Intermediate filament protein

Overview
NameIntermediate filament protein
Smed IDSMED30026612
Length (bp)2359
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Intermediate filament protein (SMED30026612) t-SNE clustered cells

Violin plots show distribution of expression levels for Intermediate filament protein (SMED30026612) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Intermediate filament protein (SMED30026612) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Intermediate filament protein (SMED30026612) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026612

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30026612SMESG000030599.1 SMESG000030598.1 dd_Smed_v4_364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 5 cellSMED30026612SMESG000030598.1 SMED30024865smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
Category 5 cellSMED30026612SMESG000030598.1 SMED30024865smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
Category 5 cellSMED30026612SMESG000030598.1 SMED30024865smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
non-ciliated epidermisSMED30026612SMESG000030598.1 SMED30024865smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
non-ciliated epidermisSMED30026612SMESG000030598.1 SMED30024865smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
non-ciliated epidermisSMED30026612SMESG000030598.1 SMED30024865smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
epidermisSMED30026612SMESG000030598.1 DN315702ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30026612SMESG000030598.1 SMESG000030596.1 DN309670ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30026612SMESG000030598.1 SMESG000030596.1 DN309670ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30026612SMESG000030598.1 OX_Smed_1.0.11129ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
gutSMED30026612SMESG000030598.1 SMED30024865smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30026612SMESG000030598.1 SMED30024865smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026612SMESG000030598.1 SMED30024865smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 5 cellSMED30026612SMESG000030598.1 SMED30024865smed_20140614PMID:29357350
de Sousa et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
epidermisSMED30026612SMESG000030596.1 SMESG000030598.1 SMESG000030599.1 dd_Smed_v6_364_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30026612SMESG000030599.1 SMESG000030598.1 dd_Smed_v4_364_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026612SMESG000030599.1 SMESG000030598.1 dd_Smed_v4_364_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30026612SMESG000030599.1 SMESG000030598.1 dd_Smed_v4_364_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30026612SMESG000030599.1 SMESG000030598.1 dd_Smed_v4_364_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Intermediate filament protein vs. Ensembl Human
Match: VIM (vimentin [Source:HGNC Symbol;Acc:HGNC:12692])

HSP 1 Score: 121.709 bits (304), Expect = 9.237e-29
Identity = 116/393 (29.52%), Postives = 203/393 (51.65%), Query Frame = 2
Query:  422 NIPLIR--GDSV--ALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRV-----NFSS 1570
            ++P +R   DSV  +L   + T  K  R  EK +LQ+LN+RFA+YI+K RFLE QNK L+ E+E+LKG   Q  S++ ++YE E+ +LR  +      +A +EV+ D+L  +I  LR++L                                     Q   + +E+ E     + L+  RQD +  +LA L LE +++SL+E + F K++H+ E++EL         + ++   + ++  ALRD++ +YE+      QE +  Y S+  ++  +  R+N      K+E++  + Q+QS+   +  L+  N   E  +  +  N+     + +  +  LQ+++   ++++   L E Q LL+ K+ L++EIA Y KLLE EE+R+     NFSS
Sbjct:   73 SVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL-------------------------------------QEEMLQREEAE-----NTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS 420          
BLAST of Intermediate filament protein vs. Ensembl Human
Match: VIM (vimentin [Source:HGNC Symbol;Acc:HGNC:12692])

HSP 1 Score: 121.324 bits (303), Expect = 1.689e-28
Identity = 116/393 (29.52%), Postives = 206/393 (52.42%), Query Frame = 2
Query:  422 NIPLIR--GDSV--ALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRV-----NFSS 1570
            ++P +R   DSV  +L   + T  K  R  EK +LQ+LN+RFA+YI+K RFLE QNK L+ E+E+LKG   Q  S++ ++YE E+ +LR  +      +A +EV+ D+L  +I  LR++L                        + E+++               +EE +   + L+  RQD +  +LA L LE +++SL+E + F K++H+ E++EL         + ++   + ++  ALRD++ +YE+      QE +  Y S+  ++  +  R+N      K+E++  + Q+QS+   +  L+  N   E  +  +  N+     + +  +  LQ+++   ++++   L E Q LL+ K+ L++EIA Y KLLE EE+R+     NFSS
Sbjct:   73 SVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ---------------REEAE---NTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS 420          
BLAST of Intermediate filament protein vs. Ensembl Human
Match: VIM (vimentin [Source:HGNC Symbol;Acc:HGNC:12692])

HSP 1 Score: 121.324 bits (303), Expect = 1.689e-28
Identity = 116/393 (29.52%), Postives = 206/393 (52.42%), Query Frame = 2
Query:  422 NIPLIR--GDSV--ALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRV-----NFSS 1570
            ++P +R   DSV  +L   + T  K  R  EK +LQ+LN+RFA+YI+K RFLE QNK L+ E+E+LKG   Q  S++ ++YE E+ +LR  +      +A +EV+ D+L  +I  LR++L                        + E+++               +EE +   + L+  RQD +  +LA L LE +++SL+E + F K++H+ E++EL         + ++   + ++  ALRD++ +YE+      QE +  Y S+  ++  +  R+N      K+E++  + Q+QS+   +  L+  N   E  +  +  N+     + +  +  LQ+++   ++++   L E Q LL+ K+ L++EIA Y KLLE EE+R+     NFSS
Sbjct:   73 SVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ---------------REEAE---NTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS 420          
BLAST of Intermediate filament protein vs. Ensembl Human
Match: GFAP (glial fibrillary acidic protein [Source:HGNC Symbol;Acc:HGNC:4235])

HSP 1 Score: 107.071 bits (266), Expect = 1.141e-23
Identity = 102/372 (27.42%), Postives = 179/372 (48.12%), Query Frame = 2
Query:  452 ALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFS 1567
            AL +G    K+ RA E+ ++ +LN+RFASYIEK RFLE QNK L  E+ +L+    ++ +K+ ++Y+ E+ +LR  L     + A LEV+ D+L  ++  +R++L   ++ N + ++            E  L   R           +E +E    R DL++                 +++SL+E + F ++IH+ EV+EL     R      +   + ++  AL++I+ +YE   +    E +  Y S+  ++  +  R+       K E +  + Q+QS+   +  L   N   E  +      +     S +  L  L+E+    + ++   L E Q LL+ KL L++EIA Y KLLE EENR+   
Sbjct:   57 ALNAG---FKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRA---KEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQ--DETNLRLEA------------ENNLAAYR-----------QEADEATLARLDLER-----------------KIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIP 380          
BLAST of Intermediate filament protein vs. Ensembl Human
Match: GFAP (glial fibrillary acidic protein [Source:HGNC Symbol;Acc:HGNC:4235])

HSP 1 Score: 106.301 bits (264), Expect = 1.217e-23
Identity = 99/372 (26.61%), Postives = 177/372 (47.58%), Query Frame = 2
Query:  452 ALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFS 1567
            AL +G    K+ RA E+ ++ +LN+RFASYIEK RFLE QNK L  E+ +L+    ++ +K+ ++Y+ E+ +LR  L     + A LEV+ D+L  ++  +R++L    ++  + ++ +                         A   +E +E    R DL++                 +++SL+E + F ++IH+ EV+EL     R      +   + ++  AL++I+ +YE   +    E +  Y S+  ++  +  R+       K E +  + Q+QS+   +  L   N   E  +      +     S +  L  L+E+    + ++   L E Q LL+ KL L++EIA Y KLLE EENR+   
Sbjct:   57 ALNAG---FKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRA---KEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLRLEAENNL-------------------------AAYRQEADEATLARLDLER-----------------KIESLEEEIRFLRKIHEEEVRELQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKHEANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIP 380          
BLAST of Intermediate filament protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 188.348 bits (477), Expect = 4.782e-51
Identity = 125/369 (33.88%), Postives = 221/369 (59.89%), Query Frame = 2
Query:  458 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNF 1564
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++L  +++ L+    +D   I+ +YE E+   + L+ ++ K R  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + +++S Y  ++QEIQT   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L +   Q+   +++    + ELQ LLD K  L+ EIA Y K+LE EENR   
Sbjct:   56 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGL 424          

HSP 2 Score: 73.1738 bits (178), Expect = 3.803e-13
Identity = 44/116 (37.93%), Postives = 68/116 (58.62%), Query Frame = 2
Query: 1904 RMKFRRTTKGNISIAEADINGLFIVLEN-NGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEI--EEDGWGLGDTIVTSLYNAEGEEKAVHYQ 2242
            R  F+R+ KGN+SI EA  +G FIVL+N +  K E++    +KR IDG  + V +T+     L +G+ L I+A+ +      +  +   ED +G G+ + T L+N EGEE+A H Q
Sbjct:  456 RQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQ 570          
BLAST of Intermediate filament protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 188.348 bits (477), Expect = 5.168e-51
Identity = 125/369 (33.88%), Postives = 221/369 (59.89%), Query Frame = 2
Query:  458 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNF 1564
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++L  +++ L+    +D   I+ +YE E+   + L+ ++ K R  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + +++S Y  ++QEIQT   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L +   Q+   +++    + ELQ LLD K  L+ EIA Y K+LE EENR   
Sbjct:   56 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGL 424          

HSP 2 Score: 73.1738 bits (178), Expect = 3.770e-13
Identity = 44/116 (37.93%), Postives = 68/116 (58.62%), Query Frame = 2
Query: 1904 RMKFRRTTKGNISIAEADINGLFIVLEN-NGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEI--EEDGWGLGDTIVTSLYNAEGEEKAVHYQ 2242
            R  F+R+ KGN+SI EA  +G FIVL+N +  K E++    +KR IDG  + V +T+     L +G+ L I+A+ +      +  +   ED +G G+ + T L+N EGEE+A H Q
Sbjct:  456 RQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQ 570          
BLAST of Intermediate filament protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 187.963 bits (476), Expect = 6.922e-51
Identity = 125/369 (33.88%), Postives = 221/369 (59.89%), Query Frame = 2
Query:  458 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNF 1564
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++L  +++ L+    +D   I+ +YE E+   + L+ ++ K R  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + +++S Y  ++QEIQT   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L +   Q+   +++    + ELQ LLD K  L+ EIA Y K+LE EENR   
Sbjct:   48 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGL 416          

HSP 2 Score: 73.1738 bits (178), Expect = 4.156e-13
Identity = 44/116 (37.93%), Postives = 68/116 (58.62%), Query Frame = 2
Query: 1904 RMKFRRTTKGNISIAEADINGLFIVLEN-NGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEI--EEDGWGLGDTIVTSLYNAEGEEKAVHYQ 2242
            R  F+R+ KGN+SI EA  +G FIVL+N +  K E++    +KR IDG  + V +T+     L +G+ L I+A+ +      +  +   ED +G G+ + T L+N EGEE+A H Q
Sbjct:  448 RQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQ 562          
BLAST of Intermediate filament protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 187.963 bits (476), Expect = 6.922e-51
Identity = 125/369 (33.88%), Postives = 221/369 (59.89%), Query Frame = 2
Query:  458 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNF 1564
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++L  +++ L+    +D   I+ +YE E+   + L+ ++ K R  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + +++S Y  ++QEIQT   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L +   Q+   +++    + ELQ LLD K  L+ EIA Y K+LE EENR   
Sbjct:   48 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGL 416          

HSP 2 Score: 73.1738 bits (178), Expect = 4.156e-13
Identity = 44/116 (37.93%), Postives = 68/116 (58.62%), Query Frame = 2
Query: 1904 RMKFRRTTKGNISIAEADINGLFIVLEN-NGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEI--EEDGWGLGDTIVTSLYNAEGEEKAVHYQ 2242
            R  F+R+ KGN+SI EA  +G FIVL+N +  K E++    +KR IDG  + V +T+     L +G+ L I+A+ +      +  +   ED +G G+ + T L+N EGEE+A H Q
Sbjct:  448 RQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQ 562          
BLAST of Intermediate filament protein vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 187.963 bits (476), Expect = 6.922e-51
Identity = 125/369 (33.88%), Postives = 221/369 (59.89%), Query Frame = 2
Query:  458 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNF 1564
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++L  +++ L+    +D   I+ +YE E+   + L+ ++ K R  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + +++S Y  ++QEIQT   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L +   Q+   +++    + ELQ LLD K  L+ EIA Y K+LE EENR   
Sbjct:   48 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGL 416          

HSP 2 Score: 73.1738 bits (178), Expect = 4.156e-13
Identity = 44/116 (37.93%), Postives = 68/116 (58.62%), Query Frame = 2
Query: 1904 RMKFRRTTKGNISIAEADINGLFIVLEN-NGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEI--EEDGWGLGDTIVTSLYNAEGEEKAVHYQ 2242
            R  F+R+ KGN+SI EA  +G FIVL+N +  K E++    +KR IDG  + V +T+     L +G+ L I+A+ +      +  +   ED +G G+ + T L+N EGEE+A H Q
Sbjct:  448 RQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQ 562          
BLAST of Intermediate filament protein vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0346460)

HSP 1 Score: 119.013 bits (297), Expect = 1.825e-27
Identity = 108/392 (27.55%), Postives = 205/392 (52.30%), Query Frame = 2
Query:  461 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELV-------ELRRFKGTQGA-------DVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKE---LATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGNTS 1585
            S ++  +  R  EK +LQ+LN+R A+YI++ R LE +N +L  E++  +    ++ + IK I+E E+ + R LL D+ + RA  E+ +  L  E              N + K+ +DK+ K+ +  EG +        EL        A       D+N+  +E++ LR   ++ R++ E+E L+ + LE+ +QSL+E L F+ QIH  E+ E   +    Y +        + +++ ++L++++ +YE ++   + E+ S Y  ++Q +Q +  R +  T    EE    + +I ++ + I +LE  NA+    + ++    +  +     ++  L+++L   ++++T  L E Q L+D K+ L+LEIAAY KLL  EE R+N +   NT+
Sbjct:   42 SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEE--------------NEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTA 419          
BLAST of Intermediate filament protein vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0307059)

HSP 1 Score: 119.013 bits (297), Expect = 1.825e-27
Identity = 108/392 (27.55%), Postives = 205/392 (52.30%), Query Frame = 2
Query:  461 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELV-------ELRRFKGTQGA-------DVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKE---LATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGNTS 1585
            S ++  +  R  EK +LQ+LN+R A+YI++ R LE +N +L  E++  +    ++ + IK I+E E+ + R LL D+ + RA  E+ +  L  E              N + K+ +DK+ K+ +  EG +        EL        A       D+N+  +E++ LR   ++ R++ E+E L+ + LE+ +QSL+E L F+ QIH  E+ E   +    Y +        + +++ ++L++++ +YE ++   + E+ S Y  ++Q +Q +  R +  T    EE    + +I ++ + I +LE  NA+    + ++    +  +     ++  L+++L   ++++T  L E Q L+D K+ L+LEIAAY KLL  EE R+N +   NT+
Sbjct:   42 SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEE--------------NEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTA 419          
BLAST of Intermediate filament protein vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0307058)

