Wnt2-1

Overview
NameWnt2-1 (ACJ64868.1)
Smed IDSMED30026602
Length (bp)1718
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Wnt2-1 (SMED30026602) t-SNE clustered cells

Violin plots show distribution of expression levels for Wnt2-1 (SMED30026602) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Wnt2-1 (SMED30026602) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Wnt2-1 (SMED30026602) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026602

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 31

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30026602SMESG000002069.1 FJ463753.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30026602SMESG000002069.1 FJ463753.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
prepharyngeal regionSMED30026602SMESG000002069.1 FJ463753.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30026602SMESG000002069.1 FJ463753.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
tailSMED30026602SMESG000002069.1 FJ463753.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal cellSMED30026602SMESG000002069.1 FJ463753.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
prepharyngeal cellSMED30026602SMESG000002069.1 FJ463753.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
prepharyngeal cellSMED30026602SMESG000002069.1 FJ463753.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30026602SMESG000002069.1 FJ463753.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
prepharyngeal cellSMED30026602SMESG000002069.1 ACJ64868.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30026602SMESG000002069.1 ACJ64868.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30026602SMESG000002069.1 dd_Smed_v4_13487_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30026602SMESG000002069.1 dd_Smed_v4_13487_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30026602SMESG000002069.1 SmedASXL_004272SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30026602SMESG000002069.1 dd_Smed_v4_13487_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30026602SMESG000002069.1 dd_Smed_v4_13487_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026602SMESG000002069.1 dd_Smed_v6_13487_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
anterior region of the whole animalSMED30026602SMESG000002069.1 EU296634smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30026602SMESG000002069.1 EU296634smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30026602SMESG000002069.1 Smed-wnt2-1smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30026602SMESG000002069.1 Smed-wnt2-1smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30026602SMESG000002069.1 Contig49161newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30026602SMESG000002069.1 Contig49161uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30026602SMESG000002069.1 OX_Smed_1.0.10743ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
esophagusSMED30026602SMESG000002069.1 FJ463753.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30026602SMESG000002069.1 FJ463753.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
body wall musculatureSMED30026602SMESG000002069.1 dd_Smed_v4_13487_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
esophagusSMED30026602SMESG000002069.1 FJ463753.1smed_ncbi_20200123PMID:27074666
Lander et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30026602SMESG000002069.1 FJ463753.1smed_ncbi_20200123PMID:27074666
Lander et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
tailSMED30026602SMESG000002069.1 FJ463753.1smed_ncbi_20200123PMID:27074666
Lander et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30026602SMESG000002069.1 dd_Smed_v4_13487_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Wnt2-1 vs. Ensembl Human
Match: WNT2B (Wnt family member 2B [Source:HGNC Symbol;Acc:HGNC:12781])

HSP 1 Score: 283.108 bits (723), Expect = 8.157e-90
Identity = 137/322 (42.55%), Postives = 199/322 (61.80%), Query Frame = 3
Query:  579 NIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTF----NKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
              + IC  I    S+++ LC  YP++M S+  GA+  + EC  QF++ RWNCT     +  F ++M         RS +E AF+++I S+GVV++IT +CS+G+L  C CDP   G+  D  GDF WGGCSD+I +G++ +  F+D  +++ +  +ALMN HNNR GR  V +    +CKCHGVSG+C+LRTCW+ ++DFRR GD L++ Y+   +V       + T ++  +RR ++  LVY DNS DYC+ D + G  GT GR C+ TS   D C+ +CC RG+ T  +     C+CKF WCC VRCK CR  V V+ CK
Sbjct:   48 GARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVML--------RSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 361          
BLAST of Wnt2-1 vs. Ensembl Human
Match: WNT2 (Wnt family member 2 [Source:HGNC Symbol;Acc:HGNC:12780])

HSP 1 Score: 282.722 bits (722), Expect = 8.263e-90
Identity = 137/315 (43.49%), Postives = 195/315 (61.90%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNC-TFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +C  +    S ++ LC  +P++M +I  G      EC  QF+  RWNC T ++       +    +  RS +E+AF+++I S+GVV++IT +CS+G++K C CDP++ G  KD+ G F WGGCSD+I +G+K +  F+D  +RK +  +ALMN HNNR GR+ V +   ++CKCHGVSG+C+LRTCW  M DFR+ GD L + YN   +V  N      T +  RF++P+K  LVY +NS DYCI+D   G  GT GR CN TS   DSC+ +CC RG+ T  +     C CKF WCC VRC+ C   + V+ CK
Sbjct:   40 MCDNVPGLVSSQRQLCHRHPDVMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDH-----SLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCK 349          
BLAST of Wnt2-1 vs. Ensembl Human
Match: WNT2B (Wnt family member 2B [Source:HGNC Symbol;Acc:HGNC:12781])

HSP 1 Score: 282.722 bits (722), Expect = 1.993e-89
Identity = 137/322 (42.55%), Postives = 199/322 (61.80%), Query Frame = 3
Query:  579 NIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTF----NKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
              + IC  I    S+++ LC  YP++M S+  GA+  + EC  QF++ RWNCT     +  F ++M         RS +E AF+++I S+GVV++IT +CS+G+L  C CDP   G+  D  GDF WGGCSD+I +G++ +  F+D  +++ +  +ALMN HNNR GR  V +    +CKCHGVSG+C+LRTCW+ ++DFRR GD L++ Y+   +V       + T ++  +RR ++  LVY DNS DYC+ D + G  GT GR C+ TS   D C+ +CC RG+ T  +     C+CKF WCC VRCK CR  V V+ CK
Sbjct:   67 GARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVML--------RSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 380          
BLAST of Wnt2-1 vs. Ensembl Human
Match: WNT2B (Wnt family member 2B [Source:HGNC Symbol;Acc:HGNC:12781])

HSP 1 Score: 266.159 bits (679), Expect = 3.077e-84
Identity = 129/296 (43.58%), Postives = 185/296 (62.50%), Query Frame = 3
Query:  657 MVSIVYGAKLGLVECAQQFKYERWNCTF----NKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            M S+  GA+  + EC  QF++ RWNCT     +  F ++M         RS +E AF+++I S+GVV++IT +CS+G+L  C CDP   G+  D  GDF WGGCSD+I +G++ +  F+D  +++ +  +ALMN HNNR GR  V +    +CKCHGVSG+C+LRTCW+ ++DFRR GD L++ Y+   +V       + T ++  +RR ++  LVY DNS DYC+ D + G  GT GR C+ TS   D C+ +CC RG+ T  +     C+CKF WCC VRCK CR  V V+ CK
Sbjct:    1 MRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVML--------RSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 288          
BLAST of Wnt2-1 vs. Ensembl Human
Match: WNT5A (Wnt family member 5A [Source:HGNC Symbol;Acc:HGNC:12784])

HSP 1 Score: 242.276 bits (617), Expect = 3.662e-74
Identity = 129/340 (37.94%), Postives = 193/340 (56.76%), Query Frame = 3
Query:  549 ITFTSPFQPNNI-----KQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKD-------QTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +   +P Q + +     + +CS ++  S  +K LC  Y + M  I  GAK G+ EC  QF++ RWNC+   +     T+    +     +ETAF +++ ++GVV +++ +C +G+L  C C   R  + KD   D+ WGGC D+I +G + +  F+D  +R+        ++ + LMN HNN  GRR V+      CKCHGVSG+CSL+TCW ++ DFR++GD LK+ Y+    +  N   K L    +RF  P+ + LVYID S DYC+++ S G  GT GR CN TS   D C+ +CC RG+  ++ V  E C CKF WCC V+CK C   V  + CK
Sbjct:   34 LGMNNPVQMSEVYIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN-----TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCS--RAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGK-LVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK 365          
BLAST of Wnt2-1 vs. Ensembl Celegans
Match: cwn-2 (pep chromosome:WBcel235:IV:10067824:10070251:1 gene:WBGene00000858.1 transcript:W01B6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-2)

HSP 1 Score: 211.846 bits (538), Expect = 4.508e-63
Identity = 117/336 (34.82%), Postives = 181/336 (53.87%), Query Frame = 3
Query:  555 FTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLD------NYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQK----SLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
             ++    +N+K +C L    S  +  +C  + + M ++  GA+  + EC +QF   RWNC+ +  +   M   +H+M TR   E AF ++I S+GV + I   C +G L  C C  +   + K+   D++WGGC D++++G K S  F+D      +  R    G++LMN+ NN  GR+++ + R  KCKCHGVSGAC+++TCW ++    ++G +L+  Y+K  +V  N        +   +K R  R     LV++D+S DYC  D   G  GT GR C   S   + C  LCC RG+ TY   V+  C+CKF WCC+V C+ C     V  CK
Sbjct:   33 LSTALAGHNVKPVCELPGL-SPGQAQVCELFKDHMPAVSIGAQNAIQECQRQFTGHRWNCSTH--YSTGMLGPIHKMATR---EAAFTYAILSAGVTHEIGRRCKQGLLTSCGCSDET--KPKNVPTDWSWGGCGDNVEYGYKFSRDFIDIREKEHDPKRNHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVSGACNMKTCWMQLPSMEQVGKILRNKYDKAIRVQINDRGNLQLLADEATKERKTRALPTDLVFMDDSPDYCRFDRHSGTLGTEGRVCKRGSGGAEGCDSLCCGRGYNTYTQEVKSKCNCKFEWCCKVVCQTCNNVTQVDICK 360          
BLAST of Wnt2-1 vs. Ensembl Celegans
Match: egl-20 (Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05])

HSP 1 Score: 211.46 bits (537), Expect = 1.246e-62
Identity = 119/370 (32.16%), Postives = 196/370 (52.97%), Query Frame = 3
Query:  510 ESFPKHWIVKTLPITFTSPFQP---------NNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSV----KETAFLFSIWSSGVVYSITNSCSKGDLKECYCDP----QRHGQDKD---NVGDFTWGGCSDHIKFGMKVSTIFLDNYDR----KDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNK-----PQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +  P +W+  TL    ++ + P          + K++C  +   +  ++ LC   P  +  +  G +  + EC  +FK+ERWNC+      +       ++  +++    KE AFL +I ++ +V+SIT  C+ G+L EC CD     QR+  + D   +   F+WGGCSD++  G++ +  FLD+++     K +    L+ +HNN VGR  + +   ++C+CHGVSG+C  +TCW +M  F ++ D+LKK Y+       +K T    +K  T  K   R     ++ Y+  S  YC ++ + G  GT GREC + S   +SC  LCC RG+ T   + +  C+CKF WCCEV+CK C  +V V+ CK
Sbjct:   29 QQVPYNWL--TLAFVGSNDYLPRPHYHSTDREHFKELCRRLDGLNPNQQALCAENPFSIPFVARGVREAIRECENKFKFERWNCSSRDEVTETRHGKFQDILGKTLRSANKEAAFLNAIMAASIVHSITKGCNTGNLTECGCDSKPGMQRYQAESDPSMSRDQFSWGGCSDNVPHGIRYAKKFLDDWETAQFDKTKNVAHLVRRHNNFVGREAIAQNIRRQCRCHGVSGSCEFKTCWLQMQKFSQVSDLLKKRYDHFAVQVTRKATKRLRRKERTERKIPLR---GNEMAYVHRSPSYCEKNLTAGILGTSGRECIHNSYSSESCDLLCCGRGYNTRLEIRQTQCECKFVWCCEVKCKTCTEEVAVHTCK 393          
BLAST of Wnt2-1 vs. Ensembl Celegans
Match: cwn-1 (pep chromosome:WBcel235:II:130983:133598:-1 gene:WBGene00000857.1 transcript:K10B4.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-1)

