Dynein heavy chain axonemal

Overview
NameDynein heavy chain axonemal
Smed IDSMED30026601
Uniprot Best hitDynein heavy chain 2, axonemal OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1 (E=0)
Length (bp)1349
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein heavy chain axonemal (SMED30026601) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein heavy chain axonemal (SMED30026601) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein heavy chain axonemal (SMED30026601) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein heavy chain axonemal (SMED30026601) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026601

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026601SMESG000033128.1 SmedASXL_018495SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30026601SMESG000033128.1 dd_Smed_v4_7062_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026601SMESG000033128.1 dd_Smed_v4_7062_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30026601SMESG000033128.1 dd_Smed_v4_7062_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026601SMESG000033128.1 dd_Smed_v6_7062_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30026601SMESG000033128.1 dd_Smed_v4_7062_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026601SMESG000033128.1 dd_Smed_v4_7062_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30026601SMESG000033128.1 dd_Smed_v4_7062_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30026601SMESG000033128.1 dd_Smed_v4_7062_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 268/418 (64.11%), Postives = 336/418 (80.38%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVV--SVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNI Y FNDSDFEVSENLLS YLD+YE TPWDALKYLIA INYGGHVTDD DRRLL TYI DYF ++++  PF +LS + +Y+IP+DGSL SY+E+I++LP +D PEAFGQHPNAD+ASQI E + LFDTLLSL+PQ+     GG ++E+KVLE++ ++ +++PE IDYEGT K+L+ DP PLNVVLLQEIQRYN  +  I   L+DLEKGIQGL+VMS+ LE+IF+ I+D  VP LW KAYPS KPLA+WTRDL  R+E F+ WA  A  P +FW+S FTFPTGFLTAV+Q+SAR NN+SVD+L+W+F V T+ ++N+   PKDGV+V+GLYL+GAGWD KNS L+EA PM+L C MP IHF+P E++KKS K  Y CPCYYYPNRAG SDR S++  ++L++G   P+HW KRGTA
Sbjct: 4003 WNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALETYFIPKDGSLASYKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQPQITPTRAGGQTREEKVLELAADVKQKIPEMIDYEGTQKLLALDPSPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYPSQKPLAAWTRDLAMRVEQFELWASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNVSVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSSDRASFVIGIDLRSGAMTPDHWIKRGTA 4420          
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 268/418 (64.11%), Postives = 336/418 (80.38%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVV--SVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNI Y FNDSDFEVSENLLS YLD+YE TPWDALKYLIA INYGGHVTDD DRRLL TYI DYF ++++  PF +LS + +Y+IP+DGSL SY+E+I++LP +D PEAFGQHPNAD+ASQI E + LFDTLLSL+PQ+     GG ++E+KVLE++ ++ +++PE IDYEGT K+L+ DP PLNVVLLQEIQRYN  +  I   L+DLEKGIQGL+VMS+ LE+IF+ I+D  VP LW KAYPS KPLA+WTRDL  R+E F+ WA  A  P +FW+S FTFPTGFLTAV+Q+SAR NN+SVD+L+W+F V T+ ++N+   PKDGV+V+GLYL+GAGWD KNS L+EA PM+L C MP IHF+P E++KKS K  Y CPCYYYPNRAG SDR S++  ++L++G   P+HW KRGTA
Sbjct: 4003 WNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALETYFIPKDGSLASYKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQPQITPTRAGGQTREEKVLELAADVKQKIPEMIDYEGTQKLLALDPSPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYPSQKPLAAWTRDLAMRVEQFELWASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNVSVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSSDRASFVIGIDLRSGAMTPDHWIKRGTA 4420          
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Match: DNAH7 (dynein axonemal heavy chain 7 [Source:HGNC Symbol;Acc:HGNC:18661])

HSP 1 Score: 294.664 bits (753), Expect = 3.088e-94
Identity = 156/422 (36.97%), Postives = 236/422 (55.92%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKIL-STDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLW-SKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGI----SDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFN++D  +S   L  +L+QYE  P++AL+Y+  + NYGG VTDD DRR L + +  +F  E ++   +K      Y++P  G   SY E+   LP    PE FG + NADI     ET+LLFD +L  + +    G  S ++ V E++ +I  +LP N D E   +   +T    +N VL+QE+ R+N  L  IR    +++K I+GL VMS+DLE++  SI + K+P +W  K+YPS+KPL S+  D ++R++  Q+W      P VFW+S F F   FLT   Q  AR   I +D L +D+ V+   E      P+DGV++ GL+L GA W+ K   L E+ P  L   +PV+  KP +     ++ SY+ P Y    R G+        +++ ++ L + ++  EHW  RG A
Sbjct:   83 WNIPYEFNETDLRISVQQLHMFLNQYEELPYEALRYMTGECNYGGRVTDDWDRRTLRSILNKFFNPELVENSDYKFDSSGIYFVPPSGDHKSYIEYTKTLPLTPAPEIFGMNANADITKDQSETQLLFDNILLTQSRSAGAGAKSSDEVVNEVASDILGKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLKTIRDSCVNIQKAIKGLAVMSTDLEEVVSSILNVKIPEMWMGKSYPSLKPLGSYVNDFLARLKFLQQW-YEVGPPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDYEVMEDKE--YKHPPEDGVFIHGLFLDGASWNRKIKKLAESHPKILYDTVPVMWLKPCKRADIPKRPSYVAPLYKTSERRGVLSTTGHSTNFVIAMTLPS-DQPKEHWIGRGVA 500          
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Match: DNAH12 (dynein axonemal heavy chain 12 [Source:HGNC Symbol;Acc:HGNC:2943])

HSP 1 Score: 304.679 bits (779), Expect = 2.617e-91
Identity = 162/423 (38.30%), Postives = 244/423 (57.68%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKV-LEISGNITKQLPENIDYEGTAKILSTD-PCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPY FN+SD  +S   L  ++++Y+  P++A+ YL  + NYGG VTDD DRRLL T +AD++    ++ P +K S   +Y+ P  G+   Y EFI  LP   HPE FG H N DI+  +Q+T+ LF++LL  +      G     D++ LEI+ +I  +LP + D E   +         +N VL+QE++R+N  +  IR  L DLEK I+G+VVM S LE +  S+   KVP +W+K +YPS+KPL S+  D ++R+   Q W   +  P VFW+S F F   FLT  +Q  AR     +D L ++F V+    ++  ++P+DGVY+ GLYL GA WD ++ +L E  P  L   MP+I  KP +  +  + ++Y+CP Y    R G         +++ ++ LKT ++   HW KRG A
Sbjct: 3535 WNIPYGFNESDLRISIRQLQLFINEYDTIPFEAISYLTGECNYGGRVTDDWDRRLLLTMLADFYNLYIVENPHYKFSPSGNYFAPPKGTYEDYIEFIKKLPFTQHPEIFGLHENVDISKDLQQTKTLFESLLLTQGGSKQTGASGSTDQILLEITKDILNKLPSDFDIEMALRKYPVRYEESMNTVLVQEMERFNNLIITIRNTLRDLEKAIKGVVVMDSALEALSGSLLVGKVPEIWAKRSYPSLKPLGSYITDFLARLNFLQDW-YNSGKPCVFWLSGFFFTQAFLTGAMQNYARKYTTPIDLLGYEFEVIPSDTSD--TSPEDGVYIHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCPLYKTSERKGTLSTTGHSTNFVIAMLLKT-DQPTRHWIKRGVA 3953          
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Match: DNAH12 (dynein axonemal heavy chain 12 [Source:HGNC Symbol;Acc:HGNC:2943])

