DDE_Tnp_IS1595 domain-containing protein
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30026614 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4
Homology
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Match: A0A146LFY4 (Putative transposase-like protein HI_1328.1 OS=Lygus hesperus OX=30085 GN=HI_1328.1_3 PE=4 SV=1) HSP 1 Score: 85.1149 bits (209), Expect = 5.505e-21 Identity = 39/67 (58.21%), Postives = 47/67 (70.15%), Query Frame = 3 Query: 669 ESVFTSRKNEIGRILLQQSVFGVNCCETDECFKFTIPDRTAATLMSIIAVKIHPVTAVMSDQWCAYN 869 ES+F+ RKN GR L QQ +FG C ET ECF +PDRT+ATLMS+I +I P T +MSDQW AY Sbjct: 139 ESLFSRRKNHTGRQLPQQRIFGGICRETKECFLVAVPDRTSATLMSVIKDRIMPGTTIMSDQWSAYG 205 HSP 2 Score: 33.113 bits (74), Expect = 5.505e-21 Identity = 17/37 (45.95%), Postives = 21/37 (56.76%), Query Frame = 1 Query: 886 DLTHQTVNHSVALVNQKT*TNTQ*IERSWKTVKERNK 996 + H TVNHS+ V+ T +TQ IE W K RNK Sbjct: 212 NFRHFTVNHSLNFVDPTTGAHTQSIESLWGKCKTRNK 248 HSP 3 Score: 32.7278 bits (73), Expect = 5.505e-21 Identity = 16/47 (34.04%), Postives = 26/47 (55.32%), Query Frame = 2 Query: 470 SCLTYTQIVRFICCWS*KLISISFCASELRIANGMVRYRNHYLRDAC 610 S L T IV FI W+ +++S+ FC EL + + V +Y+ + C Sbjct: 71 SKLPLTDIVLFIYAWADEMVSVKFCEKELSMNHNTVVGWCNYMHEVC 117
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Match: A0A0A9YMJ9 (Putative transposase-like protein HI_1328.1 OS=Lygus hesperus OX=30085 GN=CM83_19026 PE=4 SV=1) HSP 1 Score: 84.7297 bits (208), Expect = 9.771e-21 Identity = 39/67 (58.21%), Postives = 47/67 (70.15%), Query Frame = 3 Query: 669 ESVFTSRKNEIGRILLQQSVFGVNCCETDECFKFTIPDRTAATLMSIIAVKIHPVTAVMSDQWCAYN 869 ES+F+ RKN GR L QQ +FG C ET ECF +PDRT+ATLMS+I +I P T +MSDQW AY Sbjct: 139 ESLFSRRKNHTGRQLPQQRIFGGICRETKECFLVAVPDRTSATLMSVIKDRIMPGTTIMSDQWSAYG 205 HSP 2 Score: 32.7278 bits (73), Expect = 9.771e-21 Identity = 16/47 (34.04%), Postives = 26/47 (55.32%), Query Frame = 2 Query: 470 SCLTYTQIVRFICCWS*KLISISFCASELRIANGMVRYRNHYLRDAC 610 S L T IV FI W+ +++S+ FC EL + + V +Y+ + C Sbjct: 71 SKLPLTDIVLFIYAWANEMVSVKFCEKELSMNHNTVVDWCNYMHEVC 117 HSP 3 Score: 32.3426 bits (72), Expect = 9.771e-21 Identity = 17/37 (45.95%), Postives = 21/37 (56.76%), Query Frame = 1 Query: 886 DLTHQTVNHSVALVNQKT*TNTQ*IERSWKTVKERNK 996 + H TVNHS+ V+ T +TQ IE W K RNK Sbjct: 212 NFRHFTVNHSLNFVDLTTGAHTQSIESLWGKCKTRNK 248
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Match: A0A1B6H5F2 (DDE_Tnp_IS1595 domain-containing protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.11270 PE=4 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 5.696e-20 Identity = 33/67 (49.25%), Postives = 45/67 (67.16%), Query Frame = 3 Query: 669 ESVFTSRKNEIGRILLQQSVFGVNCCETDECFKFTIPDRTAATLMSIIAVKIHPVTAVMSDQWCAYN 869 ESVF RK +GR+ +Q +FG C ET +CF F + DR+AA+LM II I P T ++SD+W +YN Sbjct: 132 ESVFAKRKYNVGRVPKKQWIFGGICHETKDCFLFAVEDRSAASLMPIIVESIAPGTRIVSDKWRSYN 198 HSP 2 Score: 48.1358 bits (113), Expect = 5.696e-20 Identity = 33/98 (33.67%), Postives = 49/98 (50.00%), Query Frame = 2 Query: 341 FCNIVTLHNARLCANNHGMTLPLPDHWDR**--------E*ARPPSS*SHVSCLTYTQIVRFICCWS*KLISISFCASELRIANGMVRYRNHYLRDAC 610 F NI L +LC N H MTL + D +R + ++ S L + +++ FI CWS KL S+ FC EL+I + + N+YLR+ C Sbjct: 13 FQNIDILPREKLCENGHKMTLSVTDGRERWRCRKNTCRQDIQLRSNTWLENSRLGFDRVLLFIYCWSHKLTSVDFCERELKINHNTIVDWNNYLREVC 110 HSP 3 Score: 26.5646 bits (57), Expect = 5.696e-20 Identity = 14/44 (31.82%), Postives = 20/44 (45.45%), Query Frame = 1 Query: 853 NGARTIDDTIDDLTHQTVNHSVALVNQKT*TNTQ*IERSWKTVK 984 NG R + D H TVNHS ++ T + ++R W K Sbjct: 198 NGIRNANSNYD---HNTVNHSENFIDPGTGAHINTVKRMWGVAK 238