HSP 1 Score: 203.371 bits (516), Expect = 7.399e-60
Identity = 117/339 (34.51%), Postives = 181/339 (53.39%), Query Frame = 3
Query:  594 CSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTF-----NKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDR-----KDQTGQALM-------------NQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTY---NPFQKSLTFSKN-RFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRC 1529
            C  +   + ++   C    ++M S+  G+     EC  QF   RWNCT      ++  P +    L+E T    +E+AF+ +I S+ V Y +T  C++G  + C CD  ++  D      F + GCSD++KFG+ VS  F+D+  R     KD  G +L+             N HNN+ GR+V+ K+  ++CKCHG+SG+C +RTCW  + +FR IG  +K  ++   +V     +  +K     KN +F+R +   LVY+  S D+C  DP  G  GT GR+C    +  D C  LCC RG+     +VEE C+CKF +CCEVRC+ C++++  Y C
Sbjct:   42 CKSLKGLTRRQMRFCKKNIDLMESVRSGSLAAHAECQFQFHKRRWNCTLIDPVTHEVIPDVF---LYENT----RESAFVHAISSAAVAYKVTRDCARGISERCGCDYSKN--DHSGKSQFQYQGCSDNVKFGIGVSKEFVDSAQRRVLMMKDDNGTSLLGPSQLSADGMHMINLHNNQAGRQVLEKSLRRECKCHGMSGSCEMRTCWDSLPNFRHIGMAIKDKFDGAAEVKVVKEDGIEKPRIVMKNSQFKRHTNADLVYMTPSPDFCESDPLRGILGTKGRQCTLAPNAIDDCSLLCCGRGYEKKVQIVEEKCNCKFIYCCEVRCEPCQKRIEKYLC 371          
BLAST of Wnt2-1 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355988:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 191.045 bits (484), Expect = 2.567e-55
Identity = 115/348 (33.05%), Postives = 177/348 (50.86%), Query Frame = 3
Query:  543 LPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVG--------DFTWGGCSDHIKFGMKVSTIFLDNYDRKDQT-GQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKN--------RFRR-------PSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKV 1514
            L  T TS     +   +C  +   + ++K +C   PN++  ++ G +  L  C   F+ E WNCT   + P + T+ L   +    +E+A++++I ++GV +S+  +CSKG + +C C     G     V         DF W GCSD++KFG      F+D YDR+  T  ++ MN HNNRVGRR++     K+CKCHGVSG+C  +TCW+ M  F      L + Y   + VT N  + ++  S +        RF R         + +L+Y+D S +YC  D          REC       ++C  +CC RG  T   +V+E C C+F WCCEV+CK C++ V
Sbjct:   28 LSKTDTSSANSGSSPILCKNVPGLTPQQKRMCHENPNIIKYLISGLRSALHTCEYTFQREAWNCTL--TLPGVGTSPLQIAS----RESAYVYAISAAGVSHSLARACSKGLIDDCGCGETPQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVDQYDRQHATEPRSQMNLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWKVMPKFDEFASRLHQKYQLAKLVTNNDQKLTVRSSPSAGSSGRSERFARNMDASSKQMRNELIYLDASPNYCAID-------VKDRECG------ENCPNICCGRGWRTTREIVDEPCHCQFVWCCEVKCKTCKKLV 356          
BLAST of Wnt2-1 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355953:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 191.045 bits (484), Expect = 2.567e-55
Identity = 115/348 (33.05%), Postives = 177/348 (50.86%), Query Frame = 3
Query:  543 LPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVG--------DFTWGGCSDHIKFGMKVSTIFLDNYDRKDQT-GQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKN--------RFRR-------PSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKV 1514
            L  T TS     +   +C  +   + ++K +C   PN++  ++ G +  L  C   F+ E WNCT   + P + T+ L   +    +E+A++++I ++GV +S+  +CSKG + +C C     G     V         DF W GCSD++KFG      F+D YDR+  T  ++ MN HNNRVGRR++     K+CKCHGVSG+C  +TCW+ M  F      L + Y   + VT N  + ++  S +        RF R         + +L+Y+D S +YC  D          REC       ++C  +CC RG  T   +V+E C C+F WCCEV+CK C++ V
Sbjct:   28 LSKTDTSSANSGSSPILCKNVPGLTPQQKRMCHENPNIIKYLISGLRSALHTCEYTFQREAWNCTL--TLPGVGTSPLQIAS----RESAYVYAISAAGVSHSLARACSKGLIDDCGCGETPQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVDQYDRQHATEPRSQMNLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWKVMPKFDEFASRLHQKYQLAKLVTNNDQKLTVRSSPSAGSSGRSERFARNMDASSKQMRNELIYLDASPNYCAID-------VKDRECG------ENCPNICCGRGWRTTREIVDEPCHCQFVWCCEVKCKTCKKLV 356          
BLAST of Wnt2-1 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0088512)

HSP 1 Score: 181.415 bits (459), Expect = 1.074e-51
Identity = 114/352 (32.39%), Postives = 179/352 (50.85%), Query Frame = 3
Query:  528 WIVKTLPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGD----FTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRR-------------PSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +I+  + I   S F       +C  I   +  ++N+C   P+ ++++  G +LG  EC  QF+  RWNC+  + + + +  H+    +R   E A+ ++I S+G  Y++T +C++G++  C CD  RH       G     + WGGCS  + FGM+ +  F+D  +  ++  + LMN HNNR GR +V K     CKCHGVSG+C ++TCW+ +  FR +GD L   Y K + V     ++ L    +R +              P + +L+Y++ S +YC +    G  GT GR C  T     SC  LCC RGH T  +     C C+F WCCEV+C  C      + CK
Sbjct:   11 YILWIMEIRLVSSF---TSVMLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCS--EVWQRNVFAHVIPTASR---EAAYTYAIASAGAAYAVTAACARGNISTCGCDV-RHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARE-LERDSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTCK 352          
BLAST of Wnt2-1 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0339383)

HSP 1 Score: 180.644 bits (457), Expect = 1.107e-51
Identity = 110/331 (33.23%), Postives = 172/331 (51.96%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGD----FTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRR-------------PSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +C  I   +  ++N+C   P+ ++++  G +LG  EC  QF+  RWNC+  + + + +  H+    +R   E A+ ++I S+G  Y++T +C++G++  C CD  RH       G     + WGGCS  + FGM+ +  F+D  +  ++  + LMN HNNR GR +V K     CKCHGVSG+C ++TCW+ +  FR +GD L   Y K + V     ++ L    +R +              P + +L+Y++ S +YC +    G  GT GR C  T     SC  LCC RGH T  +     C C+F WCCEV+C  C      + CK
Sbjct:    2 LCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCS--EVWQRNVFAHVIPTASR---EAAYTYAIASAGAAYAVTAACARGNISTCGCDV-RHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARE-LERDSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTCK 325          
BLAST of Wnt2-1 vs. Ensembl Fly
Match: Wnt6 (gene:FBgn0031902 transcript:FBtr0334800)

HSP 1 Score: 159.844 bits (403), Expect = 4.478e-43
Identity = 80/200 (40.00%), Postives = 112/200 (56.00%), Query Frame = 3
Query:  933 GDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQA-LMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRC 1529
            G + WGGCSD++ FG++ S +FLD   R+ ++    L+  HNN  GR  +      +CKCHG+SG+C+++TCW +M  FR +   L+  Y+  +KVT      S        R  +K +LV+ D+S D+C  +   G  GT GRECN TSS  D C  LCC+RGH    +  + NC C F WCCEV C+ C     V  C
Sbjct:  220 GQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRNDGNSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419          

HSP 2 Score: 65.0846 bits (157), Expect = 7.875e-11
Identity = 29/78 (37.18%), Postives = 45/78 (57.69%), Query Frame = 3
Query:  666 IVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCD 899
            I+ G  LG  EC  QF+  RWNCT       ++   + ++  R  +ET F+ +I ++GV Y++T +C+ G L EC CD
Sbjct:   60 IINGINLGFRECEFQFRNRRWNCT-------VLRKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCD 130          
BLAST of Wnt2-1 vs. Ensembl Fly
Match: Wnt6 (gene:FBgn0031902 transcript:FBtr0303251)

HSP 1 Score: 159.844 bits (403), Expect = 4.478e-43
Identity = 80/200 (40.00%), Postives = 112/200 (56.00%), Query Frame = 3
Query:  933 GDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQA-LMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRC 1529
            G + WGGCSD++ FG++ S +FLD   R+ ++    L+  HNN  GR  +      +CKCHG+SG+C+++TCW +M  FR +   L+  Y+  +KVT      S        R  +K +LV+ D+S D+C  +   G  GT GRECN TSS  D C  LCC+RGH    +  + NC C F WCCEV C+ C     V  C
Sbjct:  220 GQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRNDGNSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419          

HSP 2 Score: 65.0846 bits (157), Expect = 7.875e-11
Identity = 29/78 (37.18%), Postives = 45/78 (57.69%), Query Frame = 3
Query:  666 IVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCD 899
            I+ G  LG  EC  QF+  RWNCT       ++   + ++  R  +ET F+ +I ++GV Y++T +C+ G L EC CD
Sbjct:   60 IINGINLGFRECEFQFRNRRWNCT-------VLRKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCD 130          
BLAST of Wnt2-1 vs. Ensembl Fly
Match: Wnt4 (gene:FBgn0010453 transcript:FBtr0334799)

HSP 1 Score: 157.532 bits (397), Expect = 2.454e-41
Identity = 105/354 (29.66%), Postives = 183/354 (51.69%), Query Frame = 3
Query:  516 FPKHWIVK-TLPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLD-NYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSL-TFSKNRFRRPSKKK----------LVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKF--FWCCEVRCKICRRKVFVYRCK 1532
            + +H+I + T+   FTS  Q   +   C  +   + ++ + C     +  ++    +L    C +QF+Y+RWNC+      + +   L+       KETAF+ ++ ++ + +SI  +C++G + +C C P++H ++     DF WGGC+D++K G +V+  FLD      D+  + L  +H++ VG   V    + KCKCHGVSG+CS++TCW++M DF     +L++ YN  + +   P Q+S+   S +R ++P +++          L Y++ S  YC          T  R+C +     D+C  LCC RG+ T  +   E C C+F    CC++ C  C+R    Y CK
Sbjct:  216 YNEHFISEHTVMAVFTSQGQ---VGGPCRYM-PATRRQNHQCRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLY-------KETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQ---DFQWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEIL--RHDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYN--EAIRKAPNQRSMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCAV--------TKDRQCLHP----DNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFCK 539          
BLAST of Wnt2-1 vs. Ensembl Zebrafish
Match: wnt2bb (wingless-type MMTV integration site family, member 2Bb [Source:ZFIN;Acc:ZDB-GENE-060824-6])

HSP 1 Score: 285.804 bits (730), Expect = 1.039e-90
Identity = 142/316 (44.94%), Postives = 195/316 (61.71%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNH--LHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            IC  I    +K++ LC  YP++M SI  GAK  + EC  QF++ RWNC+       +  +H     +  RS +E AF+++I S+GVV++IT +CS+G+LK C CDPQ+ G+  D  G+F WGGCSD+I +G+K +  F+D  +R  +  +ALMN HNNR GR  V +    +CKCHGVSG+C+LRTCW  M+DFR+ GD L+K YN   +VT N      T +   FR+ +K  LVY +NS DYC+ D + G  GT GR CN TS   D C+ +CC RG+ T        C+CKF WCC V CK C   V ++ CK
Sbjct:   76 ICDNIPGLVNKQRQLCQKYPDIMQSIGGGAKEWIRECQYQFRHHRWNCS------ALDRDHTVFGRVIQRSSREAAFVYAISSAGVVFAITRACSQGELKACNCDPQKRGRASDERGEFDWGGCSDNINYGIKFAKAFIDAKERTVKDARALMNLHNNRCGRMAVKRFMKLECKCHGVSGSCTLRTCWLAMSDFRKTGDYLRKKYNGAIEVTMNQDGTGFTVANKDFRKATKNDLVYFENSPDYCLMDKTAGSLGTAGRVCNKTSRGTDGCEVMCCGRGYDTTRSKRITKCECKFKWCCTVECKDCEEAVDIHTCK 385          
BLAST of Wnt2-1 vs. Ensembl Zebrafish
Match: wnt2ba (wingless-type MMTV integration site family, member 2Ba [Source:ZFIN;Acc:ZDB-GENE-030717-2])

HSP 1 Score: 283.878 bits (725), Expect = 3.890e-90
Identity = 143/318 (44.97%), Postives = 195/318 (61.32%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTF----NKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            IC  I    +K++ LC  +P++M SI  GAK  + EC  QF++ RWNC+     +  F ++M         RS +E AF+++I S+GVVY+IT +CS+G+LK C CD QR G+  D  GDF WGGCSD+I +G+K +  F+D  +R  +  +ALMN HNNR GR  V +    +CKCHGVSG+C+LRTCW  M+DFRR GD L+K YN   +V  N        +   ++R +K  LVYI+NS DYC+ D S G  GT GR CN +S   D C+ +CC RG+ T  +     C+CKF WCC V C+ C   V V+ CK
Sbjct:   67 ICDNIPGLVNKQRQLCQRHPDLMQSIGQGAKEWIRECQHQFRHHRWNCSTLERDHTVFGRVML--------RSSREAAFVYAISSAGVVYAITRACSQGELKICSCDSQRRGRASDEDGDFDWGGCSDNINYGIKFAKAFVDARERMVKDARALMNLHNNRCGRMAVKRFMKTECKCHGVSGSCALRTCWLAMSDFRRTGDYLRKKYNAAVEVMMNQDGTGFMVADRDYKRTTKNDLVYIENSPDYCLMDRSAGSLGTSGRVCNKSSRGMDGCEIMCCGRGYDTTRVNRMTKCECKFKWCCAVECRDCEETVDVHTCK 376          
BLAST of Wnt2-1 vs. Ensembl Zebrafish
Match: wnt2bb (wingless-type MMTV integration site family, member 2Bb [Source:ZFIN;Acc:ZDB-GENE-060824-6])

HSP 1 Score: 283.878 bits (725), Expect = 5.172e-90
Identity = 141/316 (44.62%), Postives = 194/316 (61.39%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNH--LHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            IC  I    +K++ LC  YP++M SI  GAK  + EC  QF++ RWNC+       +  +H     +  RS +E AF+++I S+GVV++IT +CS+G+LK C CDPQ+ G+  D  G+F WGGCSD+I +G+K +  F+D  +R  +  +ALMN HNNR GR  V +    +CKCHGVSG+C+LRTCW  M+D R+ GD L+K YN   +VT N      T +   FR+ +K  LVY +NS DYC+ D + G  GT GR CN TS   D C+ +CC RG+ T        C+CKF WCC V CK C   V ++ CK
Sbjct:   76 ICDNIPGLVNKQRQLCQKYPDIMQSIGGGAKEWIRECQYQFRHHRWNCS------ALDRDHTVFGRVIQRSSREAAFVYAISSAGVVFAITRACSQGELKACNCDPQKRGRASDERGEFDWGGCSDNINYGIKFAKAFIDAKERTVKDARALMNLHNNRCGRMAVKRFMKLECKCHGVSGSCTLRTCWLAMSDLRKTGDYLRKKYNGAIEVTMNQDGTGFTVANKDFRKATKNDLVYFENSPDYCLMDKTAGSLGTAGRVCNKTSRGTDGCEVMCCGRGYDTTRSKRITKCECKFKWCCTVECKDCEEAVDIHTCK 385          
BLAST of Wnt2-1 vs. Ensembl Zebrafish
Match: wnt2 (wingless-type MMTV integration site family member 2 [Source:NCBI gene;Acc:30127])