HSP 1 Score: 304.679 bits (779), Expect = 3.111e-91
Identity = 162/423 (38.30%), Postives = 244/423 (57.68%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKV-LEISGNITKQLPENIDYEGTAKILSTD-PCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPY FN+SD  +S   L  ++++Y+  P++A+ YL  + NYGG VTDD DRRLL T +AD++    ++ P +K S   +Y+ P  G+   Y EFI  LP   HPE FG H N DI+  +Q+T+ LF++LL  +      G     D++ LEI+ +I  +LP + D E   +         +N VL+QE++R+N  +  IR  L DLEK I+G+VVM S LE +  S+   KVP +W+K +YPS+KPL S+  D ++R+   Q W   +  P VFW+S F F   FLT  +Q  AR     +D L ++F V+    ++  ++P+DGVY+ GLYL GA WD ++ +L E  P  L   MP+I  KP +  +  + ++Y+CP Y    R G         +++ ++ LKT ++   HW KRG A
Sbjct: 2667 WNIPYGFNESDLRISIRQLQLFINEYDTIPFEAISYLTGECNYGGRVTDDWDRRLLLTMLADFYNLYIVENPHYKFSPSGNYFAPPKGTYEDYIEFIKKLPFTQHPEIFGLHENVDISKDLQQTKTLFESLLLTQGGSKQTGASGSTDQILLEITKDILNKLPSDFDIEMALRKYPVRYEESMNTVLVQEMERFNNLIITIRNTLRDLEKAIKGVVVMDSALEALSGSLLVGKVPEIWAKRSYPSLKPLGSYITDFLARLNFLQDW-YNSGKPCVFWLSGFFFTQAFLTGAMQNYARKYTTPIDLLGYEFEVIPSDTSD--TSPEDGVYIHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCPLYKTSERKGTLSTTGHSTNFVIAMLLKT-DQPTRHWIKRGVA 3085          
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 64.3142 bits (155), Expect = 1.483e-10
Identity = 67/325 (20.62%), Postives = 132/325 (40.62%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQY---------ENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFF---KLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKED---KVLEISGNITKQ----LPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPK-VFWVSAFTFPTGFLTAVIQTSARLNNISVDTLN 912
            W+  YEF+D+D  V+ + L   +D           E  PW  L+ L++   YGG + +  D+ LL+  + + F  ++ ++      K     S + P     +    ++  L N   P   G   NA+     +    +   +L +  + ++   D KE+   + +   G + KQ    LP+ I      + +     PL     +E+   +  L  IR+ L+++    +     +++   +  S+   +VP  W +   P    +  W  DL  R++   +     +  +  FW+     P  ++TA  Q  A+ N  S++ LN
Sbjct: 4149 WSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEI--VKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLN 4471          
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 64.3142 bits (155), Expect = 1.483e-10
Identity = 67/325 (20.62%), Postives = 132/325 (40.62%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQY---------ENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFF---KLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKED---KVLEISGNITKQ----LPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPK-VFWVSAFTFPTGFLTAVIQTSARLNNISVDTLN 912
            W+  YEF+D+D  V+ + L   +D           E  PW  L+ L++   YGG + +  D+ LL+  + + F  ++ ++      K     S + P     +    ++  L N   P   G   NA+     +    +   +L +  + ++   D KE+   + +   G + KQ    LP+ I      + +     PL     +E+   +  L  IR+ L+++    +     +++   +  S+   +VP  W +   P    +  W  DL  R++   +     +  +  FW+     P  ++TA  Q  A+ N  S++ LN
Sbjct: 4149 WSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEI--VKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLN 4471          
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 63.929 bits (154), Expect = 1.554e-10
Identity = 67/325 (20.62%), Postives = 132/325 (40.62%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQY---------ENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFF---KLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKED---KVLEISGNITKQ----LPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPK-VFWVSAFTFPTGFLTAVIQTSARLNNISVDTLN 912
            W+  YEF+D+D  V+ + L   +D           E  PW  L+ L++   YGG + +  D+ LL+  + + F  ++ ++      K     S + P     +    ++  L N   P   G   NA+     +    +   +L +  + ++   D KE+   + +   G + KQ    LP+ I      + +     PL     +E+   +  L  IR+ L+++    +     +++   +  S+   +VP  W +   P    +  W  DL  R++   +     +  +  FW+     P  ++TA  Q  A+ N  S++ LN
Sbjct: 3217 WSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEI--VKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLN 3539          
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 59.3066 bits (142), Expect = 5.319e-9
Identity = 78/350 (22.29%), Postives = 150/350 (42.86%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVS----ENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITM-LPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDY---EGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSR----IEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWD 1014
            W   YEF  SD  V+    E L +N  D      W+ ++ ++  + YGG + +D D ++L++Y+   F +E I        ++    +    ++  Y   I+  +P++D P  FG   N   + QI E      ++ +L           + DK+ +I  ++ K+L ++ D    E    I S DP    V+ L+ I   +  +  + + +  + K ++   + S  ++    S+   + P  W   +      A +   +V +    +++F+    ++        S   +P  FL A+ QT++R   I +D L     +L+ +        K  V V+GL LQGA +D
Sbjct: 3764 WTKFYEFGASDVRVAKSFVEQLTANKAD------WEFVRGILKFVIYGGRIENDFDFKVLDSYLNVLFCDEKINGRAGS-QLVKGIDLLATTNVQEYIGHISKSVPSVDEPYLFGLPENIKYSWQIVEADRTISSIRTLALGDTKNALSDQSDKISQIV-SLWKKLCQSDDLPKRELPTAIRSADPIS-EVLCLETINALSL-IKQLHRSIGHVAKSMKTPSLASPAVQKTIQSLVFQQTPDEWDSMWAGPSDPADYLNVVVKKTRGTLQLFESSKSSSLLSSPIDFSDLFYPNIFLNALRQTTSRQIKIPLDQL-----ILSSAWTPSQLPAKQCVQVQGLLLQGATFD 4098          
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Match: kl-2 (gene:FBgn0001313 transcript:FBtr0346722)

HSP 1 Score: 446.817 bits (1148), Expect = 6.215e-141
Identity = 221/419 (52.74%), Postives = 292/419 (69.69%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGG-DSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKD--GVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WN+ Y FNDSDFEVSE LL  YL++YE+TPW ALKYLIA +NYGGH+TDD DRRLL TYI  +F ++A++   F+LS + +Y+IP DG + SY + I M PN D P+AFGQH NADIAS I ETR+LF+ LLS++ Q  S    ++ E KV +++  I    P+ I+YE TAKI+  +  PL VVLLQEI+RYN  L  +  QL DL +GIQGLVVMSSDLEDI+ ++ + +VP  W KAY S+KPLA+W RDL+ R+  F  WA T   P +FW++A+TFPTGF+TAV+QTSAR     +D L+WDF V    +   A   ++  GVY++ L+L+G GW  KN  L +  PMEL C +PVIHFKP+EN KK  +  Y CP YYYP R+G     S++ +V+LK+G +  ++W KRGTA
Sbjct: 4039 WNVIYSFNDSDFEVSEILLLLYLNEYEDTPWGALKYLIAGVNYGGHITDDWDRRLLITYINQFFCDQALQTRKFRLSTLPNYFIPDDGDVQSYLDQIQMFPNFDKPDAFGQHSNADIASLIGETRMLFEALLSMQVQTNSTSSNENGETKVFDLAKEILMNTPDEINYEQTAKIIGINRTPLEVVLLQEIERYNKLLVDMSTQLRDLRRGIQGLVVMSSDLEDIYLAVSEGRVPLQWLKAYNSLKPLAAWARDLIHRVGHFNSWAKTLRPPILFWLAAYTFPTGFVTAVLQTSARATKTPIDELSWDFYVFVEEDTAAARIIREGGGVYIRSLFLEGGGWLRKNQCLQDPLPMELICPLPVIHFKPVENLKKRCRGVYQCPAYYYPVRSG-----SFVIAVDLKSGNEKADYWIKRGTA 4452          
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Match: Dhc36C (gene:FBgn0013810 transcript:FBtr0304742)