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Match: A0A146M1Q1 (Putative transposase-like protein HI_1328.1 (Fragment) OS=Lygus hesperus OX=30085 GN=HI_1328.1_0 PE=4 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.226e-19 Identity = 31/66 (46.97%), Postives = 42/66 (63.64%), Query Frame = 3 Query: 669 ESVFTSRKNEIGRILLQQSVFGVNCCETDECFKFTIPDRTAATLMSIIAVKIHPVTAVMSDQWCAY 866 ES+F+ RK+ +GR+L QQ VFG C ET + F +P+R A TL+S I I P + +MSD W Y Sbjct: 127 ESLFSKRKSNVGRVLPQQWVFGGLCRETGQRFLVKVPNRGAVTLLSEIKKNIEPGSTIMSDSWRGY 192 HSP 2 Score: 41.9726 bits (97), Expect = 2.226e-19 Identity = 19/47 (40.43%), Postives = 31/47 (65.96%), Query Frame = 2 Query: 470 SCLTYTQIVRFICCWS*KLISISFCASELRIANGMVRYRNHYLRDAC 610 S L++T ++RFI W+ +L S++FC +L +A V N+YLR+ C Sbjct: 58 SKLSFTTVIRFIYFWAEELTSVNFCHKQLGMAPNTVVDWNNYLREVC 104 HSP 3 Score: 35.8094 bits (81), Expect = 2.226e-19 Identity = 16/37 (43.24%), Postives = 20/37 (54.05%), Query Frame = 1 Query: 886 DLTHQTVNHSVALVNQKT*TNTQ*IERSWKTVKERNK 996 H VNH V+ +T NTQ +ER W + K RNK Sbjct: 201 GFAHFKVNHKYNFVDPETGANTQQVERMWGSAKWRNK 237
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Match: A0A2S2QDD2 (DDE_Tnp_IS1595 domain-containing protein OS=Sipha flava OX=143950 GN=g.81683 PE=4 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 1.637e-18 Identity = 35/67 (52.24%), Postives = 44/67 (65.67%), Query Frame = 3 Query: 669 ESVFTSRKNEIGRILLQQSVFGVNCCETDECFKFTIPDRTAATLMSIIAVKIHPVTAVMSDQWCAYN 869 ES+F+ RKN RIL QQ +FG CCET ECF +PDRT +TL++ I + I T + SD W AYN Sbjct: 136 ESLFSKRKNNTCRILPQQWIFGGLCCETKECFLIQVPDRTMSTLLNEILLNIKKGTKMYSDCWRAYN 202 HSP 2 Score: 38.1206 bits (87), Expect = 1.637e-18 Identity = 19/47 (40.43%), Postives = 27/47 (57.45%), Query Frame = 2 Query: 470 SCLTYTQIVRFICCWS*KLISISFCASELRIANGMVRYRNHYLRDAC 610 S L + ++RFI WS +L SI + L+I N V N+YLR+ C Sbjct: 67 SRLPFVTVLRFIFAWSQELTSIKWYEQHLKINNNTVIDWNNYLREVC 113 HSP 3 Score: 31.5722 bits (70), Expect = 1.637e-18 Identity = 16/38 (42.11%), Postives = 22/38 (57.89%), Query Frame = 1 Query: 889 LTHQTVNHSVALVNQKT*TNTQ*IERSWKTVKERNKCH 1002 H TVNHS V+ ++ +TQ +ER W + K NK H Sbjct: 211 FKHFTVNHSKNFVDPQSGAHTQNVERLWGSAKWGNKKH 248
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Planmine SMEST
Match: SMESG000080852.1 (SMESG000080852.1) HSP 1 Score: 84.7297 bits (208), Expect = 1.156e-17 Identity = 37/38 (97.37%), Postives = 38/38 (100.00%), Query Frame = 3 Query: 717 QQSVFGVNCCETDECFKFTIPDRTAATLMSIIAVKIHP 830 +QSVFGVNCCETDECFKFTIPDRTAATLMSIIAVKIHP Sbjct: 19 EQSVFGVNCCETDECFKFTIPDRTAATLMSIIAVKIHP 56 The following BLAST results are available for this feature:
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 1
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30026614 ID=SMED30026614|Name=DDE_Tnp_IS1595 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1048bpback to top Annotated Terms
The following terms have been associated with this transcript:
|