HSP 1 Score: 119.013 bits (297), Expect = 1.825e-27
Identity = 108/392 (27.55%), Postives = 205/392 (52.30%), Query Frame = 2
Query:  461 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELV-------ELRRFKGTQGA-------DVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKE---LATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGNTS 1585
            S ++  +  R  EK +LQ+LN+R A+YI++ R LE +N +L  E++  +    ++ + IK I+E E+ + R LL D+ + RA  E+ +  L  E              N + K+ +DK+ K+ +  EG +        EL        A       D+N+  +E++ LR   ++ R++ E+E L+ + LE+ +QSL+E L F+ QIH  E+ E   +    Y +        + +++ ++L++++ +YE ++   + E+ S Y  ++Q +Q +  R +  T    EE    + +I ++ + I +LE  NA+    + ++    +  +     ++  L+++L   ++++T  L E Q L+D K+ L+LEIAAY KLL  EE R+N +   NT+
Sbjct:   42 SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEE--------------NEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTA 419          
BLAST of Intermediate filament protein vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0079100)

HSP 1 Score: 119.013 bits (297), Expect = 1.825e-27
Identity = 108/392 (27.55%), Postives = 205/392 (52.30%), Query Frame = 2
Query:  461 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELV-------ELRRFKGTQGA-------DVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKE---LATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGNTS 1585
            S ++  +  R  EK +LQ+LN+R A+YI++ R LE +N +L  E++  +    ++ + IK I+E E+ + R LL D+ + RA  E+ +  L  E              N + K+ +DK+ K+ +  EG +        EL        A       D+N+  +E++ LR   ++ R++ E+E L+ + LE+ +QSL+E L F+ QIH  E+ E   +    Y +        + +++ ++L++++ +YE ++   + E+ S Y  ++Q +Q +  R +  T    EE    + +I ++ + I +LE  NA+    + ++    +  +     ++  L+++L   ++++T  L E Q L+D K+ L+LEIAAY KLL  EE R+N +   NT+
Sbjct:   42 SPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEE--------------NEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTA 419          
BLAST of Intermediate filament protein vs. Ensembl Fly
Match: LamC (gene:FBgn0010397 transcript:FBtr0087512)

HSP 1 Score: 110.538 bits (275), Expect = 1.054e-24
Identity = 109/392 (27.81%), Postives = 209/392 (53.32%), Query Frame = 2
Query:  434 IRGDSVALQSGVTS----MKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRL--MMLEDINSQYKSTIDKQR-KDISG-FEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELAT---VAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDG 1576
            + G S + + G TS     +  R QEK +LQ LN+R A YI++ R LE +N +L  E+   +    ++ S +K +YE E+   R LL ++ K +A LE+ +  L  E DDL+ RL     E   ++  + + + R  +++G +   L + ++F+  Q  ++  E E    LR  L  LR+  E E LA + LE++ QSL+E L F+ Q+H  E+ E  +   +   +        +++++ ++L++++++YE ++   ++E++  Y +++Q ++ +  R    +    EE   ++++I  + +++ +LE  NA     +  +    +  ++     + +L+ +L   + ++   L E Q L+D K+ L+LEIAAY KLL  EE R+N  S G
Sbjct:   21 VGGASTSSRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADRKKFED-QAKELALENER---LRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAAANRAAQGSALATEEVRLMRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQEYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPG 408          

HSP 2 Score: 49.6766 bits (117), Expect = 9.086e-6
Identity = 35/120 (29.17%), Postives = 61/120 (50.83%), Query Frame = 2
Query: 1880 EAEEYQLKRMKFRRTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELE-IEEDGWGLGDTIVTSLYNAEGEEKAVH 2236
            E+E+  L         KG++ I EAD+ G FI L N GT+  +LTG  + R I G+E+ ++F     + +  G  +TIW+    T        + +  W + +++ + L NA+ E+ A +
Sbjct:  461 ESEDRTLSEYSVNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTR-IAGDEE-LAFKFSRGSKVLGGASVTIWSVDAGTAHDPPNNLVMKKKWPVANSMRSVLANADKEDVASY 578          
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Match: viml (vimentin like [Source:ZFIN;Acc:ZDB-GENE-040426-1743])

HSP 1 Score: 118.627 bits (296), Expect = 8.400e-28
Identity = 119/377 (31.56%), Postives = 188/377 (49.87%), Query Frame = 2
Query:  470 TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRT---LLSDSEKSRAPLEVQVDSLEYEIDDLRKRLM--MLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRV-----NFSS 1570
            T  K  R  EK  +Q LN+RFASYIEK RFLE QNK L  E+E+L+G   Q +S+I ++YE E+  LR    LL+ +EK+RA  EV  D+L  +++ L+++L   ML             QR+D                                 + +K  RQD +  ALA + LE +++SL++ L F K +HD E+ EL T       +  M   + ++  ALRD++ +YEN  +   QE +  Y S+  ++  +  R+N      K+E +  + Q+Q++   +  L   N   E  +  +  N+       +  +  L+E +   + ++   L E Q LL+ K+ L++EIA Y KLLE EE+R+     NFSS
Sbjct:   75 TEFKANRLNEKAQMQSLNDRFASYIEKVRFLEQQNKILSAELEQLRG---QRSSRIADLYEEEMRDLRRQVDLLT-TEKTRA--EVMRDNLAEDVERLKEKLQDEML-------------QREDAE-------------------------------NSMKSFRQDVDNAALARVDLERKVESLQDELAFLKNLHDEELAELQTQIQGQQVQVEMDMAKPDLTAALRDVRLQYENLASKNIQESEDWYKSKFADLTEAANRNNEALRLAKQETNEYRRQVQAITCELDALRGTNESLERQMREMEENFSMESSGFQNTIGRLEEDIGNMKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRIAAPLPNFSS 401          
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Match: vim (vimentin [Source:ZFIN;Acc:ZDB-GENE-011212-3])

HSP 1 Score: 114.005 bits (284), Expect = 2.863e-26
Identity = 111/393 (28.24%), Postives = 192/393 (48.85%), Query Frame = 2
Query:  428 PLIRGDSVALQSGV-----TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLM--MLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRV-----NFSS 1570
            PL R  +  L  G+     T  K  R  EK ++Q LN+RFASYI+K RFLE QNK L+ E+E+L+G      S++ ++YE E+ +LR  +      ++ +EV  D+L  +I+ L++RL   ML             QR+D                                 + L+  RQD +  +LA L LE +++SL+E + F K++HD E+ E+         + +M   + ++  AL+D++ +YE   +   QE +  Y S+  ++  +  R+N      K+E +  + Q+Q++   +  L+  N   E  +  +  ++       +  +  L++ +   + ++   L E Q LL+ K+ L++EIA Y KLLE EE+R+     NFSS
Sbjct:   66 PLPRLATDTLDFGLAEAINTEFKANRTNEKAEMQHLNDRFASYIDKVRFLEQQNKILIAELEQLRGKGA---SRVGDLYEDEMRELRRQVDQLTGEKSKVEVDRDNLGEDIERLKERLQEEML-------------QREDAE-------------------------------NSLRSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEELAEMQIQMQEQHLQIDMEVAKPDLTAALKDVRQQYETLASRNLQESEDWYKSKFADLSEAAARNNETIRLAKQEANDYRRQLQALTCDLEALKGTNESLERQMRELEDSFSMEASGYQDTIGRLEDDIRNMKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRITSPFPNFSS 411          
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Match: desma (desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221])

HSP 1 Score: 108.612 bits (270), Expect = 2.429e-24
Identity = 102/361 (28.25%), Postives = 178/361 (49.31%), Query Frame = 2
Query:  488 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRK-RLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNF 1564
            R  EK +LQ LN+RFASYIEK RFLE QN  L  EIE+L+G   ++ ++I E+YE E+ +LR  +      R+ +E++ D+L   +DDL+K +L + E+I+ +     ++   ++S F               ADV+       TL R DL++                  ++ L E + F ++IH+ E++EL         +  M   + ++  ALRDI+ +YE        E +  Y S++ ++  +  ++N      K+E  + + Q+QS    I  L+  N      ++ +           +  +  L+ ++   + ++   L E Q LL+ K+ L++EIA Y KLLE EE+R++ 
Sbjct:   99 RTNEKAELQHLNDRFASYIEKVRFLEQQNSALTVEIERLRG---REPTRIAELYEEEMRELRRQVEALTNQRSRVEIERDNL---VDDLQKLKLRLQEEIHQK-----EEAENNLSAFR--------------ADVD-----AATLARLDLER-----------------RIEGLHEEIAFLRKIHEEEIRELQNQMQESQVQIQMDMSKPDLTAALRDIRLQYEAIAAKNISEAEDWYKSKVSDLNQAVNKNNEALREAKQETMQFRHQLQSYTCEIDSLKGTNESLRRQMSEMEERLGREAGGYQDTIARLEAEIAKMKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRISL 412          
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Match: desma (desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221])

HSP 1 Score: 108.227 bits (269), Expect = 2.734e-24
Identity = 102/361 (28.25%), Postives = 178/361 (49.31%), Query Frame = 2
Query:  488 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRK-RLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNF 1564
            R  EK +LQ LN+RFASYIEK RFLE QN  L  EIE+L+G   ++ ++I E+YE E+ +LR  +      R+ +E++ D+L   +DDL+K +L + E+I+ +     ++   ++S F               ADV+       TL R DL++                  ++ L E + F ++IH+ E++EL         +  M   + ++  ALRDI+ +YE        E +  Y S++ ++  +  ++N      K+E  + + Q+QS    I  L+  N      ++ +           +  +  L+ ++   + ++   L E Q LL+ K+ L++EIA Y KLLE EE+R++ 
Sbjct:   99 RTNEKAELQHLNDRFASYIEKVRFLEQQNSALTVEIERLRG---REPTRIAELYEEEMRELRRQVEALTNQRSRVEIERDNL---VDDLQKLKLRLQEEIHQK-----EEAENNLSAFR--------------ADVD-----AATLARLDLER-----------------RIEGLHEEIAFLRKIHEEEIRELQNQMQESQVQIQMDMSKPDLTAALRDIRLQYEAIAAKNISEAEDWYKSKVSDLNQAVNKNNEALREAKQETMQFRHQLQSYTCEIDSLKGTNESLRRQMSEMEERLGREAGGYQDTIARLEAEIAKMKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRISL 412          
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 104.76 bits (260), Expect = 7.720e-23
Identity = 105/402 (26.12%), Postives = 196/402 (48.76%), Query Frame = 2
Query:  452 ALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEID-----------DLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVELRR--FKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEM--------GRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGNT 1582
            A Q+ ++  +  R QEK +L+ LN+R A YI++ R LE +N +L  ++ + +  T ++ S IK +YE E+   R +L ++ + RA L++++  +  E++           DL   L+ ++D+ +QY   ++ ++    + +    EL +L+    K      V K++ EV+TL R DL+                    QSL E LEF K + D EV+E      R   ++ MV   S M         +AL+D++ ++E ++   K+EL  ++ ++L   + S   ++      +EE      +I+ +  +++ L+ Q +  E  +  +       +     QL   + ++   ++ +   L E Q LLD KL L++EI AY KLLE EE+R+  S   ++
Sbjct:   11 AAQTPLSPARISRLQEKEELRALNDRLAVYIDRVRALELENDRLQFKVSEKEEVTTREVSGIKSLYEAELADARRVLDETARERAKLQIELGKVNSELEEVTRNYKKKDGDLAAALVRIKDLEAQYNKNEAALNTALSENASLSAELADLKAQLAKAEDAHGVAKKQLEVETLMRVDLEN-----------------RCQSLTEELEFRKSMFDEEVRE-----TRRRHEKRMVEVDSGMQQDYEFKLSQALQDLRKQHEEQVQIYKEELQHTFKAKLDNAKVSSDLNDKAVLTAREELQEAHVRIEGLSYQLSALQKQASAAEERIRELEGLLSSDRDKYRRQLDAKEREMAEMRECMQQQLNEYQELLDVKLALDMEINAYRKLLEGEEDRLKLSPSPSS 390          

HSP 2 Score: 55.4546 bits (132), Expect = 2.368e-7
Identity = 30/103 (29.13%), Postives = 53/103 (51.46%), Query Frame = 2
Query: 1931 GNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEI---EEDGWGLGDTIVTSLYNAEGEEKA 2230
            G++SI E D+ G  + L NN  K +SL    +KR I G+ + + +    +  L +G+ +T+W+           ++    +  WG G+ I+T L N+ GE+ A
Sbjct:  438 GSVSIEEIDLEGKSVTLRNNSDKDQSLGSWRLKRQI-GDGEEIVYKFSPKFVLKAGQTVTVWSADAGMSHSPPSDLLWKSQSSWGTGENILTLLVNSSGEDVA 539          
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Match: vim (vimentin [Source:NCBI gene;Acc:496727])

HSP 1 Score: 122.094 bits (305), Expect = 9.821e-29
Identity = 107/361 (29.64%), Postives = 189/361 (52.35%), Query Frame = 2
Query:  479 KKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKG-GTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRV 1558
            K  R  EK ++Q+LN+RFA++I+K RFLE QNK LV E+E+LKG GT    S+I ++YE E+ +LR  L     ++  +EV  D+L  ++  LR++L                        + E+++               KEE +    +L+  RQD +  +LA + LE +++SL+E + F K++HD E++EL         + +M   + ++  ALRD++ +YEN       + +  Y S+  ++  +  R+N      K++ +  + QIQ++   I  ++  N  YE  +  +  N+     + +  +  LQE++   ++++   L E Q LL+ K+ L++EIA Y KLLE EE+R+
Sbjct:   97 KANRTNEKAEMQELNDRFANFIDKVRFLEQQNKILVAELEQLKGKGT----SRIGDLYEEEMRELRRQLDQVTNAKDRVEVDRDNLADDLQRLREKL------------------------QDEMIQ---------------KEEAEG---NLQSFRQDVDNASLARIDLERKVESLQEEIVFLKKLHDEEIRELQLQIQESHIQVDMDVSKPDLTAALRDVRQQYENVAAKNLSDAEDWYKSKFADLSEAANRNNDALRQAKQDANDYRRQIQTLTCEIDAMKGSNESYERQMREMEENFAGEAANYQDTIQRLQEEIHNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRI 411          
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Match: vim (vimentin [Source:NCBI gene;Acc:496727])