HSP 1 Score: 275.404 bits (703), Expect = 1.766e-81
Identity = 162/433 (37.41%), Postives = 234/433 (54.04%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAI--KEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFD-TLLS-----LKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGT-AKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWS-KAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIA--SAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGI----SDRPSYIESVELKTGEKAP-EHWTKRGTA 1248
            WNIPYEFN++D  +S   L  +L+QYE   +DAL+YL  + NYGG VTDD DRR L T +  ++    I  + P++ L     YY+P    ++ Y  F   LP I  P  FG H NADI    +ET +L   TLL+                + E+ V  ++ +I  +LP+  D +    K  +     +N VL+QE+ R+N  L+ IR  L  L KGI+GLVVMS  +E ++ S+   K+P +W+ K+YPS+KPL S+  D + R+E  Q W     AP  FW+S F F   FLT   Q  AR   IS+D L +D+ VLT+ E      S P+DGV+V G++L+GA WD     L E+ P EL   MP+I  KP++     ++++Y+CP Y    R G+        +++ ++ L      P  HW  RGTA
Sbjct: 3587 WNIPYEFNETDLRISLMQLRMFLNQYETVNYDALRYLTGECNYGGRVTDDWDRRTLKTILDKFYCPAVIDLETPYY-LDETGLYYVPVFKEVDLYLNFTRDLPQISAPAIFGFHANADIMKDQKETDMLLSHTLLTQDTSASSDDSGGSKALTPEEVVTNVATDILDKLPKLFDRDAALLKYPTLYHQSMNTVLVQEMVRFNVLLNTIRTSLITLRKGIKGLVVMSPAVEAVYKSVLIAKIPAMWAGKSYPSLKPLGSYVTDFLRRLEFLQHW-FDHGAPSTFWLSGFFFTQAFLTGAQQNYARKYVISIDLLAFDYEVLTVEEPQRQGLSGPEDGVFVYGIFLEGARWDRTGKYLAESRPRELFDTMPLIWLKPLKRVDLPERHNYLCPMYKTAERRGVLSTTGHSTNFVVAMLLLCNPNTPVSHWIIRGTA 4017          
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Match: Dhc62B (gene:FBgn0013811 transcript:FBtr0303106)

HSP 1 Score: 266.544 bits (680), Expect = 1.952e-78
Identity = 154/429 (35.90%), Postives = 233/429 (54.31%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITM----LPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSL--KPQVVSVG-GDSKEDKVLEISGNITKQLPENIDYEGTAKILSTD-PCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLW-SKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNI Y FN+SD ++S   LS  L+QY++ P+DA+ YL ++ NYGG VTD+ DRRL+ T +AD+   +A+ +  ++ +    Y +PR      +RE +      LP++  PE +G H N+ I   +Q T+ L D+++ L       S G G S E  +L+    I +++P ++D E  A+    D    +N V++QE++R+      IR    DL  GI+G++VM+ DLE++  ++   ++P  W SK+YP +KPL S+ +DL  R+     W      P  FW+S F F   FLT  +Q  AR   I +DTL +D+ VL +      S P DGVY  GLYL+GA W+ + + L+E  P  L  AMPVI F+P+      + + Y CP Y    R G         +Y+  + L T  KA  HW KR  A
Sbjct: 3536 WNIAYGFNESDLQISVLQLSMLLNQYDHVPYDAISYLTSECNYGGRVTDNWDRRLIVTILADFCNAQAVTDNRYRFASDDRYILPRK---TEHREILRYLDENLPSLAPPEVYGLHANSGITRDLQTTKTLLDSMILLLGSEAAGSAGAGVSVEQVILDTIKQIEREMPADMDIEAAAEKYPVDYNESMNTVVVQEMERFLKLQKEIRTTCRDLAMGIKGIIVMTPDLENVMTAMKFNRIPTKWMSKSYPCLKPLGSYVQDLYKRLNWLHDWHHHGKPP-TFWLSGFFFTQAFLTGAMQNFARKYKIPIDTLTFDYDVLKVETKT--SPPDDGVYCNGLYLEGARWEWRENTLVEQFPKVLIYAMPVIFFRPVGLVDVVEGSRYRCPLYKTAERKGTLSTTGHSTNYVVPLLLNTHVKA-SHWVKRSVA 3957          
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0344344)

HSP 1 Score: 251.136 bits (640), Expect = 4.240e-73
Identity = 147/423 (34.75%), Postives = 223/423 (52.72%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYE---NTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKP-QVVSVGGDSKEDKVLEISGNITKQLPENID-YEGTAKILSTDPC-PLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLN-NISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFN +DF  S   + N+LD+ +      W  L Y+I ++ YGG VTDD D+RLL T+ + +F E  +   F        Y +P   SL  + ++I  LP  D PE FG H NADI  QI   + + DT+LS++P +    GG+++E  V +++ ++ ++LP   + YE    +       P+N+ L QEI R    +  +   L DL+  I G +VMS  L++  D++YD ++P  W K       L  W  +L+ R   F+ W I+   PKVFW++ F  P GFLTA+ Q   R +   ++D++     +   ++ +I   P +GVYV GL+L+GA  D ++  LIE+    L   MPVI+   I          Y CP Y  P R  +     Y+ S++ +T E  P+HWT RG A
Sbjct: 4305 WNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSF---EFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTW-ISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTTAGKDPKLYECPIYRKPQRTDL----KYVGSIDFET-EFNPKHWTLRGVA 4718          
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309027)

HSP 1 Score: 251.136 bits (640), Expect = 4.893e-73
Identity = 147/423 (34.75%), Postives = 223/423 (52.72%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYE---NTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKP-QVVSVGGDSKEDKVLEISGNITKQLPENID-YEGTAKILSTDPC-PLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLN-NISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFN +DF  S   + N+LD+ +      W  L Y+I ++ YGG VTDD D+RLL T+ + +F E  +   F        Y +P   SL  + ++I  LP  D PE FG H NADI  QI   + + DT+LS++P +    GG+++E  V +++ ++ ++LP   + YE    +       P+N+ L QEI R    +  +   L DL+  I G +VMS  L++  D++YD ++P  W K       L  W  +L+ R   F+ W I+   PKVFW++ F  P GFLTA+ Q   R +   ++D++     +   ++ +I   P +GVYV GL+L+GA  D ++  LIE+    L   MPVI+   I          Y CP Y  P R  +     Y+ S++ +T E  P+HWT RG A
Sbjct: 4297 WNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSF---EFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTW-ISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTTAGKDPKLYECPIYRKPQRTDL----KYVGSIDFET-EFNPKHWTLRGVA 4710          
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 267/420 (63.57%), Postives = 325/420 (77.38%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSV----GGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNI Y FNDSDFEVSENLLS YLD+YE  PWDALK+LIA INYGGHVTDD DRRLL TYI  YF    I  PFFK+S + SYY+PRDGS +SY ++I+ LP ++HPE FGQ+PNADIASQI E R LF TLLSL+PQV S      G S+EDKVLE+S ++ +++P  IDYEGT K+L  D  PLNVVLLQEIQRYN  L  IR  L +LEKGI+GLVVMSS LE+ F+ I+D +VP LW KAYPS+KPLASWTRDL  R+E F +WA TA  P +FW+S FTFPTGFLTAV+Q+SAR NN+SVDTL+W+F+V T+ + N+   PKDGV ++GL+L+GAGWD K S L+EA PM+L C MP IHFKP+E++K+  KN Y CPCYYYP R+G S R S++ +V+LK+G    +HW KRGTA
Sbjct: 3960 WNIIYSFNDSDFEVSENLLSLYLDEYEEIPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDTPFFKVSSLVSYYVPRDGSQSSYVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAGASREDKVLELSADVLQKIPAEIDYEGTRKLLKDDLSPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFARWAETARPPVLFWLSGFTFPTGFLTAVLQSSARQNNVSVDTLSWEFSVTTVEDNNLLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHFKPVESRKRLAKNMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVPYDHWIKRGTA 4379          
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 267/420 (63.57%), Postives = 325/420 (77.38%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSV----GGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNI Y FNDSDFEVSENLLS YLD+YE  PWDALK+LIA INYGGHVTDD DRRLL TYI  YF    I  PFFK+S + SYY+PRDGS +SY ++I+ LP ++HPE FGQ+PNADIASQI E R LF TLLSL+PQV S      G S+EDKVLE+S ++ +++P  IDYEGT K+L  D  PLNVVLLQEIQRYN  L  IR  L +LEKGI+GLVVMSS LE+ F+ I+D +VP LW KAYPS+KPLASWTRDL  R+E F +WA TA  P +FW+S FTFPTGFLTAV+Q+SAR NN+SVDTL+W+F+V T+ + N+   PKDGV ++GL+L+GAGWD K S L+EA PM+L C MP IHFKP+E++K+  KN Y CPCYYYP R+G S R S++ +V+LK+G    +HW KRGTA
Sbjct: 4080 WNIIYSFNDSDFEVSENLLSLYLDEYEEIPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDTPFFKVSSLVSYYVPRDGSQSSYVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAGASREDKVLELSADVLQKIPAEIDYEGTRKLLKDDLSPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFARWAETARPPVLFWLSGFTFPTGFLTAVLQSSARQNNVSVDTLSWEFSVTTVEDNNLLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHFKPVESRKRLAKNMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVPYDHWIKRGTA 4499          
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Match: dnah7 (dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:ZDB-GENE-070912-282])