HSP 1 Score: 280.411 bits (716), Expect = 3.139e-89
Identity = 136/314 (43.31%), Postives = 193/314 (61.46%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +C  I    +K++ LC  +P +M +I  G K  + EC  QF+  RWNC        +    LH    RS +E AF+++I S+G+VY++T +CS+G+L+ C CDP + G  +D  G F WGGCSDH+   +K + +F+D  +RK++  +ALMN HNNR GR+ V +    +CKCHGVSG+C++RTCW  M DFR+ GD L+K YN   +V  N +    T +    +RP+K  LVY ++S DYCI D   G  GTGGR CN TS   DSC+ +CC RG+ T  +     C+CKF WCC V C+ C+ +V V+ CK
Sbjct:   38 MCDNIPGLINKQRQLCRQHPKVMQAIGAGIKNWIGECQHQFRTHRWNCNTMAREHNLFGRLLH----RSSREAAFVYAISSAGMVYTLTRACSQGELENCSCDPGKKGSSRDAKGAFDWGGCSDHVDHAIKFTQVFIDAKERKERDARALMNLHNNRAGRKAVKRFMNLECKCHGVSGSCNVRTCWLAMADFRQTGDYLRKKYNNAIQVVMNQYGTGFTSAYRMLKRPNKNDLVYFEDSPDYCIWDHESGSVGTGGRVCNRTSRGTDSCEVMCCGRGYDTSRVSRTTKCECKFQWCCAVHCRDCQEEVDVHTCK 347          
BLAST of Wnt2-1 vs. Ensembl Zebrafish
Match: wnt2 (wingless-type MMTV integration site family member 2 [Source:NCBI gene;Acc:30127])

HSP 1 Score: 280.411 bits (716), Expect = 3.139e-89
Identity = 136/314 (43.31%), Postives = 193/314 (61.46%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +C  I    +K++ LC  +P +M +I  G K  + EC  QF+  RWNC        +    LH    RS +E AF+++I S+G+VY++T +CS+G+L+ C CDP + G  +D  G F WGGCSDH+   +K + +F+D  +RK++  +ALMN HNNR GR+ V +    +CKCHGVSG+C++RTCW  M DFR+ GD L+K YN   +V  N +    T +    +RP+K  LVY ++S DYCI D   G  GTGGR CN TS   DSC+ +CC RG+ T  +     C+CKF WCC V C+ C+ +V V+ CK
Sbjct:   38 MCDNIPGLINKQRQLCRQHPKVMQAIGAGIKNWIGECQHQFRTHRWNCNTMAREHNLFGRLLH----RSSREAAFVYAISSAGMVYTLTRACSQGELENCSCDPGKKGSSRDAKGAFDWGGCSDHVDHAIKFTQVFIDAKERKERDARALMNLHNNRAGRKAVKRFMNLECKCHGVSGSCNVRTCWLAMADFRQTGDYLRKKYNNAIQVVMNQYGTGFTSAYRMLKRPNKNDLVYFEDSPDYCIWDHESGSVGTGGRVCNRTSRGTDSCEVMCCGRGYDTSRVSRTTKCECKFQWCCAVHCRDCQEEVDVHTCK 347          
BLAST of Wnt2-1 vs. Ensembl Xenopus
Match: WNT2B (Wnt family member 2B [Source:NCBI gene;Acc:100491761])

HSP 1 Score: 289.656 bits (740), Expect = 1.290e-92
Identity = 141/314 (44.90%), Postives = 199/314 (63.38%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            IC  I    +K++ LC  +P++M +I  GAK  + EC  QF++ RWNC+   +  +  T     M  RS +ETAF+++I  +GVVY++T +CS+G+LK C CDP++ G+ KD  G+F WGGCSDHI FG+K +  F+D  +++ +  +ALMN HNNR GR  V +    +CKCHGVSG+C+LRTCW+ M+DFR+ GD L++ YN   +VT N        +   FR+ +KK LVY +NS DYC+ D + G  GT GR C+  S   D C+ +CC RG+ T  +     C+CKF WCC VRCK C   V V+ CK
Sbjct:   34 ICDNIPGLVNKQRQLCQKHPDIMQAIGEGAKEWIRECQHQFRHHRWNCS---TLDRDHTVFGRAML-RSSRETAFVYAISYAGVVYALTRACSQGELKSCSCDPKKRGRSKDERGEFDWGGCSDHIDFGIKFAKDFVDAKEKRLKDARALMNLHNNRCGRMAVKRFMNLECKCHGVSGSCTLRTCWRAMSDFRKTGDFLRRKYNGAIQVTMNQDGSGFAVANQNFRKATKKDLVYFENSPDYCLMDKTAGSLGTAGRVCDKVSRGTDGCEVMCCGRGYDTTRVTRITKCECKFHWCCAVRCKECEETVDVHTCK 343          
BLAST of Wnt2-1 vs. Ensembl Xenopus
Match: WNT2B (Wnt family member 2B [Source:NCBI gene;Acc:100491761])

HSP 1 Score: 290.041 bits (741), Expect = 2.991e-92
Identity = 139/316 (43.99%), Postives = 198/316 (62.66%), Query Frame = 3
Query:  585 KQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            + IC  I    +K++ LC  +P++M +I  GAK  + EC  QF++ RWNC+       +    +     RS +ETAF+++I  +GVVY++T +CS+G+LK C CDP++ G+ KD  G+F WGGCSDHI FG+K +  F+D  +++ +  +ALMN HNNR GR  V +    +CKCHGVSG+C+LRTCW+ M+DFR+ GD L++ YN   +VT N        +   FR+ +KK LVY +NS DYC+ D + G  GT GR C+  S   D C+ +CC RG+ T  +     C+CKF WCC VRCK C   V V+ CK
Sbjct:   70 RVICDNIPGLVNKQRQLCQKHPDIMQAIGEGAKEWIRECQHQFRHHRWNCSTLDRDHTVFGRAM----LRSSRETAFVYAISYAGVVYALTRACSQGELKSCSCDPKKRGRSKDERGEFDWGGCSDHIDFGIKFAKDFVDAKEKRLKDARALMNLHNNRCGRMAVKRFMNLECKCHGVSGSCTLRTCWRAMSDFRKTGDFLRRKYNGAIQVTMNQDGSGFAVANQNFRKATKKDLVYFENSPDYCLMDKTAGSLGTAGRVCDKVSRGTDGCEVMCCGRGYDTTRVTRITKCECKFHWCCAVRCKECEETVDVHTCK 381          
BLAST of Wnt2-1 vs. Ensembl Xenopus
Match: WNT2 (Wnt family member 2 [Source:NCBI gene;Acc:100038261])

HSP 1 Score: 285.804 bits (730), Expect = 3.194e-91
Identity = 133/314 (42.36%), Postives = 195/314 (62.10%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +C+ I    ++++ LC  YP +M  I  GA     EC  QF++ RWNC   +    +      ++  RS +E+AF+ +I S+G+V++IT +CS+G+LK C CDP + G  KD+ G F W GCSD+I +G++ +  F+D  +RK +  +ALMN HNN+ GR+ V +   ++CKCHGVSG+C++RTCW  M DFR+ GD L++ YN   +V  N      T +  RF++P+   LVY +NS DYC++D  +G  GT GR CN TS   DSC+ +CC RG+ T  +     C+CKF WCC VRCK C   V ++ CK
Sbjct:   29 MCNNIPGLVTRQRQLCQRYPEIMQVIGLGAVEWTTECQHQFRHHRWNCNIMERDQSL----FGKLILRSSRESAFVHAISSAGIVFAITRACSQGELKSCSCDPTKKGSSKDSKGGFDWDGCSDNIDYGIRFARTFVDAKERKGKDARALMNLHNNKAGRKAVKRFMKQECKCHGVSGSCTVRTCWMAMGDFRKSGDYLRRKYNGAIQVVMNQDGTGFTVANTRFKKPTNNDLVYFENSPDYCVRDRDVGSLGTAGRICNQTSRGMDSCEVMCCGRGYDTARITKMSKCECKFHWCCSVRCKDCIETVDIHTCK 338          
BLAST of Wnt2-1 vs. Ensembl Xenopus
Match: WNT2 (Wnt family member 2 [Source:NCBI gene;Acc:100038261])

HSP 1 Score: 285.804 bits (730), Expect = 4.405e-91
Identity = 137/348 (39.37%), Postives = 204/348 (58.62%), Query Frame = 3
Query:  528 WIVKTLPITFTSPFQPNN-------------IKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            W +    + F +P   N+              + +C+ I    ++++ LC  YP +M  I  GA     EC  QF++ RWNC   +    +      ++  RS +E+AF+ +I S+G+V++IT +CS+G+LK C CDP + G  KD+ G F W GCSD+I +G++ +  F+D  +RK +  +ALMN HNN+ GR+ V +   ++CKCHGVSG+C++RTCW  M DFR+ GD L++ YN   +V  N      T +  RF++P+   LVY +NS DYC++D  +G  GT GR CN TS   DSC+ +CC RG+ T  +     C+CKF WCC VRCK C   V ++ CK
Sbjct:    9 WFLVPTTLLFLTPEAANSWWYMGAVVTSSSSSRVMCNNIPGLVTRQRQLCQRYPEIMQVIGLGAVEWTTECQHQFRHHRWNCNIMERDQSL----FGKLILRSSRESAFVHAISSAGIVFAITRACSQGELKSCSCDPTKKGSSKDSKGGFDWDGCSDNIDYGIRFARTFVDAKERKGKDARALMNLHNNKAGRKAVKRFMKQECKCHGVSGSCTVRTCWMAMGDFRKSGDYLRRKYNGAIQVVMNQDGTGFTVANTRFKKPTNNDLVYFENSPDYCVRDRDVGSLGTAGRICNQTSRGMDSCEVMCCGRGYDTARITKMSKCECKFHWCCSVRCKDCIETVDIHTCK 352          
BLAST of Wnt2-1 vs. Ensembl Xenopus
Match: ENSXETT00000050987.1 (Wnt family member 5A [Source:NCBI gene;Acc:101734372])

HSP 1 Score: 243.047 bits (619), Expect = 1.397e-74
Identity = 130/337 (38.58%), Postives = 189/337 (56.08%), Query Frame = 3
Query:  543 LPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKD-------QTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +P  +    QP     +CS +S  S  +K LC  Y + M  I  GAK G+ EC  QF++ RWNC+   +     T+    +     +ETAF ++I ++GVV +++ +C +G+L  C C   R  + KD   D+ WGGC D++ +G + +  F+D  +R+        ++ + LMN HNN  GRR V       CKCHGVSG+CSL+TCW ++ DFR++GD+LK+ Y+    +  N   K L    N+F  P+   L+YID S DYC+ + S G  GT GR CN TS   D C+ +CC RG+  ++ V  E C CKF WCC V+CK C   V  + CK
Sbjct:   36 IPEVYIIGAQP-----LCSQLSGLSQGQKKLCQLYQDHMQFIGEGAKTGIKECQYQFRHRRWNCSTVDN-----TSVFGRVMQIGSRETAFTYAISAAGVVNAVSRACREGELSTCGCS--RAARPKDLPRDWLWGGCGDNLDYGYRFAKEFVDAREREKIYQKGSYESSRLLMNLHNNEAGRRAVSTLADVACKCHGVSGSCSLKTCWLQLADFRKVGDLLKEKYDSAAAMKLNTRGK-LVQVNNKFNSPTMNDLIYIDPSPDYCVHNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEVVDQFACK 359          
BLAST of Wnt2-1 vs. Ensembl Mouse
Match: Wnt2 (wingless-type MMTV integration site family, member 2 [Source:MGI Symbol;Acc:MGI:98954])

HSP 1 Score: 286.189 bits (731), Expect = 2.482e-91
Identity = 138/315 (43.81%), Postives = 197/315 (62.54%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNC-TFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +C  +    S+++ LC  +P++M +I  G      EC  QF+  RWNC T ++       +    +  RS +E+AF+++I S+GVV++IT +CS+G+LK C CDP++ G  KD+ G F WGGCSD+I +G+K +  F+D  +RK +  +ALMN HNNR GR+ V +   ++CKCHGVSG+C+LRTCW  M DFR+ GD L + YN   +V  N      T +  RF++P+K  LVY +NS DYCI+D   G  GT GR CN TS   DSC+ +CC RG+ T  +     C+CKF WCC VRC+ C   + V+ CK
Sbjct:   40 MCDNVPGLVSRQRQLCHRHPDVMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDH-----SLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGELKSCSCDPKKKGSAKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMTKCECKFHWCCAVRCQDCLEALDVHTCK 349          
BLAST of Wnt2-1 vs. Ensembl Mouse
Match: Wnt2b (wingless-type MMTV integration site family, member 2B [Source:MGI Symbol;Acc:MGI:1261834])

HSP 1 Score: 282.337 bits (721), Expect = 1.996e-89
Identity = 135/318 (42.45%), Postives = 196/318 (61.64%), Query Frame = 3
Query:  579 NIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
              + IC  I    S+++ LC  YP++M S+  GA+  + EC  QF++ RWNCT       +    +     RS +E AF+++I S+GVV++IT +CS+G+L  C CDP   G+  D  GDF WGGCSD+I +G++ +  F+D  +++ +  +ALMN HNNR GR  V +    +CKCHGVSG+C+LRTCW+ ++DFRR GD L++ Y+   +VT      + T ++  +R  ++  LVY DNS DYC+ D + G  GT GR C+ TS   D C+ +CC RG+ T  +     C+CKF WCC VRCK CR  V V+ CK
Sbjct:   65 GARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRAM----LRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRHATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 378          
BLAST of Wnt2-1 vs. Ensembl Mouse
Match: Wnt5b (wingless-type MMTV integration site family, member 5B [Source:MGI Symbol;Acc:MGI:98959])