HSP 1 Score: 121.709 bits (304), Expect = 1.124e-28
Identity = 107/361 (29.64%), Postives = 189/361 (52.35%), Query Frame = 2
Query:  479 KKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKG-GTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRV 1558
            K  R  EK ++Q+LN+RFA++I+K RFLE QNK LV E+E+LKG GT    S+I ++YE E+ +LR  L     ++  +EV  D+L  ++  LR++L                        + E+++               KEE +    +L+  RQD +  +LA + LE +++SL+E + F K++HD E++EL         + +M   + ++  ALRD++ +YEN       + +  Y S+  ++  +  R+N      K++ +  + QIQ++   I  ++  N  YE  +  +  N+     + +  +  LQE++   ++++   L E Q LL+ K+ L++EIA Y KLLE EE+R+
Sbjct:   99 KANRTNEKAEMQELNDRFANFIDKVRFLEQQNKILVAELEQLKGKGT----SRIGDLYEEEMRELRRQLDQVTNAKDRVEVDRDNLADDLQRLREKL------------------------QDEMIQ---------------KEEAEG---NLQSFRQDVDNASLARIDLERKVESLQEEIVFLKKLHDEEIRELQLQIQESHIQVDMDVSKPDLTAALRDVRQQYENVAAKNLSDAEDWYKSKFADLSEAANRNNDALRQAKQDANDYRRQIQTLTCEIDAMKGSNESYERQMREMEENFAGEAANYQDTIQRLQEEIHNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRI 413          
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Match: vim (vimentin [Source:NCBI gene;Acc:496727])

HSP 1 Score: 121.709 bits (304), Expect = 1.171e-28
Identity = 110/370 (29.73%), Postives = 193/370 (52.16%), Query Frame = 2
Query:  479 KKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKG-GTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRV-----NFSS 1570
            K  R  EK ++Q+LN+RFA++I+K RFLE QNK LV E+E+LKG GT    S+I ++YE E+ +LR  L     ++  +EV  D+L  ++  LR++L                        + E+++               KEE +    +L+  RQD +  +LA + LE +++SL+E + F K++HD E++EL         + +M   + ++  ALRD++ +YEN       + +  Y S+  ++  +  R+N      K++ +  + QIQ++   I  ++  N  YE  +  +  N+     + +  +  LQE++   ++++   L E Q LL+ K+ L++EIA Y KLLE EE+R+     +FSS
Sbjct:   93 KANRTNEKAEMQELNDRFANFIDKVRFLEQQNKILVAELEQLKGKGT----SRIGDLYEEEMRELRRQLDQVTNAKDRVEVDRDNLADDLQRLREKL------------------------QDEMIQ---------------KEEAEG---NLQSFRQDVDNASLARIDLERKVESLQEEIVFLKKLHDEEIRELQLQIQESHIQVDMDVSKPDLTAALRDVRQQYENVAAKNLSDAEDWYKSKFADLSEAANRNNDALRQAKQDANDYRRQIQTLTCEIDAMKGSNESYERQMREMEENFAGEAANYQDTIQRLQEEIHNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRITVPVHSFSS 416          
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Match: rnasek (ribonuclease K [Source:Xenbase;Acc:XB-GENE-6046202])

HSP 1 Score: 107.457 bits (267), Expect = 1.560e-23
Identity = 109/395 (27.59%), Postives = 208/395 (52.66%), Query Frame = 2
Query:  428 PLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQL---VNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLR----KRLMMLEDINSQYKST---IDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKEL-----ATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFS 1567
            P   G   ++ + ++  +  R QEK DLQ+LN+R A YI+K R LE++N  L   V E E+++   V   S IKE+YE E+   R  L D+ + RA L++++  +  E +DLR    K+   LE   ++++ T   ++ +   ++  + E       K  QG +V   K E+  L   L   ++  E+E L  + LE+  QSL E L+F K +++ E+KE        +   D  K+  + ++ ++ +AL D++ ++++++T  K+EL+ +Y S+L+  + S   ++      +EE    + +I S+ S++++L+ ++  +   +  +     + + +    L   + ++   +  +   L + + LLD KL L++EI+AY KLLE EE R+  S
Sbjct:    9 PRSSGRRSSMNTPLSPTRISRLQEKVDLQELNDRLAVYIDKVRSLESENSLLHVQVTEREEVRSREV---SGIKELYETELADARRSLDDTARERARLQLELSKISVEHEDLRASFSKKESELESAQARFRETEALLNSKNAALATTQSE------NKSLQG-EVEDLKAEIGQLESALALAKKQLEEEILIKVDLENRCQSLIEELDFRKNVYEEEIKETRRRHETRLVEVDSGKQ--IEYEHKLSQALADMREQHDSQVTLYKEELEHTYQSKLENARLSSEMNSSAVNSTREELMESRYRIDSLTSQLSELQKESRAWHDRMQELEDMLAKEKDNSRKMLAEREREMADIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERLKLS 391          
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Match: rnasek (ribonuclease K [Source:Xenbase;Acc:XB-GENE-6046202])

HSP 1 Score: 106.686 bits (265), Expect = 2.875e-23
Identity = 108/391 (27.62%), Postives = 207/391 (52.94%), Query Frame = 2
Query:  440 GDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQL---VNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLR----KRLMMLEDINSQYKST---IDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKEL-----ATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFS 1567
            G   ++ + ++  +  R QEK DLQ+LN+R A YI+K R LE++N  L   V E E+++   V   S IKE+YE E+   R  L D+ + RA L++++  +  E +DLR    K+   LE   ++++ T   ++ +   ++  + E       K  QG +V   K E+  L   L   ++  E+E L  + LE+  QSL E L+F K +++ E+KE        +   D  K+  + ++ ++ +AL D++ ++++++T  K+EL+ +Y S+L+  + S   ++      +EE    + +I S+ S++++L+ ++  +   +  +     + + +    L   + ++   +  +   L + + LLD KL L++EI+AY KLLE EE R+  S
Sbjct:   21 GRRSSMNTPLSPTRISRLQEKVDLQELNDRLAVYIDKVRSLESENSLLHVQVTEREEVRSREV---SGIKELYETELADARRSLDDTARERARLQLELSKISVEHEDLRASFSKKESELESAQARFRETEALLNSKNAALATTQSE------NKSLQG-EVEDLKAEIGQLESALALAKKQLEEEILIKVDLENRCQSLIEELDFRKNVYEEEIKETRRRHETRLVEVDSGKQ--IEYEHKLSQALADMREQHDSQVTLYKEELEHTYQSKLENARLSSEMNSSAVNSTREELMESRYRIDSLTSQLSELQKESRAWHDRMQELEDMLAKEKDNSRKMLAEREREMADIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERLKLS 399          

HSP 2 Score: 56.9954 bits (136), Expect = 1.069e-7
Identity = 31/103 (30.10%), Postives = 54/103 (52.43%), Query Frame = 2
Query: 1931 GNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEI---EEDGWGLGDTIVTSLYNAEGEEKA 2230
            G++SI E D++G +I L+NN  +   L G  + R I   E +V+F   +R  L +G+ +TIWA           ++    ++ W  G+ +   L N++GE+ A
Sbjct:  448 GDVSIEEVDVDGKYIRLKNNSEQDHPLGGWELTRTI--GEASVNFKFTSRYVLKAGQTVTIWAADAGVTASPPSDLIWKNQNSWATGEDVKVILKNSQGEDVA 548          
BLAST of Intermediate filament protein vs. Ensembl Mouse
Match: Vim (vimentin [Source:MGI Symbol;Acc:MGI:98932])

HSP 1 Score: 122.479 bits (306), Expect = 3.468e-29
Identity = 113/387 (29.20%), Postives = 203/387 (52.45%), Query Frame = 2
Query:  422 NIPLIR--GDSV--ALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFS 1567
            ++P +R   DSV  +L   + T  K  R  EK +LQ+LN+RFA+YI+K RFLE QNK L+ E+E+LKG   Q  S++ ++YE E+ +LR  +      +A +EV+ D+L  +I  LR++L                        + E+++               +EE ++    L+  RQD +  +LA L LE +++SL+E + F K++HD E++EL         + ++   + ++  ALRD++ +YE+      QE +  Y S+  ++  +  R+N      K+E++  + Q+QS+   +  L+  N   E  +  +  N+     + +  +  LQ+++   ++++   L E Q LL+ K+ L++EIA Y KLLE EE+R++  
Sbjct:   73 SVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ---------------REEAEST---LQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLP 414          
BLAST of Intermediate filament protein vs. Ensembl Mouse
Match: Vim (vimentin [Source:MGI Symbol;Acc:MGI:98932])

HSP 1 Score: 121.709 bits (304), Expect = 8.803e-29
Identity = 113/387 (29.20%), Postives = 203/387 (52.45%), Query Frame = 2
Query:  422 NIPLIR--GDSV--ALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFS 1567
            ++P +R   DSV  +L   + T  K  R  EK +LQ+LN+RFA+YI+K RFLE QNK L+ E+E+LKG   Q  S++ ++YE E+ +LR  +      +A +EV+ D+L  +I  LR++L                        + E+++               +EE ++    L+  RQD +  +LA L LE +++SL+E + F K++HD E++EL         + ++   + ++  ALRD++ +YE+      QE +  Y S+  ++  +  R+N      K+E++  + Q+QS+   +  L+  N   E  +  +  N+     + +  +  LQ+++   ++++   L E Q LL+ K+ L++EIA Y KLLE EE+R++  
Sbjct:   73 SVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKL------------------------QEEMLQ---------------REEAEST---LQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLP 414          
BLAST of Intermediate filament protein vs. Ensembl Mouse
Match: Gfap (glial fibrillary acidic protein [Source:MGI Symbol;Acc:MGI:95697])

HSP 1 Score: 107.457 bits (267), Expect = 2.780e-24
Identity = 100/372 (26.88%), Postives = 180/372 (48.39%), Query Frame = 2
Query:  452 ALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFS 1567
            AL +G    K+ RA E+ ++ +LN+RFASYIEK RFLE QNK L  E+ +L+    ++ +K+ ++Y+ E+ +LR  L     + A LEV+ D+   ++  LR++L    ++  + ++ +                         A   +E +E    R DL++                 +++SL+E ++F ++I++ EV+EL     +      M   + ++  ALR+I+ +YE   T   QE +  Y S+  ++  + +R+       K E +  + Q+Q++   +  L   N   E  +      +     S +  L  L+E+    ++++   L E Q LL+ KL L++EIA Y KLLE EENR+   
Sbjct:   54 ALNAG---FKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRA---KEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNFAQDLGTLRQKLQDETNLRLEAENNL-------------------------AAYRQEADEATLARVDLER-----------------KVESLEEEIQFLRKIYEEEVRELREQLAQQQVHVEMDVAKPDLTAALREIRTQYEAVATSNMQETEEWYRSKFADLTDAASRNAELLRQAKHEANDYRRQLQALTCDLESLRGTNESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIP 377          
BLAST of Intermediate filament protein vs. Ensembl Mouse
Match: Gfap (glial fibrillary acidic protein [Source:MGI Symbol;Acc:MGI:95697])

HSP 1 Score: 107.071 bits (266), Expect = 3.992e-24
Identity = 103/372 (27.69%), Postives = 182/372 (48.92%), Query Frame = 2
Query:  452 ALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFS 1567
            AL +G    K+ RA E+ ++ +LN+RFASYIEK RFLE QNK L  E+ +L+    ++ +K+ ++Y+ E+ +LR  L     + A LEV+ D+   ++  LR++L   ++ N + ++            E  L   R           +E +E    R DL++                 +++SL+E ++F ++I++ EV+EL     +      M   + ++  ALR+I+ +YE   T   QE +  Y S+  ++  + +R+       K E +  + Q+Q++   +  L   N   E  +      +     S +  L  L+E+    ++++   L E Q LL+ KL L++EIA Y KLLE EENR+   
Sbjct:   54 ALNAG---FKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRA---KEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNFAQDLGTLRQKLQ--DETNLRLEA------------ENNLAAYR-----------QEADEATLARVDLER-----------------KVESLEEEIQFLRKIYEEEVRELREQLAQQQVHVEMDVAKPDLTAALREIRTQYEAVATSNMQETEEWYRSKFADLTDAASRNAELLRQAKHEANDYRRQLQALTCDLESLRGTNESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIP 377          
BLAST of Intermediate filament protein vs. Ensembl Mouse
Match: Des (desmin [Source:MGI Symbol;Acc:MGI:94885])

HSP 1 Score: 104.375 bits (259), Expect = 5.651e-23
Identity = 104/360 (28.89%), Postives = 175/360 (48.61%), Query Frame = 2
Query:  488 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFS 1567
            R  EK +LQ+LN+RFA+YIEK RFLE QN  L  E+ +LKG   ++ +++ E+YE E+ +LR  +      RA ++V+ D+L   IDDL++    L+                      E ++LR              EE +   ++L   R D +   LA + LE  ++SL E + F K++H+ E++EL         +  M   + ++  ALRDI+ +YE        E +  Y S++ ++  +  ++N      K+E    + QIQS    I  L+  N      +  +   +       +  +  L+E++   + ++   L E Q LL+ K+ L++EIA Y KLLE EE+R+N  
Sbjct:  104 RTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKG---REPTRVAELYEEEMRELRRQVEVLTNQRARVDVERDNL---IDDLQRLKAKLQ----------------------EEIQLR--------------EEAE---NNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEANGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLP 418          
BLAST of Intermediate filament protein vs. UniProt/SwissProt
Match: sp|Q01240|NF60_DORPE (60 kDa neurofilament protein OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 4.614e-68
Identity = 150/371 (40.43%), Postives = 238/371 (64.15%), Query Frame = 2
Query:  461 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNF 1564
            +GV  +K  R +EK+D++DLNERFA+YIEK RFLEAQNK+L  E+E+LK    ++ S IKE+YE E+ + R L+  + K +  L+V+V  L   ID L ++   LE+  + +   +  I +Q + ++  EGE+  LRR   +   +  ++   +  + D+++K+R D   E + HL  E+  Q+L+E LEF+K +H  E+KELA +AYRD T EN  +W++E+ +A+RDIQ EY+ K   ++ ++++ Y  ++QE +T  T+ N+E T  KEEN+++KS +  +R+R+ADLE +NA+ E    ++  + EE  R  EL+    +E++T  + ++   L ELQ L+D KL LELEIAAY KLLE EE+RV  
Sbjct:   84 TGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTEL---IDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRVGM 451          
BLAST of Intermediate filament protein vs. UniProt/SwissProt
Match: sp|Q01241|NF70_DORPE (70 kDa neurofilament protein OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 5.077e-67
Identity = 150/371 (40.43%), Postives = 238/371 (64.15%), Query Frame = 2
Query:  461 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQY---KSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNF 1564
            +GV  +K  R +EK+D++DLNERFA+YIEK RFLEAQNK+L  E+E+LK    ++ S IKE+YE E+ + R L+  + K +  L+V+V  L   ID L ++   LE+  + +   +  I +Q + ++  EGE+  LRR   +   +  ++   +  + D+++K+R D   E + HL  E+  Q+L+E LEF+K +H  E+KELA +AYRD T EN  +W++E+ +A+RDIQ EY+ K   ++ ++++ Y  ++QE +T  T+ N+E T  KEEN+++KS +  +R+R+ADLE +NA+ E    ++  + EE  R  EL+    +E++T  + ++   L ELQ L+D KL LELEIAAY KLLE EE+RV  
Sbjct:   84 TGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTEL---IDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKELQDLMDIKLSLELEIAAYRKLLEGEESRVGM 451          