HSP 1 Score: 303.138 bits (775), Expect = 9.139e-96
Identity = 164/422 (38.86%), Postives = 240/422 (56.87%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTD-PCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLW-SKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFN++D  +S   L  +LDQYE  P+DAL+Y+  + NYGG VTDD DRR L T ++ ++  E I +  +K      YY P +G  NSY E+   LP    PE FG + NADI     ET+LLFD++L  + +       S +D V E++ +I  +LP++ D +   +   T     +N VL+QE+ R+N  L  IR    +++K I+GLVVMS++LE++  SI   ++P +W  K+YPS+KPL  +  D + R++  Q W +    P VFW+S F F   FLT   Q  AR   I +D L++DF V+   E    + P+DGVY++GL+L GA WD +   L E+ P  L   MPVI  KP++ +   ++  YI P Y    R G         +Y+ S+ L + +  PEHW +RG A
Sbjct:  252 WNIPYEFNETDLRISVQQLHMFLDQYEEIPFDALRYMTGECNYGGRVTDDWDRRTLRTILSIFYTSEIINDADYKFDPSGLYYSPPEGDYNSYIEYTKTLPLNPSPEIFGMNANADITKDQVETQLLFDSILLTQSRSSGGSAASSDDMVFEVAADILNKLPQDFDTDAAMRKYPTSYNQSMNTVLVQEMGRFNKLLQTIRDSCVNIQKAIKGLVVMSAELEEVVSSILKGRIPAMWMKKSYPSLKPLGGYISDFLERLKFLQDWYMDG-MPAVFWMSGFFFTQAFLTGGQQNYARRYTIPIDLLSFDFEVMEDKEYK--NPPEDGVYIRGLFLDGARWDRRTKRLAESFPKILHDTMPVIWLKPMKKQDIPERQCYISPVYKTSERRGTLSTTGHSTNYVISMALNS-DVPPEHWIRRGVA 669          
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 308.531 bits (789), Expect = 8.745e-93
Identity = 172/426 (40.38%), Postives = 248/426 (58.22%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDK-VLEISGNITKQLPENIDYEGTAKILSTDPC---PLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNS-YICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPY FN+SD  +S   L  ++++Y+  P++A+ YL  + NYGG VTDD DRRLL T +AD++ ++ I  P +  S    Y+ P       Y EFI  LP   HPE FG H N DI+  +Q+T+LLFD+LL  +      GG S  D  +L+I+ +I  +LP N D E  + ++    C    +N VL+QE+QRYN     IR  L +L K I+GLVVM ++LE +  S+   KVP  W+K +YPS+KPL S+  D ++R++  Q W  T   P VFW+S F F   F+T  +Q  AR  +I +D L +++ VL    ++  S+P+DGVY+ GL+L GA WD K+ +L E  P  L  A+P+I  KP + K   Q +S Y+CP Y    R G         +++ ++ L T  K P+HW KRG A
Sbjct: 3532 WNIPYGFNESDLRISIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVIDHPRYSFSPSGKYHAPPKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQGGGSKGGGGSGGDSTLLDIANDILSKLPGNFDIE--SALVKFPVCYEESMNTVLVQEMQRYNNLSSTIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQDWYDT-QKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVLPFDTSD--SSPEDGVYIHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKPTDKKAMDQPHSVYVCPLYKTSERKGTLSTTGHSTNFVITMMLPTS-KRPQHWIKRGVA 3951          
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Match: dnah7 (dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:ZDB-GENE-070912-282])

HSP 1 Score: 304.679 bits (779), Expect = 1.574e-91
Identity = 164/422 (38.86%), Postives = 240/422 (56.87%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTD-PCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLW-SKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFN++D  +S   L  +LDQYE  P+DAL+Y+  + NYGG VTDD DRR L T ++ ++  E I +  +K      YY P +G  NSY E+   LP    PE FG + NADI     ET+LLFD++L  + +       S +D V E++ +I  +LP++ D +   +   T     +N VL+QE+ R+N  L  IR    +++K I+GLVVMS++LE++  SI   ++P +W  K+YPS+KPL  +  D + R++  Q W +    P VFW+S F F   FLT   Q  AR   I +D L++DF V+   E    + P+DGVY++GL+L GA WD +   L E+ P  L   MPVI  KP++ +   ++  YI P Y    R G         +Y+ S+ L + +  PEHW +RG A
Sbjct: 3577 WNIPYEFNETDLRISVQQLHMFLDQYEEIPFDALRYMTGECNYGGRVTDDWDRRTLRTILSIFYTSEIINDADYKFDPSGLYYSPPEGDYNSYIEYTKTLPLNPSPEIFGMNANADITKDQVETQLLFDSILLTQSRSSGGSAASSDDMVFEVAADILNKLPQDFDTDAAMRKYPTSYNQSMNTVLVQEMGRFNKLLQTIRDSCVNIQKAIKGLVVMSAELEEVVSSILKGRIPAMWMKKSYPSLKPLGGYISDFLERLKFLQDWYMDG-MPAVFWMSGFFFTQAFLTGGQQNYARRYTIPIDLLSFDFEVMEDKEYK--NPPEDGVYIRGLFLDGARWDRRTKRLAESFPKILHDTMPVIWLKPMKKQDIPERQCYISPVYKTSERRGTLSTTGHSTNYVISMALNS-DVPPEHWIRRGVA 3994          
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Match: DNAH2 (dynein, axonemal, heavy chain 2 [Source:NCBI gene;Acc:100170584])

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 275/419 (65.63%), Postives = 337/419 (80.43%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQV---VSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNI Y FNDSDFEVSENLLS YLD+YE TPW+ALKYLIA +NYGGHVTDD DRRLL+TYI DYF E A+   F++LS + +YYIPRDG L SY+EFI++LP  DHPEAFGQHPNADIASQI E R LFDTLLSL+PQ+      GG ++E+KVL++  ++ +++P  IDYEGT K+LS DP PLNVVLLQEIQRYN  LD IR  L+DLE+GIQGLVVMS++LE+IF  IYD +VP LW KAYPS+KPLA+WTRDLV R+E+F +WA TAH P +FW+SAFTFPTGFLTAV+Q++AR NN+SVD+L+W+F V T+ + N+   PKDGV+++GLYL+GAGWD KNS LIEA PM+L C +P +HF+P E++KKS K  Y CPCYYYP RAG S R S++  V+L+ G    EHW KRGTA
Sbjct: 3911 WNIVYGFNDSDFEVSENLLSLYLDEYEETPWEALKYLIAGVNYGGHVTDDWDRRLLSTYINDYFSEPALTNQFYRLSSLDTYYIPRDGPLASYKEFISLLPAADHPEAFGQHPNADIASQITEARTLFDTLLSLQPQITPSAQGGGQTREEKVLDLLSDVREKIPPEIDYEGTCKVLSGDPNPLNVVLLQEIQRYNALLDTIRTSLNDLERGIQGLVVMSAELEEIFTCIYDARVPPLWEKAYPSLKPLAAWTRDLVLRVELFSRWAKTAHPPVLFWLSAFTFPTGFLTAVLQSAARQNNVSVDSLSWEFIVSTVDDNNLVYPPKDGVWIRGLYLEGAGWDKKNSCLIEAEPMQLVCPLPTVHFRPTESRKKSSKGLYSCPCYYYPVRAGSSGRASFVIGVDLRCGAAPAEHWIKRGTA 4329          
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Match: xpo7 (exportin 7 [Source:Xenbase;Acc:XB-GENE-491338])