HSP 1 Score: 244.202 bits (622), Expect = 3.582e-75
Identity = 129/336 (38.39%), Postives = 191/336 (56.85%), Query Frame = 3
Query:  546 PITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRK-------DQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            P  F    QP     +CS +   S  ++ LC  Y   M  I  GAK G+ EC  QF+  RWNC+   +     T+    +     +ETAF +++ ++GVV +I+ +C +G+L  C C   R  + KD   D+ WGGC D++++G + +  F+D  +R+       ++ G+ALMN  NN  GRR V+K     CKCHGVSG+CSL+TCW ++ +FR++GD LK+ Y+    +     Q  L  + +RF +P+ + LVY+D S DYC+++ + G  GT GR CN TS   D C+ +CC RG+  ++ V  E C C+F WCC VRCK C   V  Y CK
Sbjct:   37 PEMFIIGAQP-----VCSQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDN-----TSVFGRVMQIGSRETAFTYAVSAAGVVNAISRACREGELSTCGCS--RAARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRALMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRITR-QGKLELANSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCKKCTEVVDQYVCK 359          
BLAST of Wnt2-1 vs. Ensembl Mouse
Match: Wnt5b (wingless-type MMTV integration site family, member 5B [Source:MGI Symbol;Acc:MGI:98959])

HSP 1 Score: 244.202 bits (622), Expect = 3.582e-75
Identity = 129/336 (38.39%), Postives = 191/336 (56.85%), Query Frame = 3
Query:  546 PITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRK-------DQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            P  F    QP     +CS +   S  ++ LC  Y   M  I  GAK G+ EC  QF+  RWNC+   +     T+    +     +ETAF +++ ++GVV +I+ +C +G+L  C C   R  + KD   D+ WGGC D++++G + +  F+D  +R+       ++ G+ALMN  NN  GRR V+K     CKCHGVSG+CSL+TCW ++ +FR++GD LK+ Y+    +     Q  L  + +RF +P+ + LVY+D S DYC+++ + G  GT GR CN TS   D C+ +CC RG+  ++ V  E C C+F WCC VRCK C   V  Y CK
Sbjct:   37 PEMFIIGAQP-----VCSQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDN-----TSVFGRVMQIGSRETAFTYAVSAAGVVNAISRACREGELSTCGCS--RAARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRALMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRITR-QGKLELANSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCKKCTEVVDQYVCK 359          
BLAST of Wnt2-1 vs. Ensembl Mouse
Match: Wnt5b (wingless-type MMTV integration site family, member 5B [Source:MGI Symbol;Acc:MGI:98959])

HSP 1 Score: 242.276 bits (617), Expect = 5.226e-75
Identity = 125/321 (38.94%), Postives = 187/321 (58.26%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRK-------DQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +CS +   S  ++ LC  Y   M  I  GAK G+ EC  QF+  RWNC+   +     T+    +     +ETAF +++ ++GVV +I+ +C +G+L  C C   R  + KD   D+ WGGC D++++G + +  F+D  +R+       ++ G+ALMN  NN  GRR V+K     CKCHGVSG+CSL+TCW ++ +FR++GD LK+ Y+    +     Q  L  + +RF +P+ + LVY+D S DYC+++ + G  GT GR CN TS   D C+ +CC RG+  ++ V  E C C+F WCC VRCK C   V  Y CK
Sbjct:    9 VCSQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDN-----TSVFGRVMQIGSRETAFTYAVSAAGVVNAISRACREGELSTCGCS--RAARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRALMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRITR-QGKLELANSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCKKCTEVVDQYVCK 321          
BLAST of Wnt2-1 vs. UniProt/SwissProt
Match: sp|Q07E18|WNT2_MUSPF (Protein Wnt-2 OS=Mustela putorius furo OX=9669 GN=WNT2 PE=3 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 1.172e-92
Identity = 139/315 (44.13%), Postives = 199/315 (63.17%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNC-TFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +C  +    S+++ LC  +P++M +I  G      EC  QF+  RWNC T ++       +    +  RS +E+AF++++ S+GVV++IT +CS+G+LK C CDP++ G  KD+ G+F WGGCSD+I +G+K +  F+D  +RK +  +ALMN HNNR GR+ V +   ++CKCHGVSG+C+LRTCW  M DFRR GD L + YN   +V  N      T +  RF++P+K  LVY +NS DYCI+D   G PGT GR CN TS   DSC+ +CC RG+ T  +     C+CKF WCC VRC+ C   + V+ CK
Sbjct:   40 MCDNVPGLVSRQRQLCHRHPDVMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDH-----SLFGRVLLRSSRESAFVYAVSSAGVVFAITRACSQGELKSCSCDPKKKGTAKDSKGNFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRRTGDYLWRKYNGAIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDRDAGSPGTAGRVCNLTSRGMDSCEVMCCGRGYDTSRVTRMTKCECKFHWCCAVRCQDCLEALDVHTCK 349          
BLAST of Wnt2-1 vs. UniProt/SwissProt
Match: sp|A1X153|WNT2_ECHTE (Protein Wnt-2 OS=Echinops telfairi OX=9371 GN=WNT2 PE=3 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 2.889e-92
Identity = 140/336 (41.67%), Postives = 205/336 (61.01%), Query Frame = 3
Query:  528 WIVKTLPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNC-TFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            W+V  +  ++         + +C  +    S+++ LC  +P++M +I  G      EC  QF+  RWNC T ++       +    +  RS +E+AF+++I S+GVV++IT +CS+G+LK C CDP++ G  KD+ G F WGGCSD+I +G+K +  F+D  ++K +  +ALMN HNNR GR+ V +   ++CKCHGVSG+C+LRTCW  M DFR+ GD L + YN   +V  N      T +  RF++P+K  LVY +NS DYCI+D   G PGT GR CN TS   DSC+ +CC RG+ T  +     C+CKF WCC VRC+ C   + V+ CK
Sbjct:   18 WLVPEVSSSWWYMRATGTSRVMCDNVPGLVSRQRQLCHRHPDVMRAIGLGVAEWTAECQHQFRQHRWNCDTLDRDH-----SLFGRLLLRSSRESAFVYAISSAGVVFAITRACSQGELKSCSCDPKKKGTAKDSRGTFDWGGCSDNIDYGVKFARAFVDAKEKKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDRDAGSPGTAGRVCNLTSRGMDSCEVMCCGRGYDTSRVTRMTKCECKFHWCCAVRCQDCLEALDVHTCK 348          
BLAST of Wnt2-1 vs. UniProt/SwissProt
Match: sp|Q98SN7|WNT2B_CHICK (Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 4.469e-92
Identity = 145/320 (45.31%), Postives = 200/320 (62.50%), Query Frame = 3
Query:  585 KQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNC-TFNKS---FPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            + IC  I    +K++ LC  YP++M S+  GAK  + EC  QF++ RWNC T ++    F ++M         RS +E AF+++I S+GVVY+IT +CS+G+LK C CDP + G+ KD  G+F WGGCSD+I +G++ +  F+D  ++K +  +ALMN HNNR GR  V +    +CKCHGVSG+C+LRTCW  M+DFR+ GD L+K YN   +V  N      T +   FR+P+K  LVY +NS DYC+ D S G  GT GR CN  S   D C+ +CC RG+ T  +     C+CKF WCC VRCK C   V V+ CK
Sbjct:   63 RVICDNIPGLVNKQRQLCQRYPDIMQSVGEGAKEWIRECQYQFRHHRWNCSTLDRDHTVFGRVML--------RSSREAAFVYAISSAGVVYAITRACSQGELKACGCDPLKRGRAKDERGEFDWGGCSDNINYGIRFAKAFVDAKEKKVKDARALMNLHNNRCGRMAVKRFLKLECKCHGVSGSCTLRTCWLAMSDFRKTGDYLQKKYNGAIQVIMNQDGTGFTVANKNFRKPTKTDLVYFENSPDYCVMDKSAGSLGTAGRVCNKVSRGTDGCEVMCCGRGYDTTRVTRVTKCECKFHWCCAVRCKECEDTVDVHTCK 374          
BLAST of Wnt2-1 vs. UniProt/SwissProt
Match: sp|Q2QL96|WNT2_MONDO (Protein Wnt-2 OS=Monodelphis domestica OX=13616 GN=WNT2 PE=3 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 4.779e-92
Identity = 143/336 (42.56%), Postives = 203/336 (60.42%), Query Frame = 3
Query:  528 WIVKTLPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNC-TFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            W+   +  ++       + + +C  +    S+++ LC  +P +M SI  G      EC  QF+  RWNC T ++       N   ++  RS +E AF+++I S+GVV++IT +CS+G+LK C CDP++ G  KD+ G F WGGCSD+I +G+K +  F+D  +RK +  +ALMN HNNR GR+ V +   ++CKCHGVSG+C+LRTCW  M DFR+ GD L K YN   +V  N      T +  RF++P+K  LVY +NS DYCI+D   G  GT GR CN TS   DSC+ +CC RG+ T  +     C+CKF WCC VRC+ C   V V+ CK
Sbjct:   19 WVTPQVSSSWWYMRAVGSSRVMCDNVPGLVSRQRQLCHRHPEVMRSIGLGVAEWTAECQHQFRQHRWNCHTLDRDH-----NLFGKVLLRSSREAAFVYAISSAGVVFAITRACSQGELKSCSCDPKKKGTSKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWKKYNGAIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDRDAGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSRVTRMTKCECKFHWCCAVRCQDCLEVVDVHTCK 349          
BLAST of Wnt2-1 vs. UniProt/SwissProt
Match: sp|Q2QL76|WNT2_DIDVI (Protein Wnt-2 OS=Didelphis virginiana OX=9267 GN=WNT2 PE=3 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 4.779e-92
Identity = 143/336 (42.56%), Postives = 203/336 (60.42%), Query Frame = 3
Query:  528 WIVKTLPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNC-TFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            W+   +  ++       + + +C  +    S+++ LC  +P +M SI  G      EC  QF+  RWNC T ++       N   ++  RS +E AF+++I S+GVV++IT +CS+G+LK C CDP++ G  KD+ G F WGGCSD+I +G+K +  F+D  +RK +  +ALMN HNNR GR+ V +   ++CKCHGVSG+C+LRTCW  M DFR+ GD L K YN   +V  N      T +  RF++P+K  LVY +NS DYCI+D   G  GT GR CN TS   DSC+ +CC RG+ T  +     C+CKF WCC VRC+ C   V V+ CK
Sbjct:   19 WVTPQVSSSWWYMRAVGSSRVMCDNVPGLVSRQRQLCHRHPEVMRSIGLGVAEWTAECQHQFRQHRWNCHTLDRDH-----NLFGKVLLRSSREAAFVYAISSAGVVFAITRACSQGELKSCSCDPKKKGTSKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWKKYNGAIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDRDAGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSRVTRMTKCECKFHWCCAVRCQDCLEVVDVHTCK 349          
BLAST of Wnt2-1 vs. TrEMBL
Match: D2D4A7 (Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 729.939 bits (1883), Expect = 0.000e+0
Identity = 365/365 (100.00%), Postives = 365/365 (100.00%), Query Frame = 3
Query:  447 MLKISIRXXXXXXXXXXXXXXESFPKHWIVKTLPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCKHLE 1541
            MLKISIRILVIFLHLVLVFIHESFPKHWIVKTLPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCKHLE
Sbjct:    1 MLKISIRILVIFLHLVLVFIHESFPKHWIVKTLPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCKHLE 365          
BLAST of Wnt2-1 vs. TrEMBL
Match: Q589S1 (Protein Wnt (Fragment) OS=Dugesia japonica OX=6161 GN=DjwntB PE=2 SV=1)

HSP 1 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 296/328 (90.24%), Postives = 313/328 (95.43%), Query Frame = 3
Query:  513 SFPKHWIVKTLPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCK 1496
            SFPKHWIVK+LPITF SPFQ N+IKQIC +I EESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFK+ERWNCTFN+SFP +MT+HLHEMT RSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKD  GDFTWGGCSDHIKFGMKVSTIFLDN+DRKDQTG++LMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKV+YNPFQKSLTFS+N+FRRPSKK+LVYI+ SQDYCIQD +IGHPGTGGRECNYTSSQHDSC ELCC+RGH  YEMVVEENCDCKFFWCCEV  K
Sbjct:   25 SFPKHWIVKSLPITFNSPFQTNDIKQICPMIFEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKFERWNCTFNESFPNMMTHHLHEMTVRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDGSGDFTWGGCSDHIKFGMKVSTIFLDNHDRKDQTGRSLMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVSYNPFQKSLTFSRNQFRRPSKKRLVYIEQSQDYCIQDLTIGHPGTGGRECNYTSSQHDSCSELCCNRGHYAYEMVVEENCDCKFFWCCEVDAK 352          
BLAST of Wnt2-1 vs. TrEMBL
Match: B0LMG0 (Protein Wnt OS=Schmidtea mediterranea OX=79327 GN=wnt2-1 PE=2 SV=1)