HSP 2 Score: 68.9366 bits (167), Expect = 1.109e-10
Identity = 44/112 (39.29%), Postives = 64/112 (57.14%), Query Frame = 2
Query: 1913 FRRTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXE--LEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQ 2242
            ++RT+KG++SI EAD  G FI LE    K E+LTG  I R +D N+   ++ I N   L +G  + IW+K  +     +  +  E D WG G  +VT L N +GE+KA + Q
Sbjct:  503 YQRTSKGSVSIKEADSQGCFIALETK--KEENLTGWKIVRKVDDNK-VYTYEIPNLV-LKTGTVVKIWSKNHQAQARGDDLVSRENDTWGTGSNVVTILQNEKGEDKANYTQ 610          
BLAST of Intermediate filament protein vs. UniProt/SwissProt
Match: sp|P90901|IFA1_CAEEL (Intermediate filament protein ifa-1 OS=Caenorhabditis elegans OX=6239 GN=ifa-1 PE=1 SV=2)

HSP 1 Score: 188.348 bits (477), Expect = 6.574e-50
Identity = 125/369 (33.88%), Postives = 221/369 (59.89%), Query Frame = 2
Query:  458 QSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNF 1564
            Q+  ++++  R +EK+++ DLN+R ASYIEK RFLEAQN++L  +++ L+    +D   I+ +YE E+   + L+ ++ K R  +E Q+  ++ E+ ++R++L        Q ++ ID     +S  E E+  L+R       +V + K+E + L  +L++ R D ++E L  +  ++++Q+L E ++F +++HD E+KEL T+A RD T EN  ++++E+  A+RDI+ EY+      + +++S Y  ++QEIQT   R N+E  + KEE  R+++Q+  +R ++ADLE +N+  E  +  +    E+ QRS E  L +   Q+   +++    + ELQ LLD K  L+ EIA Y K+LE EENR   
Sbjct:   56 QNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENRAGL 424          

HSP 2 Score: 73.1738 bits (178), Expect = 4.796e-12
Identity = 44/116 (37.93%), Postives = 68/116 (58.62%), Query Frame = 2
Query: 1904 RMKFRRTTKGNISIAEADINGLFIVLEN-NGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEI--EEDGWGLGDTIVTSLYNAEGEEKAVHYQ 2242
            R  F+R+ KGN+SI EA  +G FIVL+N +  K E++    +KR IDG  + V +T+     L +G+ L I+A+ +      +  +   ED +G G+ + T L+N EGEE+A H Q
Sbjct:  456 RQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATHIQ 570          
BLAST of Intermediate filament protein vs. UniProt/SwissProt
Match: sp|P90900|IFA4_CAEEL (Intermediate filament protein ifa-4 OS=Caenorhabditis elegans OX=6239 GN=ifa-4 PE=1 SV=3)

HSP 1 Score: 174.866 bits (442), Expect = 2.972e-45
Identity = 117/367 (31.88%), Postives = 209/367 (56.95%), Query Frame = 2
Query:  464 GVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNF 1564
              +++++ R +EK+++ +LN+R ASYIEK RFLEAQN+++  ++  L+G    D++ +K +YE E+   + L++DS+K RA LE Q+  L  E+++ R +L   E      +  +D     +   E E+  L+R        +   K E   + D L   R   E+E L  +  ++++Q+L E  +F ++IHD+E+ +L  +A RD T EN  Y+++E+  A+R+I++EY++     + +++S Y  ++QEI T  +R+ +E  + +EE  R+++ +  MR ++ADLE +N   E  + ++    EE  RS E  L +    +   + +  I + ELQ L+D K  L+ EI  Y K+L+ EENR   
Sbjct:   59 AASAIRESRTREKKEMSELNDRLASYIEKVRFLEAQNRKMEKDLNLLRGKWGHDSTSVKVMYETELRSAKDLIADSDKERAQLEDQIKKLVEELNNYRNKLHEAERGADVTRKELDNVLGRLGALEAEIELLKRRISLMEESIGHLKRENHRMIDSLHHARNAVEQETLNRIDYQNQVQTLLEECDFIRRIHDSEIHDLLAMASRDTTVENREYFKNELSSAIREIRSEYDHVSNTTRTDIESWYKLKVQEIHTQNSRNCLEQNYAREEVKRLRTTLGDMRGKMADLEGRNLLLEKQIEDLNYQMEEDMRSYEQSLNDKDTSINKLRDESKILMVELQMLIDTKQTLDAEIVIYRKMLDGEENRAGL 425          

HSP 2 Score: 67.0106 bits (162), Expect = 4.353e-10
Identity = 40/112 (35.71%), Postives = 67/112 (59.82%), Query Frame = 2
Query: 1913 FRRTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEIE--EDGWGLGDTIVTSLYNAEGEEKAVHYQ 2242
            + R+ KGNI+I EA+ +G +IVLEN   + E++    ++R I G  + V FT     +L + + + I+A+G+      +  +   ED +G G+ +VT+LYN EGE++A H Q
Sbjct:  460 YSRSAKGNIAIQEAEPSGKYIVLENISRRDENIGDWKLRRKIAGKREIV-FTFPREFTLRAQKSVKIFARGQGVHSPPDSLVYDLEDSFGTGNDVVTTLYNKEGEDRASHSQ 570          
BLAST of Intermediate filament protein vs. UniProt/SwissProt
Match: sp|Q6QUW1|RGP51_LYMST (Retrograde protein of 51 kDa OS=Lymnaea stagnalis OX=6523 GN=RGP51 PE=1 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 9.673e-43
Identity = 124/383 (32.38%), Postives = 205/383 (53.52%), Query Frame = 2
Query:  461 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHD------TEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQS-------MRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSS 1570
            SG+T  K  R +EKR++Q+LNER ASYIEK  FL+AQ K+L  E E L+   V+D   I++ YE E+ Q R ++ +   S+   E ++  L+ EI  LR+ ++  E     Y+  ID     +  FEGEL  LR   G+   +  K +E ++ +++  ++LR D + E  AH+  +   Q+  E  EF + + D       E  ++  + Y D       +W+SE+ + +R+I   Y+ K+  I+Q+ ++ Y SQ+ ++++   +D ++  H +EE  +++ Q+Q        + +RIA L+ +  E    L +I    EE       Q L     +   + +LT  L +LQ L+DAK+ LELEIA Y KLLE EE+RV   +
Sbjct:   60 SGITDFKGNREKEKREMQNLNERLASYIEKVHFLDAQVKKLEAENEALRNRKVEDLQPIRDAYENELRQARKVIDELASSKGVAEGKLAGLQDEIGSLRELIVTYESQAKDYRKKIDSLGNQLGEFEGELQSLRLRVGSLEDENAKLRELLEKVQEQNRRLRADLDTETAAHIEADCLAQTKTEEAEFYRDLLDQLELLKPEPIQIKGMDYAD-------FWKSELAKCVREINLAYDEKIDLIQQDCEAKYASQINQLRSGNVKDGMQLQHSQEEVKKLRGQLQDKNAAYAELATRIASLQAERDELARQLADIERELEE-------QKLKYNRDVGDLESELTSVLAQLQHLMDAKMSLELEIACYKKLLEGEESRVGLRT 428          
BLAST of Intermediate filament protein vs. TrEMBL
Match: A0A5J6BTN2 (Intermediate filament b-like protein 1 (Fragment) OS=Minona ileanae OX=60013 PE=2 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 4.666e-84
Identity = 173/377 (45.89%), Postives = 261/377 (69.23%), Query Frame = 2
Query:  434 IRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNF 1564
            + G +  + +GV+++ + R +EK+D++DLNERFA+YIEK RFLEAQNK+L NE+  L+    ++  +IK++Y+VE+ QLR LL D+ KS+A LEV+V+SLE  +D+L+K+L     +++  +  ID+    +S  E EL  LRR   +  +D +++K EV+ LRD++++LR D ++E L H+  E E  SL++ +EF K++HD+E+KELA +AYRD T+EN  +W+SEM + LRDIQNEY+NKL  ++ E+++ Y  ++QE +T+ TR   E  H KEEN R+K Q+  +R RI +LE +NA+ E  L  +R + EE  R  EL+  +L++ L+  Q +L   L ELQ+LLDAKL LELEIAAY KLLE EE+R   
Sbjct:   76 VNGHTAGVHNGVSNIMENREKEKKDMRDLNERFANYIEKVRFLEAQNKKLANELATLRDRWGKETERIKQMYDVEMTQLRKLLDDAMKSKAELEVKVNSLEETVDELQKQLDAANQLHNSDREMIDRLNSQVSDQESELSVLRRRISSFESDHSRDKAEVQRLRDEIRRLRMDLDQETLNHINSEQEAHSLRDEIEFLKKVHDSELKELAALAYRDTTQENREFWRSEMSQCLRDIQNEYDNKLDVMQSEMETHYNLKIQESRTNNTRGGAELQHTKEENIRIKQQLSELRDRIPELEARNAQLERLLEELRRDNEEKLRDWELERSSLRKTLSDNQAELESVLVELQTLLDAKLSLELEIAAYRKLLEGEESRAGL 452          

HSP 2 Score: 88.5817 bits (218), Expect = 2.373e-14
Identity = 45/113 (39.82%), Postives = 66/113 (58.41%), Query Frame = 2
Query: 1913 FRRTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSS---GEKLTIWAXXXXXXXXXELEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQ 2242
            ++RT KGNISI E   +G F+ +EN G K E ++GM I RN+D     + FT  ++T L      + + +WA+G K     ++E  E+ WG G  I T L +++GEEKA H Q
Sbjct:  498 YQRTAKGNISIQECAPDGKFLTIENTGKKREDISGMRITRNVDNGRQIIRFTFPDKTFLEPEGRAKSIKVWARGLKPPGSSDMECNENTWGNGANIHTVLISSDGEEKATHTQ 610          
BLAST of Intermediate filament protein vs. TrEMBL
Match: A0A1I8JCN5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 2.902e-81
Identity = 165/367 (44.96%), Postives = 253/367 (68.94%), Query Frame = 2
Query:  461 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVN 1561
            +G+ +M  GR +EK+D+++LNERFASYIEK RFLEAQN++L  E++KL+    ++  K++ +YE E+ QLR LL D+++ +A +EV+V +LE +++++ + L     +++  + TIDK  + ++ ++GE+  LRR   +   +  +++ E+K LR D+ +LR D + E L H+  E+  QSL+E LEF + +HD+E+KEL+ +AYRD T EN  +W++EM +AL +IQ EY++KL  ++ E++S Y  ++QE +TS TRDN+E TH KEEN R+KSQI   R+RI +LE +NA+ E  + ++R   EET RS EL+   LQ  L+     L   L ELQ+L+DAKL LELEI AY KLLE EE R+N
Sbjct:   95 AGLNNMLTGREKEKKDMRELNERFASYIEKVRFLEAQNRKLSEELQKLRDSWGKETEKVRSLYETELAQLRKLLEDADQYKATMEVRVTTLEDQLNEMEQLLEEANRVHANDRDTIDKLNQQMADYDGEISLLRRRVASFDDERARDQAEIKRLRQDVARLRGDLDTETLNHINAENSAQSLREELEFLRALHDSELKELSALAYRDTTSENREFWKNEMAQALHEIQREYDSKLDVVRSEMESQYSIKVQEARTSNTRDNMELTHLKEENRRIKSQIGDARNRIPELEARNAQLEREIEDLRRELEETMRSSELEKNQLQADLSSCNATLAEYLRELQTLMDAKLSLELEIHAYRKLLEGEEIRIN 461          

HSP 2 Score: 91.2781 bits (225), Expect = 3.665e-15
Identity = 50/109 (45.87%), Postives = 68/109 (62.39%), Query Frame = 2
Query: 1919 RTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEK-LTIWAXXXXXXXXXELEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQ 2242
            RT+KG+I+I E D  G F+ LE  G K E L+  T+ RN+D  +  V +T    T + SG K + IWAKG++    K+LE+ +  WG+G  IVT L NA+GEEKA H Q
Sbjct:  522 RTSKGSITIQECDSEGKFVTLEFTGKKKEDLSDWTLVRNVDNEKLIVKYTFPKDTVMDSGNKTIKIWAKGQRPADSKDLEMNDQSWGMGSHIVTMLSNADGEEKATHTQ 630          
BLAST of Intermediate filament protein vs. TrEMBL
Match: A0A267DRI3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002432g2 PE=3 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 3.027e-81
Identity = 165/367 (44.96%), Postives = 253/367 (68.94%), Query Frame = 2
Query:  461 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVN 1561
            +G+ +M  GR +EK+D+++LNERFASYIEK RFLEAQN++L  E++KL+    ++  K++ +YE E+ QLR LL D+++ +A +EV+V +LE +++++ + L     +++  + TIDK  + ++ ++GE+  LRR   +   +  +++ E+K LR D+ +LR D + E L H+  E+  QSL+E LEF + +HD+E+KEL+ +AYRD T EN  +W++EM +AL +IQ EY++KL  ++ E++S Y  ++QE +TS TRDN+E TH KEEN R+KSQI   R+RI +LE +NA+ E  + ++R   EET RS EL+   LQ  L+     L   L ELQ+L+DAKL LELEI AY KLLE EE R+N
Sbjct:   95 AGLNNMLTGREKEKKDMRELNERFASYIEKVRFLEAQNRKLSEELQKLRDSWGKETEKVRSLYETELAQLRKLLEDADQYKATMEVRVTTLEDQLNEMEQLLEEANRVHANDRDTIDKLNQQMADYDGEISLLRRRVASFDDERARDQAEIKRLRQDVARLRGDLDTETLNHINAENSAQSLREELEFLRALHDSELKELSALAYRDTTSENREFWKNEMAQALHEIQREYDSKLDVVRSEMESQYSIKVQEARTSNTRDNMELTHLKEENRRIKSQIGDARNRIPELEARNAQLEREIEDLRRELEETMRSSELEKNQLQADLSSCNATLAEYLRELQTLMDAKLSLELEIHAYRKLLEGEEIRIN 461          