HSP 1 Score: 295.819 bits (756), Expect = 1.039e-92
Identity = 167/426 (39.20%), Postives = 239/426 (56.10%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVL-EISGNITKQLPENIDYEGTAKILSTDPC----PLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPY FN+SD  +S   L  +++ YE  P++A+ YL  + NYGG VTDD DRRLL T +AD++  + I++P +  S   +Y +P   S   Y EFI  LP   HPE FG H N DI+  +Q+T+ +F++LL  +      G     D  L EI+ +I  +LP++ D E     L   P      +N VL+QE++R+N     IR  L +L+K I+GLVVM S+LE +  S+   KVP  W+K +YPS+KPL S+  D ++R++  Q W      P VFW+S F F   FLT  +Q  AR   I +D + ++F VL    A+  S P+DGVY+ GL+L GA WD +  +L E  P  L  A+PVI  KP +     +  SY+CP Y    R G         +++  + L T +K  +HW KRG A
Sbjct:  255 WNIPYGFNESDLRISIRQLQLFINDYETVPFEAISYLTGECNYGGRVTDDWDRRLLLTTLADFYNNDIIEKPRYSFSPSGNYQVPPKSSYEDYIEFIKRLPFSQHPEVFGLHENVDISKDLQQTKTIFESLLLTQGGGRQGGATGASDHTLYEIANDILSKLPKDFDIEAA---LQKYPVRYEESMNTVLVQEMERFNNLTRTIRTTLQNLQKAIKGLVVMDSELEALSGSLIVGKVPETWAKRSYPSLKPLGSYVSDFLARLKFLQNW-FECGKPNVFWLSGFFFTQAFLTGAMQNYARKYRIPIDLIGYEFQVLWSDSAD--SPPEDGVYINGLFLDGARWDRQRGVLGEQLPKLLFDAVPVIWIKPNKRSDIKKSKSYLCPLYKTSERKGTLSTTGHSTNFVIGMLLPT-DKPVQHWIKRGVA 673          
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 307.375 bits (786), Expect = 2.672e-92
Identity = 171/425 (40.24%), Postives = 251/425 (59.06%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPC----PLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLW-SKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFN+SD  +S   L  +L++YE  P++AL YL  + NYGG VTDD DRRLL   ++  + ++ I++  ++LS   +Y +P  G+  S  ++I  LP I HPE FG H NADI    QET  LF  +L   P+  S  G S ++ V +++ +I  +LP++ + E   K++   P      +N VL QE+ R+N    ++R  L +L K I+G V+MS++LE++F+S+   KVP +W SK+YPS+KPL S+  DL+SR++  Q W I    PKVFW+S F F   FLT V Q  AR   I +D + + F V T    ++  AP DG YVKGL+L+GA WD +   + E+ P  L   +P+I  KP E+ K    N+Y+CP Y    R G         +Y+ S+EL + ++  +HWT RG A
Sbjct: 2555 WNIPYEFNESDLRISMRQLQMFLNEYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLCLLSIVYNKD-IQQDKYRLSTGDTYCVPSYGTYQSCVDYIRSLPLITHPEVFGLHENADITKDNQETNQLFSGVLLTLPRQTSGSGRSPQEIVEDLAKDILNKLPKDFNLE---KVMEKYPVVYEESMNTVLRQELIRFNRLTAVVRSSLINLGKAIKGQVLMSAELENVFNSMLVGKVPSMWASKSYPSLKPLGSYVADLLSRLQFLQGW-IDNGPPKVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFQFEV-TRYRNDVDEAPADGAYVKGLFLEGARWDQQAMQIGESLPKILYDPLPIIWLKPGESSKFQHTNTYLCPVYKTSARRGTLSTTGHSTNYVLSIELPS-DRPEKHWTNRGVA 2972          
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 307.375 bits (786), Expect = 2.690e-92
Identity = 171/425 (40.24%), Postives = 251/425 (59.06%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPC----PLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLW-SKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFN+SD  +S   L  +L++YE  P++AL YL  + NYGG VTDD DRRLL   ++  + ++ I++  ++LS   +Y +P  G+  S  ++I  LP I HPE FG H NADI    QET  LF  +L   P+  S  G S ++ V +++ +I  +LP++ + E   K++   P      +N VL QE+ R+N    ++R  L +L K I+G V+MS++LE++F+S+   KVP +W SK+YPS+KPL S+  DL+SR++  Q W I    PKVFW+S F F   FLT V Q  AR   I +D + + F V T    ++  AP DG YVKGL+L+GA WD +   + E+ P  L   +P+I  KP E+ K    N+Y+CP Y    R G         +Y+ S+EL + ++  +HWT RG A
Sbjct: 3596 WNIPYEFNESDLRISMRQLQMFLNEYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLCLLSIVYNKD-IQQDKYRLSTGDTYCVPSYGTYQSCVDYIRSLPLITHPEVFGLHENADITKDNQETNQLFSGVLLTLPRQTSGSGRSPQEIVEDLAKDILNKLPKDFNLE---KVMEKYPVVYEESMNTVLRQELIRFNRLTAVVRSSLINLGKAIKGQVLMSAELENVFNSMLVGKVPSMWASKSYPSLKPLGSYVADLLSRLQFLQGW-IDNGPPKVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFQFEV-TRYRNDVDEAPADGAYVKGLFLEGARWDQQAMQIGESLPKILYDPLPIIWLKPGESSKFQHTNTYLCPVYKTSARRGTLSTTGHSTNYVLSIELPS-DRPEKHWTNRGVA 4013          
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 307.375 bits (786), Expect = 3.323e-92
Identity = 171/425 (40.24%), Postives = 251/425 (59.06%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPC----PLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLW-SKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFN+SD  +S   L  +L++YE  P++AL YL  + NYGG VTDD DRRLL   ++  + ++ I++  ++LS   +Y +P  G+  S  ++I  LP I HPE FG H NADI    QET  LF  +L   P+  S  G S ++ V +++ +I  +LP++ + E   K++   P      +N VL QE+ R+N    ++R  L +L K I+G V+MS++LE++F+S+   KVP +W SK+YPS+KPL S+  DL+SR++  Q W I    PKVFW+S F F   FLT V Q  AR   I +D + + F V T    ++  AP DG YVKGL+L+GA WD +   + E+ P  L   +P+I  KP E+ K    N+Y+CP Y    R G         +Y+ S+EL + ++  +HWT RG A
Sbjct: 3607 WNIPYEFNESDLRISMRQLQMFLNEYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLCLLSIVYNKD-IQQDKYRLSTGDTYCVPSYGTYQSCVDYIRSLPLITHPEVFGLHENADITKDNQETNQLFSGVLLTLPRQTSGSGRSPQEIVEDLAKDILNKLPKDFNLE---KVMEKYPVVYEESMNTVLRQELIRFNRLTAVVRSSLINLGKAIKGQVLMSAELENVFNSMLVGKVPSMWASKSYPSLKPLGSYVADLLSRLQFLQGW-IDNGPPKVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFQFEV-TRYRNDVDEAPADGAYVKGLFLEGARWDQQAMQIGESLPKILYDPLPIIWLKPGESSKFQHTNTYLCPVYKTSARRGTLSTTGHSTNYVLSIELPS-DRPEKHWTNRGVA 4024          
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 269/418 (64.35%), Postives = 337/418 (80.62%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVV--SVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNI Y FNDSDFEVSENLLS YLD+YE TPWDALKYLIA +NYGGHVTDD DRRLL TYI DYF + ++  PF++LS++ +YYIP+DGSL SY+E+I+MLP++D PEAFGQHPNAD+ASQI E R LF+TLLSL+PQ+    VGG S+E+KVLE++ ++ +++PE IDYEGT K+L+ DP PLNVVLLQEIQRYN  +  I   L+DLEKGIQGL+VMS+ LE+IF+ I+D  VP LW K YPS KPLASWTRDL  R+E F+ WA  A  P +FW+S FTFPTGFLTAV+Q++AR NNISVD+L+W+F V T+ ++N+   PKDGV+V+GLYL+GAGWD KNS L+EA PM+L C MP IHF+P E++KKS K  Y CPCYYYPNRAG +DR S++  ++L++G    +HW KRGTA
Sbjct: 4032 WNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFYRLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEKVLELAADVKQKIPEMIDYEGTRKLLALDPSPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYPSQKPLASWTRDLAVRVEQFETWASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNNISVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTA 4449          
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 269/418 (64.35%), Postives = 337/418 (80.62%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVV--SVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNI Y FNDSDFEVSENLLS YLD+YE TPWDALKYLIA +NYGGHVTDD DRRLL TYI DYF + ++  PF++LS++ +YYIP+DGSL SY+E+I+MLP++D PEAFGQHPNAD+ASQI E R LF+TLLSL+PQ+    VGG S+E+KVLE++ ++ +++PE IDYEGT K+L+ DP PLNVVLLQEIQRYN  +  I   L+DLEKGIQGL+VMS+ LE+IF+ I+D  VP LW K YPS KPLASWTRDL  R+E F+ WA  A  P +FW+S FTFPTGFLTAV+Q++AR NNISVD+L+W+F V T+ ++N+   PKDGV+V+GLYL+GAGWD KNS L+EA PM+L C MP IHF+P E++KKS K  Y CPCYYYPNRAG +DR S++  ++L++G    +HW KRGTA
Sbjct: 4038 WNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFYRLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEKVLELAADVKQKIPEMIDYEGTRKLLALDPSPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYPSQKPLASWTRDLAVRVEQFETWASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNNISVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTA 4455          
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Match: Dnah1 (dynein, axonemal, heavy chain 1 [Source:MGI Symbol;Acc:MGI:107721])