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 296/296 (100.00%), Postives = 296/296 (100.00%), Query Frame = 3
Query:  654 MMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCKHLE 1541
            MMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCKHLE
Sbjct:    1 MMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCKHLE 296          
BLAST of Wnt2-1 vs. TrEMBL
Match: T1DBK4 (Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 247/337 (73.29%), Postives = 287/337 (85.16%), Query Frame = 3
Query:  525 HWIVKTLPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCKH 1535
            HW+VKTLP+   +    N++++IC++IS E SKEK LCL+YP MM+SI+YGAK+GL EC +QFK+ERWNCTFN S+P     +LHE+T+R++KETAFL+SIWSSGVVYSITNSCSKG LKECYCDP+RHGQDKD+VGDFTWGGCSDHIKFGMKV  IFLDNY  K   G  L N HNNRVGRR+VWKTRLKKCKCHGVSGACSLRTCWQRMNDF+ IG+ LKK+Y K QKV+YNPFQK L   +N FRRPSK+KLVY ++S D+C +D  IGHPGTGGRECN TS +HDSC +LCC+RGH TYEM+VEENCDCKFFWCCEVRCKICRRK FVYRC+H
Sbjct:   28 HWLVKTLPLPINNIVHNNDMRKICAVISSEFSKEKTLCLSYPEMMLSIIYGAKIGLGECGEQFKFERWNCTFNYSYPDKTLRNLHEITSRNIKETAFLYSIWSSGVVYSITNSCSKGHLKECYCDPKRHGQDKDSVGDFTWGGCSDHIKFGMKVGRIFLDNYSHKSIDGAVLANLHNNRVGRRIVWKTRLKKCKCHGVSGACSLRTCWQRMNDFKVIGETLKKMYQKSQKVSYNPFQKDLILDRNPFRRPSKRKLVYFNDSPDFCTEDLIIGHPGTGGRECNDTSKEHDSCSDLCCNRGHHTYEMIVEENCDCKFFWCCEVRCKICRRKKFVYRCRH 364          
BLAST of Wnt2-1 vs. TrEMBL
Match: A0A2T7NT69 (Protein Wnt OS=Pomacea canaliculata OX=400727 GN=C0Q70_14843 PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 1.002e-94
Identity = 146/331 (44.11%), Postives = 203/331 (61.33%), Query Frame = 3
Query:  564 PFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCT--------FNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            P   +    +C  I     +++ LC  +P++MVS+  GA+LG+ EC  QF+ +RWNCT        F K   K  + HL        +E AF+++I ++GVV++IT +CSKG L+ C CDP + G+ +D  G F WGGCSD++ FG + S +F+D  +RK +  +ALMN HNNR GRR V K R  +CKCHGVSG+C++RTCW  M +FRR+G+ LK  +N   +V  N     L  +    +RP++  LVY + S DYC+ DPS+G  GT GR CN TS   D C  +CC RG+ T  +   + C+CKF WCC VRCK CRR V V+ CK
Sbjct:   25 PLHASGAGVLCDNIPGLVVRQRRLCHLHPDVMVSLADGARLGVEECQYQFRSQRWNCTTLHRDASVFGKVMLKETSKHLLSPLVLGSREAAFVYAISAAGVVHAITRACSKGQLQHCACDPGKRGKGQDKRGSFDWGGCSDNVGFGSRFSRMFIDAKERKTRDARALMNLHNNRAGRRAVKKFRKLECKCHGVSGSCTVRTCWLAMQEFRRVGNYLKTKHNGATQVMINQDGSGLIVANQNHKRPTRSDLVYFEKSPDYCVNDPSVGSLGTAGRLCNKTSLGTDGCDIMCCGRGYDTKTVRKVDKCECKFHWCCFVRCKECRRWVDVHTCK 355          
BLAST of Wnt2-1 vs. Ensembl Cavefish
Match: wnt2ba (protein Wnt-2b-like [Source:NCBI gene;Acc:103029625])

HSP 1 Score: 275.404 bits (703), Expect = 3.419e-87
Identity = 138/322 (42.86%), Postives = 194/322 (60.25%), Query Frame = 3
Query:  579 NIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTF----NKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
              + IC  I    +K++ LC  +P++M SI  GA   + EC  QF++ RWNC+     +  F ++M         RS +E AF+++I S+GVVY+IT +CS G+LK C CD  + G+  D +GDF WGGCSD+I +G+K +  F+D  +R  +  +ALMN HNNR GR  V +    +CKCHGVSG+C+LRTCW  M+DFRR GD L+K YN   +VT N        +   F+  +K  LVY+++S DYC+ D + G  GT GR CN +S   D C+ +CC RG+ T  +     C+CKF WCC V C+ C   V V+ CK
Sbjct:   40 GARVICDNIPGLVNKQRQLCQRHPDLMQSIGEGANEWIRECQHQFRHHRWNCSTLERDHTVFGRVML--------RSSREAAFVYAISSAGVVYAITRACSLGELKICSCDTHKRGRASDEMGDFDWGGCSDNINYGIKFAKAFVDARERMVKDARALMNLHNNRCGRMAVKRFMKLQCKCHGVSGSCALRTCWLAMSDFRRTGDYLRKKYNTAVEVTMNQDGTGFMAADRNFKGTTKNDLVYVESSPDYCLMDRTAGSLGTAGRVCNKSSRGMDGCEVMCCGRGYDTTRVKRVSKCECKFKWCCAVECRDCEDTVDVHTCK 353          
BLAST of Wnt2-1 vs. Ensembl Cavefish
Match: wnt2bb (wingless-type MMTV integration site family, member 2Bb [Source:ZFIN;Acc:ZDB-GENE-060824-6])

HSP 1 Score: 279.641 bits (714), Expect = 1.758e-86
Identity = 139/318 (43.71%), Postives = 196/318 (61.64%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNC-TFNKS---FPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            IC  I    +K++ LC  +P++M SI  G +  + EC  QF++ RWNC T ++    F ++M         RS +E AF+++I S+GVVY+IT +CS+G+LK C CDP + G+ +D  G+F WGGCSD+I +G+K +  F+D  +R  +  +AL+N HNNR GR  V +    +CKCHGVSG+C+LRTCW  M+DFR+ GD L+K YN   +VT N      T +   FR  +K  LVY +NS DYC+ D + G  GT GR CN +S   D C+ +CC RG+ T  +     C+CKF WCC V CK C   V ++ CK
Sbjct:  238 ICDNIPGLVNKQRQLCQKHPDVMQSISEGGQEWIRECQHQFRHHRWNCSTLDRDHTVFGRVMQ--------RSSREAAFVYAISSAGVVYAITRACSQGELKPCNCDPHKLGKARDERGEFDWGGCSDNINYGIKFAKDFIDAKERTVKDARALVNLHNNRCGRMSVKRFMKLECKCHGVSGSCTLRTCWLAMSDFRKTGDYLRKKYNGAIEVTVNQDGTGFTVANKDFRNATKNDLVYFENSPDYCLMDKAAGSLGTAGRICNKSSRGTDGCEVMCCGRGYDTTRVKRITKCECKFKWCCAVECKDCEEAVDIHTCK 547          
BLAST of Wnt2-1 vs. Ensembl Cavefish
Match: bcl2l13 (BCL2 like 13 [Source:NCBI gene;Acc:103033661])

HSP 1 Score: 269.24 bits (687), Expect = 3.411e-84
Identity = 128/309 (41.42%), Postives = 187/309 (60.52%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVF 1517
            +C  I    +K++ LC  +P +M ++  G K  + EC  QF+  RWNC   +    +      ++  R  +E AF+++I S+G+V+++T +CS+G+L  C CD  + G  +DN G F WGGCSDH+   +K +  F+D  DRK++  +A+MN HNNR GR+ V +    +CKCHGVSG+C++RTCW  M DFR+ GD L K YN   +V  N +     F+  +F++ +K  LVY ++S DYCI D   G  GTGGR CN TS   DSC+ +CC RG+ T  +     C+CKF WCC V C+ C  +VF
Sbjct:   38 MCDNIPGLVNKQRQLCRQHPRVMQAVGTGVKDWISECQHQFRSHRWNCNTAERDHTV----FGKLLLRGSREAAFVYAISSAGMVHTLTRACSQGELDTCACDQGKKGSSRDNKGSFDWGGCSDHVDHAIKFTQAFVDAKDRKERDARAIMNLHNNRAGRKAVKRFMTLECKCHGVSGSCNVRTCWLAMGDFRQTGDYLHKKYNSAVQVVMNRY--GTGFTSRKFKKATKNDLVYFEDSPDYCIGDHDSGSVGTGGRVCNRTSHGADSCEVMCCGRGYDTSRVSRTTKCECKFHWCCAVHCRDCHEEVF 340          
BLAST of Wnt2-1 vs. Ensembl Cavefish
Match: wnt16 (Wnt family member 16 [Source:NCBI gene;Acc:107197694])

HSP 1 Score: 239.195 bits (609), Expect = 2.202e-73
Identity = 122/311 (39.23%), Postives = 185/311 (59.49%), Query Frame = 3
Query:  615 SSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQ----ALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRP-SKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            S+K+K++C   P ++ S+  GA+LG+ EC  QF++ERWNC+  +  P    N L    T   KETAF+++I ++G+V+++T SCS G++ EC CD    G      G + WGGCSD I +G   S  F+DN  +   T       +MNQHN+  GR+ + KT    C+CHGVSG+C+++TCW+ +  F R+G  LK+ Y    +V     +K     K + R P S+++ ++++ S +YC++D  +G  GT GR CN TS+  D C  LCC RG+ T+ +   E C+CKF WCC VRC+ C     ++ CK
Sbjct:   51 SAKQKDVCRRKPYLLASVAEGARLGVSECRTQFRHERWNCSTTRE-PPGFGNEL----TSGTKETAFIYAIMAAGLVHAVTRSCSAGNMTECSCDTTLGGSGSPTEG-WHWGGCSDDIAYGTWFSRRFIDNMPKNVSTNGDDTLLVMNQHNSEAGRQAIAKTMSTDCRCHGVSGSCAVKTCWRTIAPFERVGSYLKERYENSVQVMDRSKRKFRRKEKEQRRTPISREEFIFLNKSPNYCLEDRRLGVAGTRGRRCNRTSAGPDGCNLLCCGRGYNTHVVRHVERCECKFVWCCYVRCRRCETMNDIHTCK 355          
BLAST of Wnt2-1 vs. Ensembl Cavefish
Match: wnt16 (Wnt family member 16 [Source:NCBI gene;Acc:107197694])

HSP 1 Score: 238.81 bits (608), Expect = 2.709e-73
Identity = 122/311 (39.23%), Postives = 185/311 (59.49%), Query Frame = 3
Query:  615 SSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQ----ALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRP-SKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            S+K+K++C   P ++ S+  GA+LG+ EC  QF++ERWNC+  +  P    N L    T   KETAF+++I ++G+V+++T SCS G++ EC CD    G      G + WGGCSD I +G   S  F+DN  +   T       +MNQHN+  GR+ + KT    C+CHGVSG+C+++TCW+ +  F R+G  LK+ Y    +V     +K     K + R P S+++ ++++ S +YC++D  +G  GT GR CN TS+  D C  LCC RG+ T+ +   E C+CKF WCC VRC+ C     ++ CK
Sbjct:   53 SAKQKDVCRRKPYLLASVAEGARLGVSECRTQFRHERWNCSTTRE-PPGFGNEL----TSGTKETAFIYAIMAAGLVHAVTRSCSAGNMTECSCDTTLGGSGSPTEG-WHWGGCSDDIAYGTWFSRRFIDNMPKNVSTNGDDTLLVMNQHNSEAGRQAIAKTMSTDCRCHGVSGSCAVKTCWRTIAPFERVGSYLKERYENSVQVMDRSKRKFRRKEKEQRRTPISREEFIFLNKSPNYCLEDRRLGVAGTRGRRCNRTSAGPDGCNLLCCGRGYNTHVVRHVERCECKFVWCCYVRCRRCETMNDIHTCK 357          
BLAST of Wnt2-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010914.1 (pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 gene:ENSPMAG00000009890.1 transcript:ENSPMAT00000010914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.009 bits (554), Expect = 7.606e-66
Identity = 120/350 (34.29%), Postives = 184/350 (52.57%), Query Frame = 3
Query:  546 PITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKD---------------------QTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            P  +    QP     +C L+   S  ++ LC  Y + +  I  GA+L + EC  QF+  RWNC+  +       +    +T    +ETAF  +I ++GV ++++ +C +G+L  C C   R  + ++   D+ WGGC D++++G + +  F+D  +R+                      +  + LMN HNN  GRR V+      CKCHGVSG+CSL+TCW ++ DFR++G  LK+ Y+           K L  +  +F  PS   LVY+D S DYC+++ + G  GT GR CN TS   D C+ +CC RG+  ++  V E C+CKF WCC V+CK C   V  + CK
Sbjct:   38 PEAYLLSAQP-----LCQLVGL-SPGQRKLCHLYQDHVPHIADGARLAVRECQHQFRTRRWNCSAGEG-----DSVFGRLTHIGSRETAFAHAISAAGVAHAVSRACREGELATCGC--SRAPRPRELQRDWLWGGCGDNLEYGYRFAREFVDAREREQGGQQQQQQQQQQQQLAARHSVEHSRTLMNLHNNEAGRRAVYGLADVACKCHGVSGSCSLKTCWLQLADFRKVGKFLKEKYDSASAARAGRRAK-LEPANRKFSPPSAGDLVYLDASPDYCVRNETTGSLGTIGRSCNKTSEGMDGCELMCCGRGYDHFKATVVERCNCKFHWCCYVKCKKCTSVVDRFVCK 373          
BLAST of Wnt2-1 vs. Ensembl Sea Lamprey
Match: wnt3 (wingless-type MMTV integration site family, member 3 [Source:ZFIN;Acc:ZDB-GENE-081003-1])