HSP 2 Score: 91.2781 bits (225), Expect = 3.763e-15
Identity = 50/109 (45.87%), Postives = 68/109 (62.39%), Query Frame = 2
Query: 1919 RTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEK-LTIWAXXXXXXXXXELEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQ 2242
            RT+KG+I+I E D  G F+ LE  G K E L+  T+ RN+D  +  V +T    T + SG K + IWAKG++    K+LE+ +  WG+G  IVT L NA+GEEKA H Q
Sbjct:  526 RTSKGSITIQECDSEGKFVTLEFTGKKKEDLSDWTLVRNVDNEKLIVKYTFPKDTVMDSGNKTIKIWAKGQRPADSKDLEMNDQSWGMGSHIVTMLSNADGEEKATHTQ 634          
BLAST of Intermediate filament protein vs. TrEMBL
Match: A0A267GZY0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002432g3 PE=3 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 3.525e-81
Identity = 165/367 (44.96%), Postives = 253/367 (68.94%), Query Frame = 2
Query:  461 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVN 1561
            +G+ +M  GR +EK+D+++LNERFASYIEK RFLEAQN++L  E++KL+    ++  K++ +YE E+ QLR LL D+++ +A +EV+V +LE +++++ + L     +++  + TIDK  + ++ ++GE+  LRR   +   +  +++ E+K LR D+ +LR D + E L H+  E+  QSL+E LEF + +HD+E+KEL+ +AYRD T EN  +W++EM +AL +IQ EY++KL  ++ E++S Y  ++QE +TS TRDN+E TH KEEN R+KSQI   R+RI +LE +NA+ E  + ++R   EET RS EL+   LQ  L+     L   L ELQ+L+DAKL LELEI AY KLLE EE R+N
Sbjct:   95 AGLNNMLTGREKEKKDMRELNERFASYIEKVRFLEAQNRKLSEELQKLRDSWGKETEKVRSLYETELAQLRKLLEDADQYKATMEVRVTTLEDQLNEMEQLLEEANRVHANDRDTIDKLNQQMADYDGEISLLRRRVASFDDERARDQAEIKRLRQDVARLRGDLDTETLNHINAENSAQSLREELEFLRALHDSELKELSALAYRDTTSENREFWKNEMAQALHEIQREYDSKLDVVRSEMESQYSIKVQEARTSNTRDNMELTHLKEENRRIKSQIGDARNRIPELEARNAQLEREIEDLRRELEETMRSSELEKNQLQADLSSCNATLAEYLRELQTLMDAKLSLELEIHAYRKLLEGEEIRIN 461          

HSP 2 Score: 90.5077 bits (223), Expect = 5.504e-15
Identity = 50/109 (45.87%), Postives = 68/109 (62.39%), Query Frame = 2
Query: 1919 RTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEK-LTIWAXXXXXXXXXELEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQ 2242
            RT+KG+I+I E D  G F+ LE  G K E L+  T+ RN+D  +  V +T    T + SG K + IWAKG++    K+LE+ +  WG+G  IVT L NA+GEEKA H Q
Sbjct:  525 RTSKGSITIQECDSEGKFVTLEFTGKKKEDLSDWTLVRNVDNEKLIVKYTFPKDTVMDSGNKTIKIWAKGQRPADSKDLEMNDQSWGMGSHIVTLLSNADGEEKATHTQ 633          
BLAST of Intermediate filament protein vs. TrEMBL
Match: A0A267DRG7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002432g1 PE=3 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 1.425e-80
Identity = 164/362 (45.30%), Postives = 249/362 (68.78%), Query Frame = 2
Query:  476 MKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVN 1561
            M  GR +EK+D+++LNERFASYIEK RFLEAQN++L  E++KL+    ++  K++ +YE E+ QLR LL D+++ +A +EV+V +LE +++++ + L     +++  + TIDK  + ++ ++GE+  LRR   +   +  +++ E+K LR D+ +LR D + E L H+  E+  QSL+E LEF + +HD+E+KEL+ +AYRD T EN  +W++EM +AL +IQ EY++KL  ++ E++S Y  ++QE +TS TRDN+E TH KEEN R+KSQI   R+RI +LE +NA+ E  + ++R   EET RS EL+   LQ  L+     L   L ELQ+L+DAKL LELEI AY KLLE EE R+N
Sbjct:    1 MLTGREKEKKDMRELNERFASYIEKVRFLEAQNRKLSEELQKLRDSWGKETEKVRSLYETELAQLRKLLEDADQYKATMEVRVTTLEDQLNEMEQLLEEANRVHANDRDTIDKLNQQMADYDGEISLLRRRVASFDDERARDQAEIKRLRQDVARLRGDLDTETLNHINAENSAQSLREELEFLRALHDSELKELSALAYRDTTSENREFWKNEMAQALHEIQREYDSKLDVVRSEMESQYSIKVQEARTSNTRDNMELTHLKEENRRIKSQIGDARNRIPELEARNAQLEREIEDLRRELEETMRSSELEKNQLQADLSSCNATLAEYLRELQTLMDAKLSLELEIHAYRKLLEGEEIRIN 362          

HSP 2 Score: 91.6633 bits (226), Expect = 1.850e-15
Identity = 50/109 (45.87%), Postives = 68/109 (62.39%), Query Frame = 2
Query: 1919 RTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEK-LTIWAXXXXXXXXXELEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQ 2242
            RT+KG+I+I E D  G F+ LE  G K E L+  T+ RN+D  +  V +T    T + SG K + IWAKG++    K+LE+ +  WG+G  IVT L NA+GEEKA H Q
Sbjct:  427 RTSKGSITIQECDSEGKFVTLEFTGKKKEDLSDWTLVRNVDNEKLIVKYTFPKDTVMDSGNKTIKIWAKGQRPADSKDLEMNDQSWGMGSHIVTMLSNADGEEKATHTQ 535          
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Match: vim (vimentin [Source:NCBI gene;Acc:103044141])

HSP 1 Score: 114.775 bits (286), Expect = 1.194e-26
Identity = 113/382 (29.58%), Postives = 190/382 (49.74%), Query Frame = 2
Query:  428 PLIRGDSVALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKG-GTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFS 1567
            P  R D  AL   + T  K  R  EK ++Q LN+RFASYIEK RFLE QNK L  E+E L+G GT    S++ ++YE E+ +LR  +      +A +EV+ D+L  +I  LR++L   E+I          QR+D                                 ++L   RQD +  +LA L LE +L+SL+E + F K++HD E+ EL    +    + +M   + ++  ALRD++++YE   T   QE +  Y S+  ++  +  R +      K++ +  + Q+ ++   +  L+  N   E  +  +  ++       +  ++ L++ +   + ++   L E Q LL+ K+ L++EIA Y KLLE EE+R+ F 
Sbjct:   65 PSPRLD-FALSDAINTEFKANRTNEKAEMQHLNDRFASYIEKVRFLEQQNKSLSAELELLRGKGT----SRVGDLYEEEMRELRLQVDQLIGDKARVEVERDNLGEDIQRLREKLQ--EEI---------IQREDAE-------------------------------NNLHGFRQDVDNASLARLDLERKLESLQEEIIFLKKLHDEEIAELQAQIHDQHVQIDMDVAKPDLTAALRDVRSQYETLATKNIQEAEDWYKSKFTDLSDAAARSSEAIRLAKQDANEYRRQVHALTCEVDALKGTNESLERQMRELEDSFGMESSGYQDTIVRLEDDIRNMKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRLCFP 399          
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Match: vim (vimentin [Source:NCBI gene;Acc:103044141])

HSP 1 Score: 112.849 bits (281), Expect = 5.421e-26
Identity = 112/379 (29.55%), Postives = 189/379 (49.87%), Query Frame = 2
Query:  428 PLIRGDSVALQSGV-TSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKG-GTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRV 1558
            P  R D  AL   + T  K  R  EK ++Q LN+RFASYIEK RFLE QNK L  E+E L+G GT    S++ ++YE E+ +LR  +      +A +EV+ D+L  +I  LR++L   E+I          QR+D                                 ++L   RQD +  +LA L LE +L+SL+E + F K++HD E+ EL    +    + +M   + ++  ALRD++++YE   T   QE +  Y S+  ++  +  R +      K++ +  + Q+ ++   +  L+  N   E  +  +  ++       +  ++ L++ +   + ++   L E Q LL+ K+ L++EIA Y KLLE EE+R+
Sbjct:   65 PSPRLD-FALSDAINTEFKANRTNEKAEMQHLNDRFASYIEKVRFLEQQNKSLSAELELLRGKGT----SRVGDLYEEEMRELRLQVDQLIGDKARVEVERDNLGEDIQRLREKLQ--EEI---------IQREDAE-------------------------------NNLHGFRQDVDNASLARLDLERKLESLQEEIIFLKKLHDEEIAELQAQIHDQHVQIDMDVAKPDLTAALRDVRSQYETLATKNIQEAEDWYKSKFTDLSDAAARSSEAIRLAKQDANEYRRQVHALTCEVDALKGTNESLERQMRELEDSFGMESSGYQDTIVRLEDDIRNMKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRI 396          
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Match: desmb (desmin [Source:NCBI gene;Acc:103039642])

HSP 1 Score: 110.923 bits (276), Expect = 2.555e-25
Identity = 106/361 (29.36%), Postives = 177/361 (49.03%), Query Frame = 2
Query:  488 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFS 1567
            R  EK +LQ LN+RFASYIEK RFLE QN+ LV E+E+L+G   ++ ++I ++YE E+ +LR  +      R+ +EV+ D+L    DDL+K  M L++  +Q +             E  L   R       ADV+       TL R DL++                  +++L+E + F K+IH+ E++EL         +  M   + ++  ALRDI+++YE        E +  Y S++ ++  + T++N      K E    + QIQS    I  L+  N      + ++   +       +  +  L+ ++   + ++   L E Q LL+ K+ L++EIA Y KLLE EE+R+   
Sbjct:  108 RTNEKAELQHLNDRFASYIEKVRFLEQQNQALVVEVERLRG---REPTRIADLYEEEMRELRRQVEVVTNQRSRVEVERDNL---ADDLQKLKMRLQEEIAQREEA-----------ENSLAAFR-------ADVD-----AATLARLDLER-----------------RIETLQEEIAFLKKIHEEEIRELQAQMQETQVQIQMDMSKPDLTGALRDIRSQYEAIAAKNIAEAEDWYKSKVSDLNQAVTKNNEALKQAKLETMEFRHQIQSYTCEIDSLKGTNESLMRQMRDMEDRHGREASGFQDTITRLEAEIANMKDEMARHLREYQDLLNIKMALDVEIATYRKLLEGEESRITLP 422          
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Match: desmb (desmin [Source:NCBI gene;Acc:103039642])

HSP 1 Score: 110.153 bits (274), Expect = 3.713e-25
Identity = 106/361 (29.36%), Postives = 177/361 (49.03%), Query Frame = 2
Query:  488 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFS 1567
            R  EK +LQ LN+RFASYIEK RFLE QN+ LV E+E+L+G   ++ ++I ++YE E+ +LR  +      R+ +EV+ D+L    DDL+K  M L++  +Q +             E  L   R       ADV+       TL R DL++                  +++L+E + F K+IH+ E++EL         +  M   + ++  ALRDI+++YE        E +  Y S++ ++  + T++N      K E    + QIQS    I  L+  N      + ++   +       +  +  L+ ++   + ++   L E Q LL+ K+ L++EIA Y KLLE EE+R+   
Sbjct:   85 RTNEKAELQHLNDRFASYIEKVRFLEQQNQALVVEVERLRG---REPTRIADLYEEEMRELRRQVEVVTNQRSRVEVERDNL---ADDLQKLKMRLQEEIAQREEA-----------ENSLAAFR-------ADVD-----AATLARLDLER-----------------RIETLQEEIAFLKKIHEEEIRELQAQMQETQVQIQMDMSKPDLTGALRDIRSQYEAIAAKNIAEAEDWYKSKVSDLNQAVTKNNEALKQAKLETMEFRHQIQSYTCEIDSLKGTNESLMRQMRDMEDRHGREASGFQDTITRLEAEIANMKDEMARHLREYQDLLNIKMALDVEIATYRKLLEGEESRITLP 399          
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Match: desma (desmin-like [Source:NCBI gene;Acc:103037132])

HSP 1 Score: 108.997 bits (271), Expect = 1.227e-24
Identity = 106/368 (28.80%), Postives = 179/368 (48.64%), Query Frame = 2
Query:  488 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRK-RLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGNTS 1585
            R  EK +LQ LN+RFASYIEK RFLE QN  LV E+++++G   ++ ++I E+YE E+ +LR  +      RA +EV+ D+L    DDL+K +L + E+I+ +     ++   ++S F               ADV+       TL R DL++                  ++SL+E + F K+IH+ E++EL         +  M   + ++  ALRDI+ +YE        E +  Y S++ ++  +  ++N      K E    + QIQS    I  L+  N   +  +  +           +  +  L+ ++   + ++   L E Q LL+ K+ L++EIA Y KLLE EE+R+       +S
Sbjct:   99 RTNEKAELQHLNDRFASYIEKVRFLEQQNAALVVELDRMRG---REPTRITEMYEEEMRELRRQVDAVTNQRARVEVERDNL---ADDLQKLKLRLQEEIHQK-----EEAENNLSAFR--------------ADVD-----AATLARLDLER-----------------RIESLQEEIAFLKKIHEEEIRELQNQMQETQVQVQMDMSKPDLTAALRDIRMQYEAIAAKNISEAEEWYKSKVSDLNQAVNKNNDALRQAKMETMEFRHQIQSYTCEIDSLKGTNESLKRQMREMEERMGGEAGGYQDTISRLEGEIAKMKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRITLPPQSFSS 419          
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Match: zgc:136930 (zgc:136930 [Source:ZFIN;Acc:ZDB-GENE-060312-16])