HSP 1 Score: 311.227 bits (796), Expect = 1.045e-93
Identity = 175/422 (41.47%), Postives = 242/422 (57.35%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDY-EGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLW-SKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            +NIPYEF D D  +  + L  +LD+YE+ P+  LKY   +INYGG VTDD DRR +   + D++    +       +    + IP    LN Y  +I  LP  D PE FG H NA+I     ET  LF+ +L L+P+  S+GG S+E+ V +++ NI  Q+P  I+  E T K        +N VL+QE+ RYN  L++I + LSD+ K I+GLVVMS +LE +  S+Y+  VP LW SKAYPS+KPLASW  DL+ R++    W I    P VFW+S F FP  FLT  +Q  AR   IS+DT+ +DF VL  + + I   P+ G Y+ GL+L+GA WD  N  L E+ P EL   M VI   P  N+K   ++ Y+CP Y    RAG         +Y+ +VE+ + +    HW KRG A
Sbjct: 3824 FNIPYEFTDGDLRICISQLKMFLDEYEDIPYKVLKYTAGEINYGGRVTDDWDRRCVMNILEDFYNPAVLSSEHSYSNSGIYHQIPPTYDLNGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALFNAILQLQPKSSSMGGQSREELVEDVAENILLQVPGPIELQEVTKKFPVLYEESMNTVLVQEVIRYNKLLEVITQTLSDMLKAIKGLVVMSLELELMSISLYNNTVPELWKSKAYPSLKPLASWIMDLLLRLDFMHSW-INDGIPPVFWISGFFFPQAFLTGTLQNFARKFVISIDTITFDFKVLPEASSEIKERPQTGCYIHGLFLEGARWDSMNFQLAESRPKELYTEMAVIWLLPEANRKVQNQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPSNQPQ-RHWIKRGVA 4243          
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Match: Dnah7c (dynein, axonemal, heavy chain 7C [Source:MGI Symbol;Acc:MGI:3639762])

HSP 1 Score: 309.686 bits (792), Expect = 3.385e-93
Identity = 165/421 (39.19%), Postives = 238/421 (56.53%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKIL-STDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLW-SKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKT---GEKAPEHWTKRGTA 1248
            WNIPYEFN++D  +S   L  +LDQYE  P+DAL+Y+  + NYGG VTDD DRR L + +  +F  E ++ P +K      Y+IP  G   SY ++   LP I  PE FG + NADI     ET+LLFD +L  + Q    G  S ++ V E++G+I  +LP N D E   +   +T    +N VL+QE+ R+N  L  IR+   +++K I+GLVVMS++LE++  SI + K+P +W  K+YPS+KPL S+  D + R++  Q+W      P VFW+S F F   FLT   Q  AR   I +D L +D+ V+   E    +AP+DGVY+ GL+L GA WD K   L E+ P  L   +PV+  KP +    S++ SY+ P Y    R G      +  +  +      ++  EHW  RG A
Sbjct: 3600 WNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFIPPSGDHKSYIDYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSQSSGSGTKSSDEVVNEVAGDILSKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPAMWMGKSYPSLKPLGSYVNDFLERLKFLQQW-YEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLAFDYEVMDDKEYK--NAPEDGVYIHGLFLDGASWDRKTKKLAESHPKVLYDTVPVMWLKPCKKSDISKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVA 4017          
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Match: Dnah12 (dynein, axonemal, heavy chain 12 [Source:MGI Symbol;Acc:MGI:107720])

