAATTTCCAGCCAAAATAAATTTGATA
TTGATCGGTACAATGAACTGAGAGAAAATCAGGCAGAAGTACAAAATGAT
CTGAAGCGGCTCCGTGATCCATTATTGTTGAATTTACCTTTGCAGCAAAA
ATCTTTAAACTGAATCTTTACTTTTTAGAGCTCTGAAATTGATTTAAGTT
TTTTTCAAATTGGTTTTTATTTTATCAACTGTTTCTTATAGAGAATTTTT
CCAATTTGAAGATTTTTTCTATTTATAATTAATTTTTATTCCTCTTAGAA
ACGTTTGCTTTATAAGTAAGTAAAAGTTATATTTTATTTTGTTTATTTTA
TTCATATCTTTGTACGCGTAATTTGAATGTTAAAGCTTGG
back to top

protein sequence of SMED30026619-orf-1

>SMED30026619-orf-1 ID=SMED30026619-orf-1|Name=SMED30026619-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=308bp
MKTIKFLNYHTFIKQNIFLFQKFCTNHKENVLTISYSGGLPHFLVPLPSR
QEDCLFILKPIAQNVGDLINSIKEEDLGIDRIAIYNIDGKRISKSNSIFS
LLSHDFNLVINEHTYRVTASQPTISSEEKIEQLNGIKNMISQLCVTVNVD
EFNLQKEQELKMKLEKIQTELNPLEKQRIDIALKAATHTRRLTWLGLGAM
GLQFGLLARLTWWEYSWDIMEPVTYFVGYGTAIAMYAYYVVTRQEYCFPQ
VFDREYLKRFYLISSQNKFDIDRYNELRENQAEVQNDLKRLRDPLLLNLP
LQQKSLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039055MCU_fam
IPR006769MCU_C
Vocabulary: molecular function
TermDefinition
GO:0005262calcium channel activity
GO:0005515protein binding
GO:0015292uniporter activity
GO:0042802identical protein binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031305integral component of mitochondrial inner membrane
GO:0034704calcium channel complex
GO:1990246uniplex complex
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0006851mitochondrial calcium ion transmembrane transport
GO:0019722calcium-mediated signaling
GO:0032024positive regulation of insulin secretion
GO:0035786protein complex oligomerization
GO:0036444mitochondrial calcium uptake
GO:0042593glucose homeostasis
GO:0051560mitochondrial calcium ion homeostasis
GO:0051561positive regulation of mitochondrial calcium ion concentration
GO:0070588calcium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 157..177
NoneNo IPR availablePANTHERPTHR13462:SF16CALCIUM UNIPORTER PROTEIN, MITOCHONDRIALcoord: 26..303
NoneNo IPR availableTMHMMTMhelixcoord: 194..213
NoneNo IPR availableTMHMMTMhelixcoord: 223..242
IPR006769Calcium uniporter protein, C-terminalPFAMPF04678MCUcoord: 75..277
e-value: 8.5E-62
score: 208.4
IPR039055MCU familyPANTHERPTHR13462FAMILY NOT NAMEDcoord: 26..303