HSP 1 Score: 82.8037 bits (203), Expect = 8.746e-17
Identity = 98/374 (26.20%), Postives = 165/374 (44.12%), Query Frame = 2
Query:  464 GVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGT-VQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQ--TSKTRDNV-----ETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVN 1561
            G       R  EK  LQ LN+RF  Y+EK R L+ +N  L  ++  + GG  +  +  +   YEV+I +LRT +      +  LE+++D++    ++L+ +      +  Q +S I   +KDI     E     R   T              L D+L  L++ YE                +E   F+ ++  TEV    ++   D  K        ++   L  I++EYE   T  + E ++ Y S+++EIQ  TSKT + +     E     ++     S++Q++ S+   +E   A YE   ++  A+Y+         + +L+  +   + DL   L   QSLLD KL L+ EI+ Y  LLE E  R +
Sbjct:  175 GTIPPMASREAEKSTLQFLNDRFGGYVEKVRLLQRENAALEAQLASITGGAPLSPDGGVTVNYEVQITELRTTIETLILDKVNLEIELDNIRATAEELKAKFEFEAGVRYQLESDISLMKKDI-----EFATDTRVNLTT---------RYTALTDELTFLKKTYE----------------EEFATFQTRLGTTEVSS-GSIIEVDTIK------SFDLMSTLSQIRSEYEVVATRNRAEAEAYYHSRIEEIQAVTSKTTEAINFAKTEIVSVTKDIQMHYSELQTLLSQSYSMEQAVASYEARASSEVASYQ-------SSVASLEVAIETARMDLQRQLLAYQSLLDVKLQLDAEISTYRNLLEGEAARCS 504          
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 83.1889 bits (204), Expect = 8.994e-17
Identity = 102/408 (25.00%), Postives = 197/408 (48.28%), Query Frame = 2
Query:  449 VALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSK----------IKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKL-------RQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVY---------WQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTI-------TLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSD 1573
            + ++S ++  +  R QEK  L +LN+R A+YIE+ R LE    +L+  +   +    +   K          ++  Y+ E+ ++R  L D+  ++A LE+Q+   + E D+ R R        S+Y+   +     I   E +L        T   D    + EV  LR+ + +L       +Q  E+E LA + LE+ + +L+E LEF K+IH+ E+ E  +       +E  V          ++ ++  AL +++ ++E ++   +QELD +  ++L++   +  + +++ +        ++  ++   SR+  L  Q +  +H+L  ++    E + +L  +    + +L  + ++L          L E + LLD KL L++EIAAY KLLE EE+R+N S +
Sbjct:    3 IEMKSLLSPTRVTRLQEKESLVELNDRLAAYIERVRSLEVDKARLLARVSMWEEEEEEQRQKSERQREATGGLRAAYDAELAEVRRALDDALGAKAALEIQLRLAQVERDEGRSRC-------SKYEQEWNVALGRIRDMEVQLCAKEASLSTASGDKEYLETEVDDLRNQVNQLEGVLVSSKQQLEEETLARVDLENRMLTLQEELEFTKRIHEQEIHESRS------KRETHVLEIDGGQQQAFEYKLSEALTELRQQHEEQVQLYRQELDQTMRAKLEKSILTPEKQSLDIS--------IREDLREATSRVGTLSSQLSAAQHDLALLQGRVRELEETLSHERDQSKRRLDESDRELAELREVMDEQLIEYEQLLDIKLALDMEIAAYRKLLEGEESRLNLSPE 389          

HSP 2 Score: 65.0846 bits (157), Expect = 3.897e-11
Identity = 35/107 (32.71%), Postives = 57/107 (53.27%), Query Frame = 2
Query: 1922 TTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEI---EEDGWGLGDTIVTSLYNAEGEEKAV 2233
            +  G+I I E D+ G  + + NN  K + L G  +KR I+ ++  +++   +R  L +G+ +TIWA           ++    +  WG GD I TSL N++GEE AV
Sbjct:  438 SASGSIGIKEVDMEGKSVTMVNNSEKDQPLGGWVLKRQIE-DQAEIAYKFSSRYVLKAGQTVTIWAANAGVSHNPPSDLLWKTQSSWGTGDDIRTSLLNSDGEEVAV 543          
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Match: desmb (desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102])

HSP 1 Score: 81.2629 bits (199), Expect = 1.310e-16
Identity = 93/358 (25.98%), Postives = 167/358 (46.65%), Query Frame = 2
Query:  488 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTK-ENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRV 1558
            R  EK +LQ+LN+RFA+YI+K R+LE QNK L+ E+  LKG   ++ +++  +YE E+ +LR  +      +A  +V+  +L  E+  L++RL        + +  +   R+D+                         ++    R DL++                 +++SL+E + F K+IHD E++E+           E  V  + ++  ALRDI+ EYE        E +  Y S+  ++  +  R+N      K+E    + Q+Q+ +  I  L+  N   E  +  +   +     + +  +  L++ +   + ++   L + Q LL  K+ L++EIA Y KLLE EE RV
Sbjct:   85 RTNEKVELQELNDRFANYIDKVRYLEQQNKALLAELALLKG---REPTRVGPLYEQELRELRAQVERLTGEKARGDVERANLLDELQRLQQRLQEETAAREEAEKNLQAFRQDV-------------------------DDATLARVDLER-----------------KVESLQEEIAFLKKIHDEELREVQVQVQEQTVHVEYDVGTKPDLTAALRDIRAEYEGIAAKNVAEAEEWYKSKFLDLSEAAVRNNEALRAAKQELMDYRRQVQAQQCDIDSLKGANESLERQIREMEERFSVESANYQDTITRLEDDIGNLKDEMARHLRDYQELLHVKMALDIEIATYRKLLEGEETRV 397          
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010102.1 (pep scaffold:Pmarinus_7.0:GL478364:74479:82531:1 gene:ENSPMAG00000009106.1 transcript:ENSPMAT00000010102.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 1.386e-16
Identity = 98/362 (27.07%), Postives = 169/362 (46.69%), Query Frame = 2
Query:  488 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRL----MMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVK--TLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENR 1555
            R QEK  ++ LN+RFA++I+K RFLE QNK L  +   L+  T   +S I E++E  IN LR               Q+D L ++   L   L     ++ED  ++Y++ I+ +    +  EGE V ++  K   GA ++K + E +   L D++  LR  +                 +E  E E QI  T V  L  +        N+     ++   + D++ +YE      + E D+ Y  + Q + +   R++ E    + E + +  Q+Q  R+ +  L+ Q A+ E  +       E   R  +  +  L+E++   +Q++   + E Q L++ KL L++EI  Y KLLE EE+R
Sbjct:  137 RTQEKEAIKHLNDRFANFIDKVRFLEQQNKVLEAQWYALQEKTTTGSS-IDEMFEAYINGLRR--------------QLDGLGHDKGQLNGNLGQMQAVVEDFRAKYEAEINNR----NAAEGEFVVVK--KDVDGAYLSKVELETRLQGLVDEINFLRSIFT----------------QELSELEAQIKHTNV--LVEI----DNSRNL-----DVDGIIADVRQQYETIAARSRAEADAFYQDKFQSLHSDSGRNDEELRMTRNEITELNRQMQRFRAEMEALKKQRAKLESAIAEAEGRGEADIREAKAAIAQLEEEIHKAKQEMARHVREYQELMNVKLALDIEIVTYRKLLEGEESR 450          
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010061.1 (pep scaffold:Pmarinus_7.0:GL478364:48285:55057:1 gene:ENSPMAG00000009104.1 transcript:ENSPMAT00000010061.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 5.317e-15
Identity = 99/369 (26.83%), Postives = 171/369 (46.34%), Query Frame = 2
Query:  473 SMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYE----IDDLRKRLMMLEDINSQYKSTID--KQRKDISGFEGELVELRRFKGTQGADVNKEKEEVK--TLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENR 1555
            S+   R QEK  ++ LN+RFA++I+K RFLE QNK L  +   L+  T    S + E++E  IN LR               Q+D L +E      DL +   ++ED  ++Y++ I    +R+D      E V  +  K   GA ++K + E K   L++D+  +R  +                 +E  E E QI  T V  L  +        N+     ++   + D++++YE      + E D+ Y  + Q + +   R++ E    + E + +  Q+Q  R+ +  L+ Q A+ E  +       E   R  +  +  L+E++   +Q++   + E Q L++ KL L++EI  Y KLLE EE+R
Sbjct:  130 SVLPTRTQEKEAIKHLNDRFANFIDKVRFLEQQNKVLEAQWYALQEKTTT-GSSVDEMFEAYINGLRR--------------QLDGLGHENGRANGDLGQMQAVVEDFRAKYEAEISLRTERED------EFVFAK--KDVDGAYLSKVELEAKLDGLQEDINFMRSIFA----------------QELSELEAQIKHTNV--LVEI----DNSRNL-----DVDGIIADVRHQYETIAARSRAEADAFYQDKFQSLHSDSGRNDEELRVTRNEITELNRQMQRFRAEMEALKKQRAKLESAIAEAEGRGEADIREAKAAIAQLEEEIHKAKQEMARHVREYQELMNVKLALDIEIVTYRKLLEGEESR 448          
BLAST of Intermediate filament protein vs. Ensembl Nematostella
Match: EDO37225 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD1])

HSP 1 Score: 91.6633 bits (226), Expect = 3.174e-19
Identity = 107/403 (26.55%), Postives = 195/403 (48.39%), Query Frame = 2
Query:  461 SGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQV-----DSLEY----------------EIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMV------YWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQN---AEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGN 1579
            S   S K  RAQEK +LQ LN+R A+YI++ + LE +N +L +E+   +    ++   +K +YE E+   R LL ++ K +A  +++      D+ E+                E++D+RK   +L D  +Q    + ++ ++    E  L EL      QG        E + L+D LK  +   E+E L  + LE+  QSL+E   F+KQ++D E+ ++ +      TK  +V       ++  M   L++++ +Y++     K+E +  Y S+ +E++  + RD+      +EEN  +   +  + S++  LE +N        +L  +RA  +E   +  L   N   +L  +  D    L + + L+  K+ L++EI AY KLLE EE R+  +   +
Sbjct:   28 SPPGSAKFTRAQEKAELQHLNDRLATYIDRVKNLEQENSKLRSEVTVSRKTVEREVDSMKSLYETELADARRLLDETAKEKAKQQIESSKNSNDAQEFKNKFDKEAAARKKAEKELNDVRK---LLHDKENQ----LTRRNQEALNLESVLREL------QG--------ECEELKDALKAAKYALEQETLTRVDLENRCQSLQEEQNFKKQMYDKELSDIRSQLKTVETKRVVVETDYKDKYEGLMAEKLQELREDYDSDARSFKEETELLYSSKFEELRIQRERDSEALAKLREENRNLSKSVDELSSQVHQLEAKNNALVSRVSDLQGLRAQDKEKHDNEILLRENEIAELRTSIDD---ALRDYEDLMGVKVALDMEITAYRKLLESEETRLEITPPAS 406          

HSP 2 Score: 57.7658 bits (138), Expect = 1.168e-8
Identity = 35/108 (32.41%), Postives = 53/108 (49.07%), Query Frame = 2
Query: 1931 GNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEI---EEDGWGLGDTIVTSLYNAEGEEKAVHYQE 2245
            G I   EAD +G +I + N+G K E+L G TI+R + G ED   +    +  L S   +T+W+           ++   +   WG G+   T+L NA GEE A   +E
Sbjct:  442 GAIQFTEADPDGKYIKIYNSGEKDEALGGWTIQRQV-GTEDPSVYKFTPKYVLKSQSHVTVWSAQGGGTHKPPSDLVFKQLPSWGSGNEARTALVNAGGEEMATLLEE 548          
BLAST of Intermediate filament protein vs. Ensembl Medaka
Match: viml (vimentin [Source:NCBI gene;Acc:101163931])

HSP 1 Score: 115.931 bits (289), Expect = 5.671e-27
Identity = 116/385 (30.13%), Postives = 194/385 (50.39%), Query Frame = 2
Query:  425 IPLIRGDSV--ALQSGVTS-MKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKG-GTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKEL--ATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVN 1561
            +P +  +S+  +L   V S     R  EK  +Q LN+RFASYIEK RFLE QNK L+ E+E+L+G GT    S+I ++YE E+ +LR  +      +A +EV  D+L  +I+ LR++L                 R +IS                      ++EE +     ++  RQD +  ALA L LE +++SL+E + F K++HD E+ E        +   + +M   + ++  ALRD++ +YEN  T   QE +  Y S+  ++  +  R+N      K+E +  + Q+Q++   +  L+  N   E  L  +  N+       +  +  L+E +   + ++   L E Q LL+ K+ L++EIA Y KLLE EE+R++
Sbjct:   63 MPRLASESLDFSLHDAVNSEFLTNRTNEKAQMQSLNDRFASYIEKVRFLEQQNKILLAELEQLRGKGT----SRIGDLYEDEMRELRRQVDQLTNEKARVEVHRDNLADDIERLREKL-----------------RDEIS----------------------QREEAEAT---MQSFRQDVDSAALARLDLERKIESLQEEINFLKKLHDEEMLEFQSQVQQQQQHVQVDMDVAKPDLTAALRDVRLQYENLATKNIQESEEWYKSKFADLTEAAARNNEALRMAKQEANDYRRQVQALTCEVDALKGTNESLERQLREMEENFSLESNGYQDTIGRLEEDMHNIKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRIS 401          
BLAST of Intermediate filament protein vs. Ensembl Medaka
Match: viml (vimentin [Source:NCBI gene;Acc:101163931])

HSP 1 Score: 114.39 bits (285), Expect = 1.452e-26
Identity = 116/383 (30.29%), Postives = 192/383 (50.13%), Query Frame = 2
Query:  425 IPLIRGDSV--ALQSGVTS-MKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKG-GTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKEL--ATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENR 1555
            +P +  +S+  +L   V S     R  EK  +Q LN+RFASYIEK RFLE QNK L+ E+E+L+G GT    S+I ++YE E+ +LR  +      +A +EV  D+L  +I+ LR++L                 R +IS                      ++EE +     ++  RQD +  ALA L LE +++SL+E + F K++HD E+ E        +   + +M   + ++  ALRD++ +YEN  T   QE +  Y S+  ++  +  R+N      K+E +  + Q+Q++   +  L+  N   E  L  +  N+       +  +  L+E +   + ++   L E Q LL+ K+ L++EIA Y KLLE EE+R
Sbjct:   63 MPRLASESLDFSLHDAVNSEFLTNRTNEKAQMQSLNDRFASYIEKVRFLEQQNKILLAELEQLRGKGT----SRIGDLYEDEMRELRRQVDQLTNEKARVEVHRDNLADDIERLREKL-----------------RDEIS----------------------QREEAEAT---MQSFRQDVDSAALARLDLERKIESLQEEINFLKKLHDEEMLEFQSQVQQQQQHVQVDMDVAKPDLTAALRDVRLQYENLATKNIQESEEWYKSKFADLTEAAARNNEALRMAKQEANDYRRQVQALTCEVDALKGTNESLERQLREMEENFSLESNGYQDTIGRLEEDMHNIKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESR 399          
BLAST of Intermediate filament protein vs. Ensembl Medaka
Match: gfap (glial fibrillary acidic protein [Source:NCBI gene;Acc:101173548])

HSP 1 Score: 107.842 bits (268), Expect = 2.103e-24
Identity = 101/363 (27.82%), Postives = 179/363 (49.31%), Query Frame = 2
Query:  479 KKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFS 1567
            K+ R  EK ++  LN+RFASYIEK R LE QNK LV E+ +L+G   ++ S++ +IY+ E+ +LR  + +    +A LE++ D+L  ++  L++RL                                     Q   V +++ E     ++L   RQD ++ +L+ + LE +++SL++ + F K+IH+ E++E            ++   + ++  ALRDI+ +YEN  T   QE +  Y S+  ++  +  R+       K+E +  + QIQ +   +  L   N   E  L  +           +  +  L+E++   ++++   L E Q LL+ KL L++EIA Y KLLE EE+R+   
Sbjct:   80 KETRTNEKMEMMGLNDRFASYIEKVRMLEQQNKVLVAELNQLRG---KEPSRLGDIYQDELRELRRQVDNLTTGKARLEIERDNLAADLATLKQRL-------------------------------------QDEIVQRQEAE-----NNLNAFRQDVDEASLSRVQLERKIESLQDEINFLKKIHEEELRESQEKVLAQQVHVDLDVSKPDLTAALRDIRLQYENLATSNMQETEEWYRSKFADLTDAANRNGEALRQAKQEANEYRRQIQVLTCDLDALRGTNESLERQLREMEDRCAMETAGYQDTVSRLEEEIQALKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEESRITIP 397          
BLAST of Intermediate filament protein vs. Ensembl Medaka
Match: gfap (glial fibrillary acidic protein [Source:NCBI gene;Acc:101173548])