HSP 1 Score: 306.99 bits (785), Expect = 3.073e-92
Identity = 167/423 (39.48%), Postives = 245/423 (57.92%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKV-LEISGNITKQLPENIDYEGTAKILSTD-PCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPY FN+SD  +S   L  ++++Y+  P++A+ YL  + NYGG VTDD DRRLL T +AD++    I+ P +K S   +YY P  G+ + Y EFI  LP    PE FG H N DI+  +Q+T++LF++LL  +      G     D+V LEI+ +I  QLP + D E   K         +N VL+QE++R+N  +  IR  L DL+K I+GLVVM S LE +  S+   KVP +W+K +YPS+KPL S+  D ++R++  + W  ++  P VFW+S F F   FLT  +Q  AR   I +D L ++F V+    ++  + P+DGVY+ GLYL GA WD  + +L E  P  L   MP+I  KP    +  +  +YICP Y    R G         +++ ++ LKT ++  +HW KRG A
Sbjct: 3535 WNIPYGFNESDLRISVRQLQLFINEYDTIPFEAISYLTGECNYGGRVTDDWDRRLLLTMLADFYNSFIIENPHYKFSPSGNYYAPPKGTYDDYIEFIKKLPFTQEPEIFGLHENVDISKDLQQTKVLFESLLLTQGGAKQTGSSGSTDQVLLEITEDILTQLPNDFDIEAALKNYPVRYEESMNTVLVQEMERFNNLIRTIRNTLRDLKKAIKGLVVMDSALEALSGSLLIGKVPEMWAKRSYPSLKPLGSYITDFLARLKFLEDW-FSSGKPSVFWISGFFFTQAFLTGAMQNFARKYTIPIDLLGYEFEVIPFDYSD--TPPEDGVYIHGLYLDGARWDRFSGLLAEQYPKLLFDLMPIIWIKPNLKIEIVKIEAYICPLYKTSERKGTLSTTGHSTNFVIAMLLKT-DQPTQHWIKRGVA 3953          
BLAST of Dynein heavy chain axonemal vs. UniProt
Match: sp|P0C6F1|DYH2_MOUSE (Dynein heavy chain 2, axonemal OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 269/418 (64.35%), Postives = 337/418 (80.62%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVV--SVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNI Y FNDSDFEVSENLLS YLD+YE TPWDALKYLIA +NYGGHVTDD DRRLL TYI DYF + ++  PF++LS++ +YYIP+DGSL SY+E+I+MLP++D PEAFGQHPNAD+ASQI E R LF+TLLSL+PQ+    VGG S+E+KVLE++ ++ +++PE IDYEGT K+L+ DP PLNVVLLQEIQRYN  +  I   L+DLEKGIQGL+VMS+ LE+IF+ I+D  VP LW K YPS KPLASWTRDL  R+E F+ WA  A  P +FW+S FTFPTGFLTAV+Q++AR NNISVD+L+W+F V T+ ++N+   PKDGV+V+GLYL+GAGWD KNS L+EA PM+L C MP IHF+P E++KKS K  Y CPCYYYPNRAG +DR S++  ++L++G    +HW KRGTA
Sbjct: 4032 WNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFYRLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEKVLELAADVKQKIPEMIDYEGTRKLLALDPSPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYPSQKPLASWTRDLAVRVEQFETWASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNNISVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTA 4449          
BLAST of Dynein heavy chain axonemal vs. UniProt
Match: sp|Q9P225|DYH2_HUMAN (Dynein heavy chain 2, axonemal OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 268/418 (64.11%), Postives = 336/418 (80.38%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVV--SVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNI Y FNDSDFEVSENLLS YLD+YE TPWDALKYLIA INYGGHVTDD DRRLL TYI DYF ++++  PF +LS + +Y+IP+DGSL SY+E+I++LP +D PEAFGQHPNAD+ASQI E + LFDTLLSL+PQ+     GG ++E+KVLE++ ++ +++PE IDYEGT K+L+ DP PLNVVLLQEIQRYN  +  I   L+DLEKGIQGL+VMS+ LE+IF+ I+D  VP LW KAYPS KPLA+WTRDL  R+E F+ WA  A  P +FW+S FTFPTGFLTAV+Q+SAR NN+SVD+L+W+F V T+ ++N+   PKDGV+V+GLYL+GAGWD KNS L+EA PM+L C MP IHF+P E++KKS K  Y CPCYYYPNRAG SDR S++  ++L++G   P+HW KRGTA
Sbjct: 4003 WNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALETYFIPKDGSLASYKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQPQITPTRAGGQTREEKVLELAADVKQKIPEMIDYEGTQKLLALDPSPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYPSQKPLAAWTRDLAMRVEQFELWASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNVSVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSSDRASFVIGIDLRSGAMTPDHWIKRGTA 4420          
BLAST of Dynein heavy chain axonemal vs. UniProt
Match: sp|Q9MBF8|DYH1B_CHLRE (Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC10 PE=1 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 3.204e-147
Identity = 209/419 (49.88%), Postives = 306/419 (73.03%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDS---KEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            +NIPY+FND+DF VS++LL +YLD YE TPWDALKYLIA+ NYGG VTD+LDRR+L +Y+  ++ E+A+  P + LS +S+YY+P +G L S++++I  LP  D PEAFGQHPNA+I+  I+++++L D+LLSL+P+     G +   +ED V+ I+ ++  Q+P+  + E   K  + DP  L+VVL QE++RYN  L  +R+   +L++GI+GLVVMS+DL+ IF+S+Y  KVP  W K YPS+KPL  WTRDL+ RIE    W    + P+V+W+S FT+PTGFLTAV+QT+AR  ++ +DTL+++F+++ + E  I + PK+GVY+KGL+L+GAGWD +N  L E +PMEL   MP++ F+P+ENKK++ K  Y CP Y YP R G  +RPS++ +V+L++G   P+HW  RGTA
Sbjct: 4089 FNIPYDFNDTDFSVSDDLLKSYLDSYEQTPWDALKYLIAEANYGGRVTDELDRRVLASYLNKFYCEDALAVPGYLLSPLSTYYVPENGPLQSFKDYILTLPAGDRPEAFGQHPNAEISYLIEDSKVLLDSLLSLQPRTEGAAGGAGTRREDVVMAIATDLLDQVPQPFNLEEVMKAKADDPSALHVVLFQEVERYNALLVAVRRSCVELQRGIKGLVVMSADLDLIFESLYAAKVPAAWLKTYPSLKPLGPWTRDLLQRIEQLATWVEETY-PRVYWLSGFTYPTGFLTAVLQTTARKASVPIDTLSFEFSIINLDEREINAPPKEGVYIKGLFLEGAGWDFENGCLCEPNPMELIVPMPILLFRPVENKKRTAKGIYTCPLYLYPLRTGTRERPSFMINVDLRSGSADPDHWIMRGTA 4506          
BLAST of Dynein heavy chain axonemal vs. UniProt
Match: sp|Q63164|DYH1_RAT (Dynein heavy chain 1, axonemal OS=Rattus norvegicus OX=10116 GN=Dnah1 PE=2 SV=2)

HSP 1 Score: 315.464 bits (807), Expect = 2.891e-94
Identity = 177/426 (41.55%), Postives = 249/426 (58.45%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYY-IPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPC----PLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLW-SKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            +NIPYEF D D  +  + L  +LD+YE+ P+  LKY   +INYGG VTDD DRR +   + D++   A+  P  + S    Y+ IP    LN Y  +I  LP  D PE FG H NA+I     ET  LF  +L L+P+  S+GG S+E+ V +++ +I  Q+P+ +D E   ++++  P      +N VL+QE+ RYN  L +I + LSD+ K I+GLVVMS +LE +  S+Y+  VP LW SKAYPS+KPLASW  DL+ R+     W I    P VFW+S F FP  FLT  +Q  AR   IS+DT+ +DF VL+ + + IA  P  G Y+ GL+L+GA WD  +  L E+ P EL   M VI   P+ N+K   ++ Y+CP Y    RAG         +Y+ +VE+ + +    HW KRG A
Sbjct: 4090 FNIPYEFTDGDLRICISQLKMFLDEYEDIPYKVLKYTAGEINYGGRVTDDWDRRCVMNILEDFYNP-AVLSPEHRYSKSGIYHQIPPTYDLNGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALFGAILQLQPKSSSMGGQSREELVEDVAEDILVQVPKPVDLE---EVVNKYPVLYEESMNTVLVQEVIRYNKLLMVITQTLSDMLKAIKGLVVMSLELELMSTSLYNNAVPELWKSKAYPSLKPLASWIMDLLQRLNFLHSW-IKNGIPSVFWISGFFFPQAFLTGTLQNFARKFVISIDTITFDFKVLSYASSEIAERPSTGCYIYGLFLEGARWDPFDFQLAESRPKELYTEMAVIWLLPVANRKVQNQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPSNQPQ-RHWIKRGVA 4509          
BLAST of Dynein heavy chain axonemal vs. UniProt
Match: sp|E9Q8T7|DYH1_MOUSE (Dynein heavy chain 1, axonemal OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 7.308e-93
Identity = 175/422 (41.47%), Postives = 242/422 (57.35%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDY-EGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLW-SKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            +NIPYEF D D  +  + L  +LD+YE+ P+  LKY   +INYGG VTDD DRR +   + D++    +       +    + IP    LN Y  +I  LP  D PE FG H NA+I     ET  LF+ +L L+P+  S+GG S+E+ V +++ NI  Q+P  I+  E T K        +N VL+QE+ RYN  L++I + LSD+ K I+GLVVMS +LE +  S+Y+  VP LW SKAYPS+KPLASW  DL+ R++    W I    P VFW+S F FP  FLT  +Q  AR   IS+DT+ +DF VL  + + I   P+ G Y+ GL+L+GA WD  N  L E+ P EL   M VI   P  N+K   ++ Y+CP Y    RAG         +Y+ +VE+ + +    HW KRG A
Sbjct: 3824 FNIPYEFTDGDLRICISQLKMFLDEYEDIPYKVLKYTAGEINYGGRVTDDWDRRCVMNILEDFYNPAVLSSEHSYSNSGIYHQIPPTYDLNGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALFNAILQLQPKSSSMGGQSREELVEDVAENILLQVPGPIELQEVTKKFPVLYEESMNTVLVQEVIRYNKLLEVITQTLSDMLKAIKGLVVMSLELELMSISLYNNTVPELWKSKAYPSLKPLASWIMDLLLRLDFMHSW-INDGIPPVFWISGFFFPQAFLTGTLQNFARKFVISIDTITFDFKVLPEASSEIKERPQTGCYIHGLFLEGARWDSMNFQLAESRPKELYTEMAVIWLLPEANRKVQNQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPSNQPQ-RHWIKRGVA 4243          
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|23858590 (tr|V4AL85|V4AL85_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_184938 PE=4 SV=1)