HSP 1 Score: 210.69 bits (535), Expect = 3.215e-63
Identity = 111/320 (34.69%), Postives = 167/320 (52.19%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNR------FRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +C+ I     K+   C  Y  +M S+  G +LG+ EC  QF+  RWNCT     P I    L     R+ +E +F+ ++ S+GV +++T +C+ G    C CD +  G+     G + WGGCS+   FG+ VS  F D  + +    ++ MN+HNN  GR  +     +KCKCHG+SG+C ++TCW     FR +GD LK  Y+   ++     ++S  + +        F+ P+++ LVY + S ++C      G  GT GR CN TS   D C  LCC RG+ T+     E C C F WCC V C+ C R   ++ CK
Sbjct:   44 LCASIPGLVPKQLRFCRNYQELMPSVAEGVRLGIQECQHQFRGRRWNCTTMTEGPAIFGPVLE----RATREASFVHAVSSAGVGFAVTRACADGTSTICGCDNKHRGEPS---GGWKWGGCSEDADFGVMVSREFADARENRPDA-RSAMNRHNNEAGRVSILDFMQRKCKCHGLSGSCEVKTCWWAQPSFRTVGDHLKDKYDSASEMLVERHRESRGWVETLRPKYPLFKPPAERDLVYYETSPNFCEPSAETGSLGTHGRPCNLTSHGIDGCDLLCCSRGYNTHTERRREKCKCVFHWCCYVSCQECARVYDIHTCK 355          
BLAST of Wnt2-1 vs. Ensembl Sea Lamprey
Match: wnt1 (wingless-type MMTV integration site family, member 1 [Source:NCBI gene;Acc:30128])

HSP 1 Score: 165.236 bits (417), Expect = 3.217e-47
Identity = 89/264 (33.71%), Postives = 137/264 (51.89%), Query Frame = 3
Query:  801 KETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVS-TIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVT-YNPFQKSLTFSKNR------------------FRRPSKKKLVYIDNSQDYCIQDPS-IGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRC 1529
            +ETAF+ ++ S+ + + +  +CS+G +  C CD  R G+      D+ WGGCSD++ FG + +  +     +R  +  +ALM++HN   G R V     ++CKCHG+SG+C+L+TCW R+  FR +GD LK+ ++   +V  Y       +   +R                   + P  + LVY+D S ++C  D + +  PGT GR C   S     C+ LCC RG  + E  V E C C F WCC V C+ C R   V+ C
Sbjct:    6 RETAFIHAVMSAALAHGVARACSEGSIASCTCDYGRRGRGGP---DWEWGGCSDNLPFGTRFARELAAGAGERGGRDARALMDRHNEEAGMRTVDSEMRRECKCHGMSGSCALKTCWLRLPPFRAVGDRLKERFDGATQVADYGREGNRASKDSDRGGGGSGGGGGHLRPADPAHKPPGGRDLVYVDESPEFCHADTAGLSWPGTRGRVCVRGSPGLGGCELLCCGRGWTSREARVSERCLCTFHWCCTVTCQNCTRVETVHEC 266          
BLAST of Wnt2-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001922.1 (pep scaffold:Pmarinus_7.0:GL482023:1913:9516:-1 gene:ENSPMAG00000001738.1 transcript:ENSPMAT00000001922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.229 bits (404), Expect = 8.857e-45
Identity = 108/330 (32.73%), Postives = 161/330 (48.79%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSD-HIKFGMKVSTIFLD----NYDRKDQTGQALMNQHNNRVGRRV--VWKTRLK-KCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKS-------LTFSKNR-FRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            IC+ I   + +++ LC + P++++ I  GA+LG+ EC  QF++ RWNCT         T    E+   +++ T F       G+   I   C  G  +   C     G++    G   W   +    +FG K S+ FL     +Y+ ++     LM +   R       V + ++K +CKCHGVSG+C+ +TCW  +  FR +G  LK  Y     V   P   S       L   K+R +R+P   +LV+ + S +YC +DP+ G  GT GR CN TS   D C  LCC RG+ T++      C+CKF WCC VRC  C  +   Y CK
Sbjct:    6 ICNKIPGLAPRQRALCQSRPDVIIVIGEGAQLGISECQYQFRFGRWNCTALGE----RTVFGQELKV-AIRSTHFTDIQSGGGLFERIHQRCRYGAHELSLCSQLTRGRE----GPHPWLRMTPLDEQFGQKTSSTFLKIVYIHYNYRNSDLAQLMQKVPYRRFHSTDQVLEEKMKLECKCHGVSGSCTTKTCWTTLPKFREVGYALKDKYE--HTVHVEPVSGSRYMRPMFLKVKKSRSYRKPLDTELVFTERSPNYCEEDPATGSAGTRGRLCNRTSPHADGCDLLCCGRGYNTHQYTRAWQCNCKFHWCCYVRCSTCSERTEEYTCK 324          
BLAST of Wnt2-1 vs. Ensembl Sea Lamprey
Match: wnt10a (wingless-type MMTV integration site family, member 10a [Source:NCBI gene;Acc:30171])

HSP 1 Score: 156.762 bits (395), Expect = 9.889e-44
Identity = 101/297 (34.01%), Postives = 142/297 (47.81%), Query Frame = 3
Query:  801 KETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDK------------------------------DNVGD---FTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYN-----KPQKVTYNPF---------------QKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +ETAF +++ ++GV++++ ++CS G LK C CD +  G ++                              D  G    + WGGCS  ++FG K S  FLD+ +       A    HNNRVGRRVV + + +KCKCHG SG+C L+TCWQ   DFR +GD L+  ++      P      P                  S   +  R+R P   +L+Y + S  +C +      PGT GR CN TSS  D C+ +CC RGH        E C+CKF WCC V C+ C    +V  CK
Sbjct:    3 RETAFAYALAAAGVMHAVASACSLGKLKTCGCDEKLKGDEEAFRVKLIKLKMQMLSQGKAAANGVLPHVPADAPGSPDTWEWGGCSHDLEFGEKFSRDFLDSRETSRDI-HARTRLHNNRVGRRVVLEHKRRKCKCHGTSGSCQLKTCWQVSPDFRTVGDTLRDRFHLAAFLAPHNRHGVPALALVSGGGHHHHHQGSSSAQVTGRRYRPPDDGELLYFERSPTFCERGAGSEWPGTQGRVCNRTSSGADGCESMCCGRGHNQISESRMERCNCKFHWCCYVVCEECHSSAWVNVCK 298          
BLAST of Wnt2-1 vs. Ensembl Nematostella
Match: WNT2 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5])

HSP 1 Score: 253.832 bits (647), Expect = 1.928e-79
Identity = 135/317 (42.59%), Postives = 199/317 (62.78%), Query Frame = 3
Query:  585 KQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNC-TFNKS---FPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQ-HDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFV 1520
            K +C+ I+   S ++ +CL  P++MVSI  GAKLG+ EC  QF+ +RWNC T N     F K+M         R+ +ETAF+++I S+GVV+ +T SCS G+LK+C C   R+ + +   G F WGGCSD+I++G+  +  F+D+ +  ++  +ALMN HNN VGRRVV       CKCHGVSG+CS+RTCW+ ++ FR +G  L++ Y    +VT       LT ++  +++PS+  LVY+++S +YC+ D + G  GT GRECN ++S    +C  LCC RG  T ++  E  C CKF WCC V+C+ CRR    
Sbjct:   39 KVMCNSITGLISIQRQMCLDNPDVMVSIGKGAKLGVEECQHQFRDQRWNCSTVNGDATVFGKVMR--------RASRETAFVYAISSAGVVHEVTRSCSLGELKDCSC---RNKKGRSRKG-FEWGGCSDNIQYGLNFAKAFVDSRE-VEKDARALMNLHNNHVGRRVVKTNMSLDCKCHGVSGSCSVRTCWKSISSFRIVGQHLREKYTTAVQVTVGQSGGELTNAEVSYKKPSRDDLVYLEDSPNYCMVDSNTGSLGTSGRECNGSASDTTGACSLLCCGRGFNTIQIEEEYKCHCKFHWCCYVKCQTCRRTTLA 342          
BLAST of Wnt2-1 vs. Ensembl Nematostella
Match: WNT3 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RXF5])

HSP 1 Score: 244.588 bits (623), Expect = 4.731e-76
Identity = 121/334 (36.23%), Postives = 199/334 (59.58%), Query Frame = 3
Query:  540 TLPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNP---FQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            TL    +    P     +C +  + +S+++ +C   P++M  + +GAK G+ EC  QF+  RWNC+  +    +  + L    ++  +E AF+ ++ ++GV +S+T++CSKG ++ C CD    G+       +TW GC+ +IKFG+  S  F +  +R     Q +MN+HN+R GR+ + +   +KCKCHG+SG+CS++TCW +  +FR+IGD LK  Y+   ++T       +K L    + F++PS K L+Y + S +YC ++ ++G  GT GR+CNYTS+  D C+ LCC RGH   +  +  NC+C F WCCEV+C+ C+  V +Y CK
Sbjct:   24 TLGTQLSVSSDPAKKSMLCYVTRQFNSRQQEVCRKNPDLMEHVAHGAKYGVHECRHQFRNRRWNCSTIRESGSLFESVL----SKGCREAAFVHAVTAAGVAHSVTDACSKGRIESCDCDRNLSGRSSKG---WTWSGCNSNIKFGVWFSKQFTEARERGGDLRQ-IMNRHNSRAGRKALEELVWRKCKCHGLSGSCSMKTCWMQQANFRQIGDHLKVKYDSAVEMTTKVNRRGKKRLKPKYSHFKKPSDKDLIYFETSPNYCDKNVTVGSLGTSGRQCNYTSNGIDGCELLCCGRGHNIQQAKITRNCNCVFKWCCEVKCERCKEVVNIYTCK 349          
BLAST of Wnt2-1 vs. Ensembl Nematostella
Match: EDO31000 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54])

HSP 1 Score: 232.261 bits (591), Expect = 2.914e-71
Identity = 135/351 (38.46%), Postives = 198/351 (56.41%), Query Frame = 3
Query:  516 FPKHWIVKTLPITFTSP---FQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCT---FNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDL-KECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTG---QALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQ-KSLTFSKNRFRRP-SKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +   W+  +L +T ++P       N  +I  L++    ++  +C     +M S+  GA + L EC  QF+Y  WNCT   F++S   +  N ++  T    +E AF+ +I S+GV Y++T +CS G L ++C CD +  GQ       F W GCSD I FGM  +T F+D  +R    G   + LMN HNNR GR  V K    +CKCHGVSG+C+++TCW+ + +FR +GD +K+ ++   +V Y     K +   KNR  +P ++  LVY+  S D+C  +P  G  GT GR CN TS   D C  +CC RG+++   V +E C CKFFWCC VRC+ C R+V V  CK
Sbjct:   19 YSSQWL--SLALTGSNPNRFLSKKNCDEIGQLLNH---RQVQVCKRNIQVMDSVKDGASVALFECQHQFRYRPWNCTTVQFSRS--PVFGNSINGGT----REAAFVHAISSAGVAYAVTQACSSGRLGQKCGCDRKTRGQ----ADGFNWAGCSDDIDFGMTFATRFVDARERGSGIGSPARVLMNLHNNRGGRLAVKKFMDLQCKCHGVSGSCNIKTCWRALPNFRIVGDYIKEKFDGATEVEYKLIGGKHVLVPKNRKYKPHTQMDLVYLVQSPDFCEPNPKTGSLGTQGRICNRTSQAIDGCDLMCCGRGYVSRTEVRQEQCACKFFWCCHVRCQTCMRRVEVSYCK 354          
BLAST of Wnt2-1 vs. Ensembl Nematostella
Match: WNT16 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S694])

HSP 1 Score: 228.409 bits (581), Expect = 4.954e-70
Identity = 120/336 (35.71%), Postives = 188/336 (55.95%), Query Frame = 3
Query:  543 LPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQ------TGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            + I+ +     N++   CS +   S ++  +CL  P+++ S+  GA +G+ EC +QFKYERWNC+ +   P +    L        KE+AF+++I S+GVV+++  SCSKG+L EC C+ +R  +++     + WGGCSD++ +G+ +S  F+D  ++ D+        +A+MN HNN  GR  V      +C+CHGVS +C+++TC + +  F  +G+ LK  Y    +  Y   ++ L    N+  R     LVY+D S +YC +D  +G  GT GRECN  SS  D C  LCC  G+ T  +    +C C+F WCC V CK C +    Y CK
Sbjct:    1 MGISASGSISGNSVSPSCSRVPGLSLQQLRMCLQKPDVIPSVSQGANIGIHECKKQFKYERWNCSTSND-PTVFGTLLKIAH----KESAFVYAITSAGVVHAVGKSCSKGNLTECSCESKRGARNQPK--GWEWGGCSDNVNYGVWLSKTFVDAPEKADRRARSQRKARAMMNLHNNEAGREAVLALMRVQCRCHGVSSSCAVKTCSKSLPKFEEVGEALKAEYKDAIRAVYIKRKRKLKRKDNKKLRIPSSSLVYLDESPNYCYRDKKLGIDGTSGRECNKNSSGVDGCDLLCCGSGYNTQTVRSVHSCHCRFIWCCNVVCKKCEKIFDRYTCK 329          
BLAST of Wnt2-1 vs. Ensembl Nematostella
Match: EDO49431 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9])