HSP 1 Score: 107.457 bits (267), Expect = 2.965e-24
Identity = 101/363 (27.82%), Postives = 179/363 (49.31%), Query Frame = 2
Query:  479 KKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFS 1567
            K+ R  EK ++  LN+RFASYIEK R LE QNK LV E+ +L+G   ++ S++ +IY+ E+ +LR  + +    +A LE++ D+L  ++  L++RL                                     Q   V +++ E     ++L   RQD ++ +L+ + LE +++SL++ + F K+IH+ E++E            ++   + ++  ALRDI+ +YEN  T   QE +  Y S+  ++  +  R+       K+E +  + QIQ +   +  L   N   E  L  +           +  +  L+E++   ++++   L E Q LL+ KL L++EIA Y KLLE EE+R+   
Sbjct:   80 KETRTNEKMEMMGLNDRFASYIEKVRMLEQQNKVLVAELNQLRG---KEPSRLGDIYQDELRELRRQVDNLTTGKARLEIERDNLAADLATLKQRL-------------------------------------QDEIVQRQEAE-----NNLNAFRQDVDEASLSRVQLERKIESLQDEINFLKKIHEEELRESQEKVLAQQVHVDLDVSKPDLTAALRDIRLQYENLATSNMQETEEWYRSKFADLTDAANRNGEALRQAKQEANEYRRQIQVLTCDLDALRGTNESLERQLREMEDRCAMETAGYQDTVSRLEEEIQALKEEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEESRITIP 397          
BLAST of Intermediate filament protein vs. Ensembl Medaka
Match: desmb (desmin [Source:NCBI gene;Acc:101174730])

HSP 1 Score: 106.686 bits (265), Expect = 6.956e-24
Identity = 103/360 (28.61%), Postives = 178/360 (49.44%), Query Frame = 2
Query:  488 RAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTL-RDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNF 1564
            R  EK +LQ LN+RFASYIEK RFLE QN+ L  E+E+L+G   ++ ++I ++YE E+ +LR  +      R+ +EV+ D+L  ++D L+ RL   E+I          Q++D    E  L   R       ADV+       TL R DL++                  +++L+E + F K+IH+ E++EL T       +  M   + ++  ALRDI+ +YE        + +  Y S++ ++  + +++N      ++E    + QIQ+    I  L+  N      +  +   +       +  +  L+ ++   + ++   L E Q LL+ K+ L++EIA Y KLLE EE+R+  
Sbjct:  104 RTNEKAELQHLNDRFASYIEKVRFLEQQNQALSVEVERLRG---REPTRIADLYEEEMRELRRQVEILTNQRSRVEVERDNLAEDLDKLKLRLQ--EEI---------LQKEDA---ENNLAAFR-------ADVD-----AATLARLDLER-----------------RIETLQEEIAFLKKIHEEEIRELQTQMQETQVQIQMDMSKPDLTAALRDIRTQYEGIAAKNIADAEDWYKSKVSDLNQAVSKNNEALKQARQETMEFRHQIQAYTCEIDSLKGTNESLMRQMRELEDRHGCEAARFQDTIARLEAEIANMKDEMARHLREYQDLLNIKMALDVEIATYRKLLEGEESRITM 417          
BLAST of Intermediate filament protein vs. Planmine SMEST
Match: SMESG000030598.1 (SMESG000030598.1)

HSP 1 Score: 741.11 bits (1912), Expect = 0.000e+0
Identity = 496/521 (95.20%), Postives = 510/521 (97.89%), Query Frame = 2
Query:   35 MLAIEMETSKKIAVKTTKQEVSGSGSSGGLNEQQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITTSRSYYKPISQPRNNLKDLQKTSGMXXXXXXXXXXXXXNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGNT--SQF 1591
            MLAIEMETSKKIAVKTTKQEVSGSGSSGGLNEQQ FGSGSFRTGSGGVQISASGAIGSSSSGGVSGTGGVGSIGGGSGAGGEGTGASTVITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGSSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQL NEIEKLKGGTVQDNSKIKEIYEVEINQLR L+++SEKS+APLE QVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQ EYENKLTGIKQEL++SYG Q+QEI+TSKTRDNVETTHYKEENSR+KSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLL LQEQLTGTQQ+LT+ LTELQSLLDAKLGLELEIAAY+KLLEFEE+RVNFS+DGN   SQF
Sbjct:    1 MLAIEMETSKKIAVKTTKQEVSGSGSSGGLNEQQVFGSGSFRTGSGGVQISASGAIGSSSSGGVSGTGGVGSIGGGSGAGGEGTGASTVITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGSSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSADGNATLSQF 521          

HSP 2 Score: 146.747 bits (369), Expect = 2.541e-36
Identity = 75/127 (59.06%), Postives = 102/127 (80.31%), Query Frame = 2
Query: 1868 LSSTEAEEYQLKRMKFRRTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQEI 2248
            ++  E  +YQ KRMKFRRTTKGNISIAE D+ G  I+LEN GTK ESL GMTIKR +DG+E+ +SFTI  + +L++GEK+++ AKGK TGKG+E+EI++  WG+G+ +VT+L ++EG EKA HYQE+
Sbjct:  553 MTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEV 679          
BLAST of Intermediate filament protein vs. Planmine SMEST
Match: SMESG000030598.1 (SMESG000030598.1)

HSP 1 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 496/521 (95.20%), Postives = 510/521 (97.89%), Query Frame = 2
Query:   35 MLAIEMETSKKIAVKTTKQEVSGSGSSGGLNEQQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITTSRSYYKPISQPRNNLKDLQKTSGMXXXXXXXXXXXXXNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGNT--SQF 1591
            MLAIEMETSKKIAVKTTKQEVSGSGSSGGLNEQQ FGSGSFRTGSGGVQISASGAIGSSSSGGVSGTGGVGSIGGGSGAGGEGTGASTVITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGSSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQL NEIEKLKGGTVQDNSKIKEIYEVEINQLR L+++SEKS+APLE QVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQ EYENKLTGIKQEL++SYG Q+QEI+TSKTRDNVETTHYKEENSR+KSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLL LQEQLTGTQQ+LT+ LTELQSLLDAKLGLELEIAAY+KLLEFEE+RVNFS+DGN   SQF
Sbjct:    1 MLAIEMETSKKIAVKTTKQEVSGSGSSGGLNEQQVFGSGSFRTGSGGVQISASGAIGSSSSGGVSGTGGVGSIGGGSGAGGEGTGASTVITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGSSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSADGNATLSQF 521          

HSP 2 Score: 146.747 bits (369), Expect = 2.653e-36
Identity = 75/127 (59.06%), Postives = 102/127 (80.31%), Query Frame = 2
Query: 1868 LSSTEAEEYQLKRMKFRRTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQEI 2248
            ++  E  +YQ KRMKFRRTTKGNISIAE D+ G  I+LEN GTK ESL GMTIKR +DG+E+ +SFTI  + +L++GEK+++ AKGK TGKG+E+EI++  WG+G+ +VT+L ++EG EKA HYQE+
Sbjct:  554 MTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEV 680          
BLAST of Intermediate filament protein vs. Planmine SMEST
Match: SMESG000030598.1 (SMESG000030598.1)

HSP 1 Score: 730.324 bits (1884), Expect = 0.000e+0
Identity = 491/516 (95.16%), Postives = 505/516 (97.87%), Query Frame = 2
Query:   50 METSKKIAVKTTKQEVSGSGSSGGLNEQQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITTSRSYYKPISQPRNNLKDLQKTSGMXXXXXXXXXXXXXNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGNT--SQF 1591
            METSKKIAVKTTKQEVSGSGSSGGLNEQQ FGSGSFRTGSGGVQISASGAIGSSSSGGVSGTGGVGSIGGGSGAGGEGTGASTVITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGSSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQL NEIEKLKGGTVQDNSKIKEIYEVEINQLR L+++SEKS+APLE QVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQ EYENKLTGIKQEL++SYG Q+QEI+TSKTRDNVETTHYKEENSR+KSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLL LQEQLTGTQQ+LT+ LTELQSLLDAKLGLELEIAAY+KLLEFEE+RVNFS+DGN   SQF
Sbjct:    1 METSKKIAVKTTKQEVSGSGSSGGLNEQQVFGSGSFRTGSGGVQISASGAIGSSSSGGVSGTGGVGSIGGGSGAGGEGTGASTVITTSRSYYKPISQPRNNLKDLQKTSGMSYSAQSNSQQGSSNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRVNFSADGNATLSQF 516          

HSP 2 Score: 146.747 bits (369), Expect = 2.582e-36
Identity = 75/127 (59.06%), Postives = 102/127 (80.31%), Query Frame = 2
Query: 1868 LSSTEAEEYQLKRMKFRRTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQEI 2248
            ++  E  +YQ KRMKFRRTTKGNISIAE D+ G  I+LEN GTK ESL GMTIKR +DG+E+ +SFTI  + +L++GEK+++ AKGK TGKG+E+EI++  WG+G+ +VT+L ++EG EKA HYQE+
Sbjct:  550 MTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAHYQEV 676          
BLAST of Intermediate filament protein vs. Planmine SMEST
Match: SMESG000030596.1 (SMESG000030596.1)

HSP 1 Score: 635.18 bits (1637), Expect = 0.000e+0
Identity = 358/432 (82.87%), Postives = 390/432 (90.28%), Query Frame = 2
Query:  302 ITTSRSYYKPISQPRNNLKDLQKTSGMXXXXXXXXXXXXXNIPLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGNT--SQF 1591
            +TT+ SY KPISQPRN+L+DLQKT+           + S N+ LIRGDSVALQSGVTSMKKGRAQEKR+LQ+LNERFASYIEKARFLEAQNKQL NEIEKLKGGTVQDNSKIKEIYEVEINQLR L+++SEKS+APLE QVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQR DI+ FEGELVEL+RFKGTQGADV  EKEEVK+L+D LKKLRQDYE+EALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMV+WQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQ+QEIQTSKTRDNVETTHYKEENSRVKSQIQSMR RIA+LE QNAEYE NL NIR NYEETQR+L+ QL ++Q+QL+GTQQ+LT   TELQSLLDAKLGLELEIAAY++LLE EE RV  S+D  +  SQF
Sbjct:   49 VTTNHSYIKPISQPRNSLRDLQKTT-----------ENSQNM-LIRGDSVALQSGVTSMKKGRAQEKRNLQELNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRNDIAAFEGELVELKRFKGTQGADVTLEKEEVKSLKDSLKKLRQDYEREALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVFWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQMQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRMRIAELERQNAEYEINLKNIRDNYEETQRNLQSQLFSMQDQLSGTQQELTAASTELQSLLDAKLGLELEIAAYARLLEIEEERVLSSADQRSVMSQF 468          

HSP 2 Score: 134.42 bits (337), Expect = 2.154e-32
Identity = 72/116 (62.07%), Postives = 92/116 (79.31%), Query Frame = 2
Query: 1901 KRMKFRRTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQEI 2248
            K+M  RRTT GNISIAE+D +GLFIVLEN G++ +SL+GM IKRNIDG  + V+++I  +  LS+GE++TI   GKKTGKGKELEIEED WG G+ ++T+L +A GEEKA  YQEI
Sbjct:  535 KKMSSRRTTTGNISIAESDESGLFIVLENMGSQTQSLSGMMIKRNIDGVANFVTYSIPKKIDLSAGERITICGHGKKTGKGKELEIEEDSWGFGENVITALCDANGEEKAALYQEI 650          
BLAST of Intermediate filament protein vs. Planmine SMEST
Match: SMESG000030599.1 (SMESG000030599.1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 342/431 (79.35%), Postives = 392/431 (90.95%), Query Frame = 2
Query:  302 ITTSRSYYKPISQPRNNLKDLQKTSGMXXXXXXXXXXXXXNI-PLIRGDSVALQSGVTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSKIKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYXXXXXXXXXXXXXXQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKTRDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEEXXXXXXXXXXXXXXXXXXXXXDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGNTSQF 1591
            ++T+RS YKPISQ RNN KDLQ+ +     +  +  Q S ++ PLIRGDSVALQ+G+ S+KKGRAQEK+DLQ+LNERFASYIEKARFLE QNKQLV EIE+LKGGT+QD SK+KEIYEVEINQLR+LL++SEKSRAPLE+QV+SLEYEI DL+KRL++LEDI +QY++TIDKQR+++  FEGE+VEL+RFK T+  D  KEK+E   LRD++KKLRQ+YEKEALAH+TLEH+LQSL+E +EFEKQIH TEVKELATVAY++PTKENMVYWQSEMGRALRDIQ EYENKL+GIKQEL++SY  Q+QEI+TSKTRDNVETT YKEENSR+KSQIQSMRSRI DLEMQNAEYEHNLNNIRANYEETQRSLELQLLNLQEQLTGTQQDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGNTSQF
Sbjct:  103 VSTTRSMYKPISQSRNNFKDLQRNAASLSYSMQSGNQQSGSVMPLIRGDSVALQTGLNSIKKGRAQEKKDLQELNERFASYIEKARFLEEQNKQLVGEIEELKGGTIQDTSKVKEIYEVEINQLRSLLNESEKSRAPLEIQVNSLEYEIGDLQKRLLLLEDIGTQYRATIDKQRRELETFEGEMVELKRFKDTRSIDATKEKDETSNLRDEIKKLRQNYEKEALAHITLEHDLQSLRETMEFEKQIHATEVKELATVAYQNPTKENMVYWQSEMGRALRDIQTEYENKLSGIKQELEASYSLQMQEIRTSKTRDNVETTQYKEENSRIKSQIQSMRSRITDLEMQNAEYEHNLNNIRANYEETQRSLELQLLNLQEQLTGTQQDLTITLTELQSLLDAKLGLELEIAAYSKLLEFEENRVNFSSDGNTSQF 533          