HSP 1 Score: 221.09 bits (562), Expect = 7.081e-67
Identity = 118/332 (35.54%), Postives = 180/332 (54.22%), Query Frame = 3
Query:  573 PNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKS-------------LTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRC 1529
            PN I+ +       + K+  +   YP ++  I  GA+  + EC  QF+  +WNC+ +        N   ++  R+ +ETAF ++I ++GV ++I  +C +G L  C CD +  G  K     + WGGCSD+I F    S  F+D  + K +  +A +N HNN  GR  V    + +CKCHG+S AC+++TCW+R+ DFR +GD LK+ ++    V Y     +                SK   RRP+   LVY ++S ++C ++PS G  GT GRECN TS   D C+ +CC RG  T      ENC+C+FFWCCEV+C+ C+ +  +  C
Sbjct:   47 PNQIRAL-------TQKQIRISRRYPELIQYIAGGARTAIHECQHQFRNRKWNCSAHSP-----ENVFGKILKRACRETAFTYAITAAGVSHAIARACGEGKLSACSCDQRYRGVSKQG---WQWGGCSDNIHFADNFSKRFVDAQE-KGRDFRAQINLHNNEAGRAAVRNNMIVECKCHGLSEACTVKTCWKRLPDFRLVGDDLKRKFDNASMVEYQQNNNNRNSNRNRNEDPALFIPSKPYLRRPTVYDLVYYEHSPNFCERNPSAGSLGTQGRECNTTSMGTDGCELMCCGRGFTTSSQERVENCNCRFFWCCEVKCQKCKTRRIISNC 362          
BLAST of Wnt2-1 vs. Ensembl Medaka
Match: wnt2bb (wingless-type MMTV integration site family, member 2Bb [Source:NCBI gene;Acc:100529167])

HSP 1 Score: 287.345 bits (734), Expect = 1.445e-91
Identity = 139/314 (44.27%), Postives = 195/314 (62.10%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            IC  I    +K++ LC  +P++M +I  G K  + EC  QF++ RWNC+       +    L     RS +E AF+++I S+GVVY++T +CS+GDL+ C CDP + G+ +D  G+F WGGCSD+I +G+K +  F+D  +R  +  +ALMN HNNR GR  V +    +CKCHGVSG+C+LRTCW  M+DFR+ GD L++ YN   +VT N      T +   FR+ +K  LVY +NS DYC+QD ++G  GT GR CN TS   D C+ +CC RG+ T  +     C+CKF WCC V CK C   V V+ CK
Sbjct:   71 ICDNIPGLVNKQRQLCQRHPDIMQAIGEGTKEWIRECQHQFRHHRWNCSTLDRDHTVFGRVL----LRSSREAAFVYAISSAGVVYALTRACSQGDLRTCNCDPHKRGRARDERGEFDWGGCSDNINYGIKFAKAFIDAKERTVRDARALMNLHNNRCGRTAVKRFMKLECKCHGVSGSCTLRTCWMAMSDFRKTGDFLRRKYNGAIEVTMNQDGTGFTVANKAFRKATKNDLVYFENSPDYCMQDKTVGSLGTAGRVCNKTSRGTDGCEVMCCGRGYDTTRIKQITKCECKFKWCCAVECKDCEEAVDVHTCK 380          
BLAST of Wnt2-1 vs. Ensembl Medaka
Match: wnt2bb (wingless-type MMTV integration site family, member 2Bb [Source:NCBI gene;Acc:100529167])

HSP 1 Score: 287.345 bits (734), Expect = 1.445e-91
Identity = 139/314 (44.27%), Postives = 195/314 (62.10%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            IC  I    +K++ LC  +P++M +I  G K  + EC  QF++ RWNC+       +    L     RS +E AF+++I S+GVVY++T +CS+GDL+ C CDP + G+ +D  G+F WGGCSD+I +G+K +  F+D  +R  +  +ALMN HNNR GR  V +    +CKCHGVSG+C+LRTCW  M+DFR+ GD L++ YN   +VT N      T +   FR+ +K  LVY +NS DYC+QD ++G  GT GR CN TS   D C+ +CC RG+ T  +     C+CKF WCC V CK C   V V+ CK
Sbjct:   71 ICDNIPGLVNKQRQLCQRHPDIMQAIGEGTKEWIRECQHQFRHHRWNCSTLDRDHTVFGRVL----LRSSREAAFVYAISSAGVVYALTRACSQGDLRTCNCDPHKRGRARDERGEFDWGGCSDNINYGIKFAKAFIDAKERTVRDARALMNLHNNRCGRTAVKRFMKLECKCHGVSGSCTLRTCWMAMSDFRKTGDFLRRKYNGAIEVTMNQDGTGFTVANKAFRKATKNDLVYFENSPDYCMQDKTVGSLGTAGRVCNKTSRGTDGCEVMCCGRGYDTTRIKQITKCECKFKWCCAVECKDCEEAVDVHTCK 380          
BLAST of Wnt2-1 vs. Ensembl Medaka
Match: wnt2 (protein Wnt-2 [Source:NCBI gene;Acc:101162030])

HSP 1 Score: 281.182 bits (718), Expect = 1.052e-89
Identity = 134/314 (42.68%), Postives = 188/314 (59.87%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +C  I    +K++ LC  +P +M +I  G K  + EC  QF+  RWNC        +       +  R  +E AFL++I S+GVVY++  +CS+G+L  C CDP + G   D  G F WGGCSDH++  ++ S  F+D  DRK++  +ALMN HNNR GR+ V +    +CKCHGVSG+CS+RTCW  + DFR  GD L++ YN   +VT N +    T +  +FR  SK  LVY+++S DYCI+D   G  GT GR C+ TS   D C+ +CC RGH T  +     C+CKF WCC V C+ C ++V V+ CK
Sbjct:   38 MCDNIPGLVNKQRQLCRQHPKVMQAIGGGMKDWIFECQHQFRSHRWNCNTTARDYSLFG----RLPLRGSREVAFLYAISSAGVVYTLARACSQGELDSCSCDPTKKGSSWDEKGSFDWGGCSDHVEHAVRFSQTFVDAKDRKERDARALMNLHNNRAGRKAVKRFMTLECKCHGVSGSCSVRTCWLALADFRLTGDHLRRRYNSAVQVTVNQYGSGFTAAHTQFRHASKNDLVYLEDSPDYCIRDQESGSAGTAGRLCDRTSRGMDGCEVMCCGRGHDTARVSRTTKCECKFHWCCAVHCRDCHQQVDVHTCK 347          
BLAST of Wnt2-1 vs. Ensembl Medaka
Match: wnt2 (protein Wnt-2 [Source:NCBI gene;Acc:101162030])

HSP 1 Score: 280.796 bits (717), Expect = 2.201e-89
Identity = 134/314 (42.68%), Postives = 188/314 (59.87%), Query Frame = 3
Query:  591 ICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            +C  I    +K++ LC  +P +M +I  G K  + EC  QF+  RWNC        +       +  R  +E AFL++I S+GVVY++  +CS+G+L  C CDP + G   D  G F WGGCSDH++  ++ S  F+D  DRK++  +ALMN HNNR GR+ V +    +CKCHGVSG+CS+RTCW  + DFR  GD L++ YN   +VT N +    T +  +FR  SK  LVY+++S DYCI+D   G  GT GR C+ TS   D C+ +CC RGH T  +     C+CKF WCC V C+ C ++V V+ CK
Sbjct:   51 MCDNIPGLVNKQRQLCRQHPKVMQAIGGGMKDWIFECQHQFRSHRWNCNTTARDYSLFG----RLPLRGSREVAFLYAISSAGVVYTLARACSQGELDSCSCDPTKKGSSWDEKGSFDWGGCSDHVEHAVRFSQTFVDAKDRKERDARALMNLHNNRAGRKAVKRFMTLECKCHGVSGSCSVRTCWLALADFRLTGDHLRRRYNSAVQVTVNQYGSGFTAAHTQFRHASKNDLVYLEDSPDYCIRDQESGSAGTAGRLCDRTSRGMDGCEVMCCGRGHDTARVSRTTKCECKFHWCCAVHCRDCHQQVDVHTCK 360          
BLAST of Wnt2-1 vs. Ensembl Medaka
Match: wnt2ba (protein Wnt-2b-A [Source:NCBI gene;Acc:101164972])

HSP 1 Score: 280.796 bits (717), Expect = 4.221e-89
Identity = 147/343 (42.86%), Postives = 200/343 (58.31%), Query Frame = 3
Query:  537 KTLPITFTSPFQPN-----------NIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCK 1532
            K++ I F   F P              + IC  I    +K++ LC  +P++M SI  GAK  + EC  QF+ +RWNC+       +       +  RS +E AF+++I S+GVVY+IT +CS+G+LK C CD  + G   DN G+F WGGCSD+I FG+K +  F+D  ++  +  +ALMN HNNR GR  V +    KCKCHGVSG+CSLRTCW  M+DFR  GD L K YN   +VT N        +   F+  +K +LVY+++S DYCI+D   G  GT GRECN  S   D C+ +CC RG+ T  +    +CDCKF WCC V CK+C   V V+ CK
Sbjct:   21 KSIFILFLLIFTPKVDSSWWYIGALGARVICDNIPGLVNKQRQLCQKHPDLMQSISDGAKEWIKECQHQFRQQRWNCSTMDRDHTV----FGRVILRSSQEAAFVYAISSAGVVYAITRACSQGELKICSCDSHKRGLGSDNNGEFEWGGCSDNINFGIKFAKAFVDAREKMVKDARALMNLHNNRCGRMAVKRFMKLKCKCHGVSGSCSLRTCWLAMSDFRLTGDYLHKKYNNAIEVTMNQDGTGFMVADKDFKGSTKNELVYVESSPDYCIKDSKTGTLGTDGRECNKFSRGLDGCEVMCCGRGYDTMPVKRVTSCDCKFKWCCSVECKVCEDVVDVHICK 359          
BLAST of Wnt2-1 vs. Planmine SMEST
Match: SMESG000002069.1 (SMESG000002069.1)

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 363/365 (99.45%), Postives = 363/365 (99.45%), Query Frame = 3
Query:  447 MLKISIRXXXXXXXXXXXXXXESFPKHWIVKTLPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRCKHLE 1541
            MLKISIRILVIFLHLVLVFIHESFPKHWIVKTLPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQ LMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKIC RKVFVYRCKHLE
Sbjct:    1 MLKISIRILVIFLHLVLVFIHESFPKHWIVKTLPITFTSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQTLMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICSRKVFVYRCKHLE 365          
BLAST of Wnt2-1 vs. Planmine SMEST
Match: SMESG000055035.1 (SMESG000055035.1)

HSP 1 Score: 208.379 bits (529), Expect = 1.258e-61
Identity = 116/346 (33.53%), Postives = 185/346 (53.47%), Query Frame = 3
Query:  528 WIVKTLPITFTSPFQPNN---IKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRK-------DQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPG--TGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRC 1529
            W ++ LP    SP    +   IK+IC  +S  S  +  +C  Y + M ++  GA++G+ EC +Q KY +WNC+   +     ++     T  S KE AF  +I ++GVV++I  SC +G L  C C  +   +D     D+ WGGC D++K+    +  F+D  +++       +     ++N HNN  GR  V+K     CKCHGVSG+CSLR+CW+++  F +IG  + + Y+  ++V +N     L       ++    +L+Y  NS DYC  + S  H G  T GREC     + + C+ LCC+R + T+   V E C CKF WCC+++C++C R   V+ C
Sbjct:   33 WTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHN-----SDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHR--DWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYC--ELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 369          
BLAST of Wnt2-1 vs. Planmine SMEST
Match: SMESG000067888.1 (SMESG000067888.1)

HSP 1 Score: 204.912 bits (520), Expect = 9.648e-61
Identity = 117/342 (34.21%), Postives = 182/342 (53.22%), Query Frame = 3
Query:  558 TSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCT-FNKSFP---------KIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDR---KDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSS-QHD----SCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRC 1529
            ++ F  NN    C+ + +    ++++CL +  ++ S+++G  +G+ EC  QF    WNC   N S P         K    +L  +  + + E+AFL S+ S+ V + ++ +CS G  K C CD   +   +DN   F W GCSD++ FG   S  FLD+  +   K      L+N HN+  G ++V    + KCKCHGVSG+C  +TC++ + D R++GD+LK+ ++K   V  N F+  L    +   R ++  L Y+  S ++C  +PS G  GT GR CN T   +H+    SC  LCC RG  T + +V+E C CKF WCC V+C+ C       RC
Sbjct:    6 STKFDLNNTNIFCNQLMK---LQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDN---FQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK--LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRC 339          
BLAST of Wnt2-1 vs. Planmine SMEST
Match: SMESG000067888.1 (SMESG000067888.1)

HSP 1 Score: 204.912 bits (520), Expect = 2.101e-60
Identity = 117/342 (34.21%), Postives = 182/342 (53.22%), Query Frame = 3
Query:  558 TSPFQPNNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCT-FNKSFP---------KIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDR---KDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSS-QHD----SCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRC 1529
            ++ F  NN    C+ + +    ++++CL +  ++ S+++G  +G+ EC  QF    WNC   N S P         K    +L  +  + + E+AFL S+ S+ V + ++ +CS G  K C CD   +   +DN   F W GCSD++ FG   S  FLD+  +   K      L+N HN+  G ++V    + KCKCHGVSG+C  +TC++ + D R++GD+LK+ ++K   V  N F+  L    +   R ++  L Y+  S ++C  +PS G  GT GR CN T   +H+    SC  LCC RG  T + +V+E C CKF WCC V+C+ C       RC
Sbjct:   38 STKFDLNNTNIFCNQLMK---LQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDN---FQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFK--LVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRC 371          
BLAST of Wnt2-1 vs. Planmine SMEST
Match: SMESG000066476.1 (SMESG000066476.1)

HSP 1 Score: 201.06 bits (510), Expect = 1.637e-58
Identity = 122/332 (36.75%), Postives = 172/332 (51.81%), Query Frame = 3
Query:  624 EKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNC------------------TFNKSFPK----IMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDR---KDQTGQALMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQ-----HDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICRRKVFVYRC 1529
            +K LC  +  +M S+V G  LG+ EC  QF    WNC                  T+ +  PK    +   ++ ++  +S  E+AF+ SI S+GV Y +T +CS+G    C CD   +   KD+   FTW GCS +I FG   S  FLD  ++   K QT  AL N HNN VGR  V    + KCKCHGVSG+C +RTC + +  FR +GD LK+ + K  +V +  F   L          ++  ++Y+++S D+C  D   G  GT GR CN T +       +SC  LCC RG+     + +E C CKF WCC+V C+ C+RKV    C
Sbjct:   74 QKPLCEEHFPLMPSVVSGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDS--KFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDF--FDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAIC 401          
The following BLAST results are available for this feature:
BLAST of Wnt2-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WNT2B8.157e-9042.55Wnt family member 2B [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT28.263e-9043.49Wnt family member 2 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WNT2B1.993e-8942.55Wnt family member 2B [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT2B3.077e-8443.58Wnt family member 2B [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT5A3.662e-7437.94Wnt family member 5A [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Wnt2-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cwn-24.508e-6334.82pep chromosome:WBcel235:IV:10067824:10070251:1 gen... [more]
egl-201.246e-6232.16Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05][more]
cwn-17.399e-6034.51pep chromosome:WBcel235:II:130983:133598:-1 gene:W... [more]
mom-22.567e-5533.05pep chromosome:WBcel235:V:8355988:8358185:1 gene:W... [more]
mom-22.567e-5533.05pep chromosome:WBcel235:V:8355953:8358185:1 gene:W... [more]
back to top
BLAST of Wnt2-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt21.074e-5132.39gene:FBgn0004360 transcript:FBtr0088512[more]
Wnt21.107e-5133.23gene:FBgn0004360 transcript:FBtr0339383[more]
Wnt64.478e-4340.00gene:FBgn0031902 transcript:FBtr0334800[more]
Wnt64.478e-4340.00gene:FBgn0031902 transcript:FBtr0303251[more]
Wnt42.454e-4129.66gene:FBgn0010453 transcript:FBtr0334799[more]
back to top
BLAST of Wnt2-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt2bb1.039e-9044.94wingless-type MMTV integration site family, member... [more]
wnt2ba3.890e-9044.97wingless-type MMTV integration site family, member... [more]
wnt2bb5.172e-9044.62wingless-type MMTV integration site family, member... [more]
wnt23.139e-8943.31wingless-type MMTV integration site family member ... [more]
wnt23.139e-8943.31wingless-type MMTV integration site family member ... [more]
back to top
BLAST of Wnt2-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WNT2B1.290e-9244.90Wnt family member 2B [Source:NCBI gene;Acc:1004917... [more]
WNT2B2.991e-9243.99Wnt family member 2B [Source:NCBI gene;Acc:1004917... [more]
WNT23.194e-9142.36Wnt family member 2 [Source:NCBI gene;Acc:10003826... [more]
WNT24.405e-9139.37Wnt family member 2 [Source:NCBI gene;Acc:10003826... [more]
ENSXETT00000050987.11.397e-7438.58Wnt family member 5A [Source:NCBI gene;Acc:1017343... [more]
back to top
BLAST of Wnt2-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt22.482e-9143.81wingless-type MMTV integration site family, member... [more]
Wnt2b1.996e-8942.45wingless-type MMTV integration site family, member... [more]
Wnt5b3.582e-7538.39wingless-type MMTV integration site family, member... [more]
Wnt5b3.582e-7538.39wingless-type MMTV integration site family, member... [more]
Wnt5b5.226e-7538.94wingless-type MMTV integration site family, member... [more]
back to top
BLAST of Wnt2-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q07E18|WNT2_MUSPF1.172e-9244.13Protein Wnt-2 OS=Mustela putorius furo OX=9669 GN=... [more]
sp|A1X153|WNT2_ECHTE2.889e-9241.67Protein Wnt-2 OS=Echinops telfairi OX=9371 GN=WNT2... [more]
sp|Q98SN7|WNT2B_CHICK4.469e-9245.31Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B P... [more]
sp|Q2QL96|WNT2_MONDO4.779e-9242.56Protein Wnt-2 OS=Monodelphis domestica OX=13616 GN... [more]
sp|Q2QL76|WNT2_DIDVI4.779e-9242.56Protein Wnt-2 OS=Didelphis virginiana OX=9267 GN=W... [more]
back to top
BLAST of Wnt2-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D2D4A70.000e+0100.00Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=... [more]
Q589S10.000e+090.24Protein Wnt (Fragment) OS=Dugesia japonica OX=6161... [more]
B0LMG00.000e+0100.00Protein Wnt OS=Schmidtea mediterranea OX=79327 GN=... [more]
T1DBK40.000e+073.29Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 ... [more]
A0A2T7NT691.002e-9444.11Protein Wnt OS=Pomacea canaliculata OX=400727 GN=C... [more]
back to top
BLAST of Wnt2-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt2ba3.419e-8742.86protein Wnt-2b-like [Source:NCBI gene;Acc:10302962... [more]
wnt2bb1.758e-8643.71wingless-type MMTV integration site family, member... [more]
bcl2l133.411e-8441.42BCL2 like 13 [Source:NCBI gene;Acc:103033661][more]
wnt162.202e-7339.23Wnt family member 16 [Source:NCBI gene;Acc:1071976... [more]
wnt162.709e-7339.23Wnt family member 16 [Source:NCBI gene;Acc:1071976... [more]
back to top
BLAST of Wnt2-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010914.17.606e-6634.29pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 g... [more]
wnt33.215e-6334.69wingless-type MMTV integration site family, member... [more]
wnt13.217e-4733.71wingless-type MMTV integration site family, member... [more]
ENSPMAT00000001922.18.857e-4532.73pep scaffold:Pmarinus_7.0:GL482023:1913:9516:-1 ge... [more]
wnt10a9.889e-4434.01wingless-type MMTV integration site family, member... [more]
back to top
BLAST of Wnt2-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Wnt2-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
WNT21.928e-7942.59Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5][more]
WNT34.731e-7636.23Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RXF5][more]
EDO310002.914e-7138.46Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54][more]
WNT164.954e-7035.71Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S694][more]
EDO494317.081e-6735.54Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9][more]
back to top
BLAST of Wnt2-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt2bb1.445e-9144.27wingless-type MMTV integration site family, member... [more]
wnt2bb1.445e-9144.27wingless-type MMTV integration site family, member... [more]
wnt21.052e-8942.68protein Wnt-2 [Source:NCBI gene;Acc:101162030][more]
wnt22.201e-8942.68protein Wnt-2 [Source:NCBI gene;Acc:101162030][more]
wnt2ba4.221e-8942.86protein Wnt-2b-A [Source:NCBI gene;Acc:101164972][more]
back to top
BLAST of Wnt2-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002069.10.000e+099.45SMESG000002069.1[more]
SMESG000055035.11.258e-6133.53SMESG000055035.1[more]
SMESG000067888.19.648e-6134.21SMESG000067888.1[more]
SMESG000067888.12.101e-6034.21SMESG000067888.1[more]
SMESG000066476.11.637e-5836.75SMESG000066476.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30026602
GenBankACJ64868.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026602 ID=SMED30026602|Name=Wnt2-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1718bp
TATATAAATCTTATATGATTGAATAAAAAATTTCCCCACTGAAAGGCAAA
TGTATAATTTTCAGGGAAATTGAAATATTTTTTCCCAACAGCCTAACAAA
CCGTCTAGATATTTGTATAATTTAGCGCAGATACACAGCTAAACATTTGG
TTTCACCAAGTATCCAACTGAGATTTGCAGATTTTCCCCGTTATATATCC
AATTCAGCATCACCGGGAAATAGGCAAGGTAAATTATTTTTTAATAAAAA
AAAAATTAGAAGTGTATTTTGACGCGTGACTGAGTTGGTTGATTAAACTG
CAGTGAAGAATCGGACTACCCCATTTGCAGCCGATGCACTTATTAGTTGG
CGTGCGAATTAATATTATTCGTTAATTTTTATACTCGCCCATTCGCCATT
TACATCATTTGAATTCGCGTCAGATTTTGTTTTTCTGAATTAAATCATGC
TTAAAATTTCCATTCGAATTTTGGTAATCTTTCTTCACCTGGTTCTGGTT
TTCATTCACGAATCCTTCCCGAAACACTGGATTGTCAAAACTCTCCCTAT
AACCTTCACTAGTCCCTTTCAGCCGAATAATATCAAACAGATTTGCTCTT
TGATATCTGAGGAATCTTCGAAAGAAAAGAATCTCTGTTTGACTTATCCA
AATATGATGGTATCAATTGTCTACGGTGCCAAATTGGGATTAGTAGAATG
TGCTCAACAATTTAAGTACGAAAGATGGAATTGTACGTTTAACAAATCTT
TTCCAAAAATTATGACCAATCATTTACACGAAATGACAACAAGAAGTGTA
AAAGAAACCGCGTTTTTATTTTCCATTTGGTCATCGGGTGTCGTTTATTC
CATAACAAATTCCTGCAGCAAAGGAGATTTGAAAGAATGCTATTGTGATC
CACAAAGACACGGTCAAGATAAAGATAACGTTGGTGATTTCACATGGGGA
GGATGCAGTGATCATATCAAATTTGGAATGAAAGTGAGTACAATATTCCT
GGATAATTATGACAGAAAAGATCAGACCGGTCAAGCTCTAATGAACCAAC
ACAACAATAGAGTGGGCCGCAGAGTTGTGTGGAAAACCAGGCTTAAAAAA
TGCAAGTGTCACGGAGTAAGTGGAGCCTGCTCACTGAGAACCTGTTGGCA
GAGAATGAATGATTTCCGAAGAATTGGTGACATGCTAAAAAAATTGTATA
ATAAGCCCCAGAAAGTCACTTATAACCCATTTCAGAAATCTCTCACTTTC
AGTAAAAATCGTTTCAGAAGACCTTCGAAAAAAAAATTGGTCTATATTGA
TAACTCTCAAGATTACTGCATTCAAGACCCTTCGATAGGTCACCCGGGGA
CTGGCGGTCGGGAATGCAACTATACATCCTCCCAACATGATTCCTGTCAG
GAGTTGTGCTGCCATCGCGGCCATCTCACCTATGAGATGGTGGTCGAGGA
GAATTGTGATTGCAAATTCTTTTGGTGCTGTGAAGTGAGATGCAAAATCT
GCCGCCGAAAGGTGTTCGTGTATAGATGCAAACATTTAGAATGACGAGAA
ACTCGCCAATCTCAACAATCATATTCCATCTCAATCTATCAATTCATTTT
CTCTCGCTTCATCATTATCAACATTTTTTGATTGACAACAACTATTATTA
CTATAATGATAATAACTATTATTGCTCTCATTGTTATTATTATAATTATT
AATTATTATTATTATTAT
back to top

protein sequence of SMED30026602-orf-1

>SMED30026602-orf-1 ID=SMED30026602-orf-1|Name=SMED30026602-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=366bp
MLKISIRILVIFLHLVLVFIHESFPKHWIVKTLPITFTSPFQPNNIKQIC
SLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNK
SFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYC
DPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRKDQTGQALMN
QHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKL
YNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHP
GTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCK
ICRRKVFVYRCKHLE*
back to top
Aliases
The feature 'Wnt2-1' has the following synonyms
Synonym
Wnt2-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000062esophagus
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000142posterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0000421tail
PLANA:0003001lateral region of the whole animal
PLANA:0003117parapharyngeal cell
PLANA:0003118prepharyngeal cell
PLANA:0007561head margin
Vocabulary: INTERPRO
TermDefinition
IPR043158Wnt_C
IPR005817Wnt
IPR018161Wnt_CS
Vocabulary: biological process
TermDefinition
GO:0016055Wnt signaling pathway
GO:0007275multicellular organism development
Vocabulary: molecular function
TermDefinition
GO:0005102signaling receptor binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005817WntPRINTSPR01349WNTPROTEINcoord: 220..234
score: 76.45
coord: 165..177
score: 56.24
coord: 138..151
score: 44.73
coord: 280..291
score: 52.46
coord: 119..133
score: 44.54
IPR005817WntSMARTSM00097wnt1_3coord: 48..362
e-value: 1.8E-101
score: 353.1
IPR005817WntPFAMPF00110wntcoord: 57..362
e-value: 3.2E-101
score: 339.0
IPR005817WntPANTHERPTHR12027WNT RELATEDcoord: 14..363
IPR043158Wnt, C-terminal domainGENE3DG3DSA:3.30.2460.20coord: 302..362
e-value: 2.5E-10
score: 42.3
NoneNo IPR availablePANTHERPTHR12027:SF37coord: 14..363
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.682
IPR018161Wnt protein, conserved sitePROSITEPS00246WNT1coord: 219..228