HSP 2 Score: 261.536 bits (667), Expect = 7.226e-76
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 2
Query: 1847 LRFNINELSSTEAEEYQLKRMKFRRTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAXXXXXXXXXELEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQEIQG 2254
            LRFNINELSSTEAEEYQLKRMKFRRTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAKGKKTGKGKELEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQEIQG
Sbjct:  619 LRFNINELSSTEAEEYQLKRMKFRRTTKGNISIAEADINGLFIVLENNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAKGKKTGKGKELEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQEIQG 754          
The following BLAST results are available for this feature:
BLAST of Intermediate filament protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VIM9.237e-2929.52vimentin [Source:HGNC Symbol;Acc:HGNC:12692][more]
VIM1.689e-2829.52vimentin [Source:HGNC Symbol;Acc:HGNC:12692][more]
VIM1.689e-2829.52vimentin [Source:HGNC Symbol;Acc:HGNC:12692][more]
GFAP1.141e-2327.42glial fibrillary acidic protein [Source:HGNC Symbo... [more]
GFAP1.217e-2326.61glial fibrillary acidic protein [Source:HGNC Symbo... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ifa-14.782e-5133.88Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-15.168e-5133.88Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-16.922e-5133.88Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-16.922e-5133.88Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-16.922e-5133.88Intermediate filament protein ifa-1 [Source:UniPr... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lam1.825e-2727.55gene:FBgn0002525 transcript:FBtr0346460[more]
Lam1.825e-2727.55gene:FBgn0002525 transcript:FBtr0307059[more]
Lam1.825e-2727.55gene:FBgn0002525 transcript:FBtr0307058[more]
Lam1.825e-2727.55gene:FBgn0002525 transcript:FBtr0079100[more]
LamC1.054e-2427.81gene:FBgn0010397 transcript:FBtr0087512[more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
viml8.400e-2831.56vimentin like [Source:ZFIN;Acc:ZDB-GENE-040426-174... [more]
vim2.863e-2628.24vimentin [Source:ZFIN;Acc:ZDB-GENE-011212-3][more]
desma2.429e-2428.25desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221][more]
desma2.734e-2428.25desmin a [Source:ZFIN;Acc:ZDB-GENE-980526-221][more]
lmnb27.720e-2326.12lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vim9.821e-2929.64vimentin [Source:NCBI gene;Acc:496727][more]
vim1.124e-2829.64vimentin [Source:NCBI gene;Acc:496727][more]
vim1.171e-2829.73vimentin [Source:NCBI gene;Acc:496727][more]
rnasek1.560e-2327.59ribonuclease K [Source:Xenbase;Acc:XB-GENE-6046202... [more]
rnasek2.875e-2327.62ribonuclease K [Source:Xenbase;Acc:XB-GENE-6046202... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vim3.468e-2929.20vimentin [Source:MGI Symbol;Acc:MGI:98932][more]
Vim8.803e-2929.20vimentin [Source:MGI Symbol;Acc:MGI:98932][more]
Gfap2.780e-2426.88glial fibrillary acidic protein [Source:MGI Symbol... [more]
Gfap3.992e-2427.69glial fibrillary acidic protein [Source:MGI Symbol... [more]
Des5.651e-2328.89desmin [Source:MGI Symbol;Acc:MGI:94885][more]
back to top
BLAST of Intermediate filament protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01240|NF60_DORPE4.614e-6840.4360 kDa neurofilament protein OS=Doryteuthis pealei... [more]
sp|Q01241|NF70_DORPE5.077e-6740.4370 kDa neurofilament protein OS=Doryteuthis pealei... [more]
sp|P90901|IFA1_CAEEL6.574e-5033.88Intermediate filament protein ifa-1 OS=Caenorhabdi... [more]
sp|P90900|IFA4_CAEEL2.972e-4531.88Intermediate filament protein ifa-4 OS=Caenorhabdi... [more]
sp|Q6QUW1|RGP51_LYMST9.673e-4332.38Retrograde protein of 51 kDa OS=Lymnaea stagnalis ... [more]
back to top
BLAST of Intermediate filament protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J6BTN24.666e-8445.89Intermediate filament b-like protein 1 (Fragment) ... [more]
A0A1I8JCN52.902e-8144.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DRI33.027e-8144.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GZY03.525e-8144.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DRG71.425e-8045.30Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vim1.194e-2629.58vimentin [Source:NCBI gene;Acc:103044141][more]
vim5.421e-2629.55vimentin [Source:NCBI gene;Acc:103044141][more]
desmb2.555e-2529.36desmin [Source:NCBI gene;Acc:103039642][more]
desmb3.713e-2529.36desmin [Source:NCBI gene;Acc:103039642][more]
desma1.227e-2428.80desmin-like [Source:NCBI gene;Acc:103037132][more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1369308.746e-1726.20zgc:136930 [Source:ZFIN;Acc:ZDB-GENE-060312-16][more]
lmnb28.994e-1725.00lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
desmb1.310e-1625.98desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102][more]
ENSPMAT00000010102.11.386e-1627.07pep scaffold:Pmarinus_7.0:GL478364:74479:82531:1 g... [more]
ENSPMAT00000010061.15.317e-1526.83pep scaffold:Pmarinus_7.0:GL478364:48285:55057:1 g... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Intermediate filament protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO372253.174e-1926.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Intermediate filament protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
viml5.671e-2730.13vimentin [Source:NCBI gene;Acc:101163931][more]
viml1.452e-2630.29vimentin [Source:NCBI gene;Acc:101163931][more]
gfap2.103e-2427.82glial fibrillary acidic protein [Source:NCBI gene;... [more]
gfap2.965e-2427.82glial fibrillary acidic protein [Source:NCBI gene;... [more]
desmb6.956e-2428.61desmin [Source:NCBI gene;Acc:101174730][more]
back to top
BLAST of Intermediate filament protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030598.12.541e-3695.20SMESG000030598.1[more]
SMESG000030598.12.653e-3695.20SMESG000030598.1[more]
SMESG000030598.12.582e-3695.16SMESG000030598.1[more]
SMESG000030596.12.154e-3282.87SMESG000030596.1[more]
SMESG000030599.17.226e-7679.35SMESG000030599.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026612 ID=SMED30026612|Name=Intermediate filament protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2359bp
TCTTATAAATACAACATTAATTGTATAGTGAACTATGTTAGCCATTGAAA
TGGAGACAAGTAAAAAAATCGCAGTCAAAACTACGAAACAAGAAGTAAGT
GGAAGTGGAAGCTCTGGTGGACTAAATGAACAACAAGCTTTTGGAAGTGG
TAGCTTTCGAACCGGGTCTGGAGGTGTACAGATAAGTGCTAGTGGAGCAA
TTGGATCTAGCAGTTCAGGCGGAGTTAGTGGCACTGGCGGAGTTGGTAGC
ATTGGTGGAGGCAGTGGTGCTGGTGGTGAAGGAACAGGAGCTAGCACAGT
TATCACTACAAGCAGATCTTATTATAAGCCTATTAGTCAACCTAGAAATA
ATTTAAAAGACTTACAAAAAACTTCTGGTATGAGTTACAGTGCACAATCA
AACTCCCAGCAAGGTTCAAGTAATATTCCATTGATTAGGGGAGACAGTGT
TGCTCTACAATCTGGAGTAACTTCAATGAAAAAAGGACGAGCTCAAGAGA
AAAGAGATCTTCAGGATCTGAATGAAAGATTCGCTAGTTACATTGAAAAA
GCTCGATTTCTAGAAGCGCAAAATAAACAATTGGTCAATGAAATTGAAAA
GTTAAAAGGTGGAACCGTCCAGGACAACTCAAAGATCAAAGAAATCTATG
AAGTCGAAATCAATCAACTTCGAACTTTGTTAAGTGATTCTGAAAAAAGC
AGAGCACCCTTAGAAGTACAAGTTGATTCTCTTGAATACGAAATTGATGA
TTTGAGAAAACGATTAATGATGCTGGAAGACATAAACTCTCAGTACAAAT
CCACCATCGATAAGCAACGCAAAGACATTTCTGGATTTGAAGGGGAATTG
GTGGAGCTCAGAAGATTCAAAGGCACCCAAGGTGCTGATGTAAATAAAGA
AAAGGAAGAAGTAAAAACACTAAGAGACGATTTGAAAAAATTGAGACAAG
ATTATGAGAAAGAAGCTCTAGCTCATCTCACCCTTGAACATGAATTACAA
AGCTTGAAAGAAGCATTAGAATTCGAGAAACAAATACATGACACAGAAGT
AAAAGAGCTGGCAACCGTTGCATATCGAGACCCAACGAAAGAAAACATGG
TTTACTGGCAAAGCGAAATGGGACGCGCGTTACGAGACATTCAAAATGAA
TATGAAAACAAGCTTACAGGAATCAAACAAGAATTGGATTCGTCATATGG
CTCACAACTGCAGGAAATACAAACAAGCAAGACCAGGGATAATGTGGAAA
CGACCCATTACAAAGAAGAGAACAGCCGGGTAAAATCTCAAATCCAAAGC
ATGAGATCGAGAATCGCTGATCTTGAGATGCAGAATGCTGAATACGAACA
CAACTTGAATAATATTCGTGCTAATTACGAAGAAACTCAAAGAAGTCTTG
AATTGCAGTTGTTGAATTTGCAAGAGCAATTGACAGGAACTCAACAGGAC
TTGACTATTACTTTGACCGAACTCCAAAGCCTATTGGACGCCAAATTGGG
ACTGGAATTAGAAATCGCTGCATACTCAAAGTTGTTAGAATTCGAAGAGA
ATCGTGTTAATTTTTCATCAGATGGTAACACATCACAATTTATCAGTTTT
TCATCTGGCGTGGGAGCTGGTGGTGTAGGAGGAGGATCAAGTGGAGGGTC
AGGTAGAGGATCAGGTGGAGGGTCAGGTGGTGGGTCAGGTGGTGGATCAG
GTGGAGGATCAGGTGGGGGATTTGGAGGTGGAGCAGGATTAGGATCAGGC
GGAGGAGGAGGATCAGGAAGTGGGTCTGGTGGAGGCGCAGGTGGGGCTGG
TTCTAGTATTGGAATTGGAGGTGGGGGCAATTTTGTAGGTGGTTCTCTGA
GATTTAACATTAATGAATTGAGCAGTACAGAGGCTGAAGAATACCAATTG
AAAAGAATGAAGTTCAGACGAACAACTAAAGGAAACATATCAATAGCAGA
AGCTGACATCAATGGACTGTTTATAGTTCTAGAGAATAACGGAACAAAAT
TTGAATCTTTAACTGGAATGACGATTAAGAGAAATATTGATGGGAATGAG
GATGCGGTTTCATTCACCATTCAAAACCGAACAAGTTTGAGTTCTGGAGA
AAAACTAACTATCTGGGCCAAAGGAAAGAAAACTGGCAAAGGAAAAGAAC
TTGAAATAGAAGAAGACGGCTGGGGGCTGGGGGATACTATTGTGACCTCT
TTATACAATGCGGAAGGAGAAGAGAAAGCGGTCCATTATCAAGAAATACA
GGGTTGAGCAGGTGCTCACTTAAGACTGACTTGAAATTTATTTGTTTAAA
TAATACTTTCAATAGGGATTTTAATGCTAATAAAAAGTATTTAAACTATT
AAAAAAAAA
back to top

protein sequence of SMED30026612-orf-1

>SMED30026612-orf-1 ID=SMED30026612-orf-1|Name=SMED30026612-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=741bp
MLAIEMETSKKIAVKTTKQEVSGSGSSGGLNEQQAFGSGSFRTGSGGVQI
SASGAIGSSSSGGVSGTGGVGSIGGGSGAGGEGTGASTVITTSRSYYKPI
SQPRNNLKDLQKTSGMSYSAQSNSQQGSSNIPLIRGDSVALQSGVTSMKK
GRAQEKRDLQDLNERFASYIEKARFLEAQNKQLVNEIEKLKGGTVQDNSK
IKEIYEVEINQLRTLLSDSEKSRAPLEVQVDSLEYEIDDLRKRLMMLEDI
NSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDL
KKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDP
TKENMVYWQSEMGRALRDIQNEYENKLTGIKQELDSSYGSQLQEIQTSKT
RDNVETTHYKEENSRVKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEE
TQRSLELQLLNLQEQLTGTQQDLTITLTELQSLLDAKLGLELEIAAYSKL
LEFEENRVNFSSDGNTSQFISFSSGVGAGGVGGGSSGGSGRGSGGGSGGG
SGGGSGGGSGGGFGGGAGLGSGGGGGSGSGSGGGAGGAGSSIGIGGGGNF
VGGSLRFNINELSSTEAEEYQLKRMKFRRTTKGNISIAEADINGLFIVLE
NNGTKFESLTGMTIKRNIDGNEDAVSFTIQNRTSLSSGEKLTIWAKGKKT
GKGKELEIEEDGWGLGDTIVTSLYNAEGEEKAVHYQEIQG*
back to top
Aliases
The feature 'Intermediate filament protein' has the following synonyms
Synonym
H.24.6b
vim-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000022Category 5 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR039008IF_rod_dom
IPR042180IF_rod_dom_coil1B
IPR001664IF
IPR001322Lamin_tail_dom
Vocabulary: cellular component
TermDefinition
GO:0005882intermediate filament
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 286..313
NoneNo IPR availableCOILSCoilCoilcoord: 413..454
NoneNo IPR availableCOILSCoilCoilcoord: 152..193
NoneNo IPR availableCOILSCoilCoilcoord: 202..257
NoneNo IPR availableGENE3DG3DSA:1.20.5.500coord: 361..428
e-value: 3.3E-5
score: 26.1
NoneNo IPR availableGENE3DG3DSA:1.20.5.170coord: 429..506
e-value: 2.1E-11
score: 46.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 14..38
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 15..38
NoneNo IPR availablePANTHERPTHR45721:SF12INTERMEDIATE FILAMENT PROTEIN IFA-1coord: 125..505
NoneNo IPR availablePANTHERPTHR45721FAMILY NOT NAMEDcoord: 125..505
NoneNo IPR availableSUPERFAMILYSSF64593Intermediate filament protein, coiled coil regioncoord: 437..505
NoneNo IPR availableSUPERFAMILYSSF64593Intermediate filament protein, coiled coil regioncoord: 154..189
IPR039008Intermediate filament, rod domainSMARTSM01391Filament_2coord: 154..504
e-value: 1.1E-28
score: 111.4
IPR039008Intermediate filament, rod domainPFAMPF00038Filamentcoord: 154..505
e-value: 1.7E-51
score: 175.6
IPR039008Intermediate filament, rod domainPROSITEPS51842IF_ROD_2coord: 155..506
score: 40.435
IPR042180Intermediate filament, rod domain, coil 1BGENE3DG3DSA:1.20.5.1160coord: 251..340
e-value: 2.8E-5
score: 26.3
IPR042180Intermediate filament, rod domain, coil 1BGENE3DG3DSA:1.20.5.1160coord: 150..244
e-value: 1.0E-21
score: 79.2