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 301/416 (72.36%), Postives = 355/416 (85.34%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNI YEFNDSDFEVSENLLS YLD YE TPWDALKYLIA INYGGHVTDD DRRLL TY+ D F E A+  PFF++S + +YYIP+DG L SY+E+I+MLPNIDHPEAFGQHPNADI SQIQ+TR+LFDTLLSL+PQV S  G+S+EDKVL+++ NI +Q+PENIDYEGTA+ILSTDP PLNVVLLQEIQRYN  L+ IR  L+DLEKGIQGLVVM+ +LE+IF  I+D +VP  W KAYPSMKPL++WTRDLV R+E F KWA TAH P +FW++AFTFPTGFLTAV+Q+SARLNN+S+D+L+W+FTV+T+ E+N    P DGV VKGL+LQGAGWDMKN+ LIEA+PM+L C MPVIHFKP+ENKKKS K +Y+CPCYYYPNR G S RPS++ SVELK GEK  +HWTKRGTA
Sbjct: 3917 WNIAYEFNDSDFEVSENLLSIYLDTYEETPWDALKYLIAGINYGGHVTDDYDRRLLMTYVNDQFTEAALTTPFFRVSSLPTYYIPKDGPLASYKEYISMLPNIDHPEAFGQHPNADITSQIQDTRILFDTLLSLQPQVSSTAGESREDKVLDLAANIFRQIPENIDYEGTAQILSTDPSPLNVVLLQEIQRYNALLEEIRSSLTDLEKGIQGLVVMTLELENIFTCIFDGRVPPAWEKAYPSMKPLSAWTRDLVLRVEQFAKWAQTAHPPVLFWMAAFTFPTGFLTAVLQSSARLNNVSIDSLSWEFTVMTVDESNFVKGPMDGVLVKGLFLQGAGWDMKNTCLIEANPMQLVCPMPVIHFKPVENKKKSSKGTYMCPCYYYPNRTGTSSRPSFVVSVELKCGEKTADHWTKRGTA 4332          
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|20709125 (tr|A0A504Z1Y4|A0A504Z1Y4_FASGI Dynein heavy chain axonemal OS=Fasciola gigantica OX=46835 GN=FGIG_05064 PE=4 SV=1)

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 297/416 (71.39%), Postives = 352/416 (84.62%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFNDSDFEVSE+LL+NYLDQYE T W+AL+YLIADINYGGHVTDD DRRLL TYI +YF+++ +KEPF+KLS++  YY+PRDG+LN+YREF++MLP IDHPEAFGQHPNADI SQIQETR+L DTLLSL+PQV S  G S+EDKVLE+  N+ KQ PE+IDYEGT KI + DP PL VVLLQEIQRYN  LDLIR QLSDL KGIQGLVVMSS+LE +F +++D  VP  WSKAY S+KPL SW+RDL +R+++F KWA TAHAPK FW+ AFTFPTGFLTAV+QTSARLNN+SVD+L+W+FTV   S+ N+   PKDGVYV  L+LQGAGWD K+  L+EA+PM+L C MP++HF+P+ENKKKS KN Y+ PCYYYPNRAG SDRPS++  VELKTGEK PEHW KR TA
Sbjct: 4347 WNIPYEFNDSDFEVSEHLLTNYLDQYEETAWEALRYLIADINYGGHVTDDWDRRLLGTYIGEYFKDDVLKEPFYKLSVLPHYYVPRDGTLNAYREFVSMLPQIDHPEAFGQHPNADITSQIQETRMLLDTLLSLQPQVSSASGVSREDKVLELIDNLQKQFPEDIDYEGTVKIFANDPSPLVVVLLQEIQRYNALLDLIRNQLSDLSKGIQGLVVMSSELEAVFTAVFDNHVPEHWSKAYSSLKPLGSWSRDLSARVDLFAKWAQTAHAPKTFWIGAFTFPTGFLTAVLQTSARLNNVSVDSLSWEFTVQNTSDPNLLPTPKDGVYVCNLFLQGAGWDKKSICLVEATPMQLVCPMPIVHFRPVENKKKSMKNIYVAPCYYYPNRAGTSDRPSFMIGVELKTGEKPPEHWIKRSTA 4762          
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|22889998 (tr|A0A3Q0KTZ4|A0A3Q0KTZ4_SCHMA Dynein heavy chain, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 659.448 bits (1700), Expect = 0.000e+0
Identity = 303/416 (72.84%), Postives = 350/416 (84.13%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFNDSDFEVSE+LL+NYL QY+ TPWDAL+YLIADINYGGHVTDD DRRLLNTYI+DYFR+E +KEPF+KLS +  YYIPRDG+LN+YREF+T+LP IDHPEAFGQHPNADI SQIQETR+L DTLLSL+PQV    G S+E+KVL++  N+ KQLPE+ID+EGT K+ +TD  PL VVLLQEIQRYN  L LIR QL DL KGIQGLVVMSS+LE IF SI+D  VP+ WSK Y S+KPL SW RDL +R+E+F KWA T H PK+FW+ AFTFPTGFLTAV+QTSAR NNISVD+L+W+F+VL  S+ NI   PKDGVY+  LYLQGAGWD KNS LIEA+PMEL C MP +HFKP+ENKKKS KN Y+ PCYYYPNRAG +DRPS++  VELKTGEK PEHWTKR TA
Sbjct: 4079 WNIPYEFNDSDFEVSEHLLTNYLGQYDETPWDALRYLIADINYGGHVTDDWDRRLLNTYISDYFRDEVLKEPFYKLSSLPYYYIPRDGTLNAYREFVTLLPQIDHPEAFGQHPNADITSQIQETRVLLDTLLSLQPQVSQGTGVSREEKVLDLIDNLQKQLPEDIDFEGTMKMFATDHSPLVVVLLQEIQRYNHLLGLIRNQLLDLSKGIQGLVVMSSELEQIFTSIFDGHVPKQWSKTYSSLKPLGSWARDLAARVELFSKWASTTHPPKLFWIGAFTFPTGFLTAVLQTSARKNNISVDSLSWEFSVLATSDPNILVTPKDGVYISNLYLQGAGWDRKNSCLIEAAPMELVCPMPGVHFKPVENKKKSSKNIYVAPCYYYPNRAGTTDRPSFMLGVELKTGEKPPEHWTKRSTA 4494          
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|19063004 (tr|A0A4E0RK79|A0A4E0RK79_FASHE Dynein heavy chain axonemal OS=Fasciola hepatica OX=6192 GN=D915_001063 PE=4 SV=1)

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 296/416 (71.15%), Postives = 351/416 (84.38%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFNDSDFEVSE+LL+NYLDQYE T W+AL+YLIADINYGGHVTDD DRRLL TYI +YF+++ +KEPF+KLS++  YY+PRDG+LN+YREF++MLP IDHPEAFGQHPNADI SQIQETR+L DTLLSL+PQV S  G S+EDKVLE+  N+ KQ PE+IDYEGT KI + D  PL VVLLQEIQRYN  LDLIR QLSDL KGIQGLVVMSS+LE +F +++D  VP  WSKAY S+KPL SW+RDL +R+++F KWA TAHAPK FW+ AFTFPTGFLTAV+QTSARLNN+SVD+L+W+FTV   S+ N+   PKDGVYV  L+LQGAGWD K+  L+EA+PM+L C MP++HF+P+ENKKKS KN Y+ PCYYYPNRAG SDRPS++  VELKTGEK PEHW KR TA
Sbjct: 4357 WNIPYEFNDSDFEVSEHLLTNYLDQYEETAWEALRYLIADINYGGHVTDDWDRRLLGTYIGEYFKDDVLKEPFYKLSVLPHYYVPRDGTLNAYREFVSMLPQIDHPEAFGQHPNADITSQIQETRMLLDTLLSLQPQVSSASGVSREDKVLELIDNLQKQFPEDIDYEGTIKIFANDQSPLVVVLLQEIQRYNALLDLIRNQLSDLSKGIQGLVVMSSELEAVFTAVFDNHVPEHWSKAYSSLKPLGSWSRDLSARVDLFAKWAQTAHAPKTFWIGAFTFPTGFLTAVLQTSARLNNVSVDSLSWEFTVQNTSDPNLLPTPKDGVYVCNLFLQGAGWDKKSICLVEATPMQLVCPMPIVHFRPVENKKKSMKNIYVAPCYYYPNRAGTSDRPSFMIGVELKTGEKPPEHWIKRSTA 4772          
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|22828087 (tr|A0A5K4F755|A0A5K4F755_SCHMA Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 658.292 bits (1697), Expect = 0.000e+0
Identity = 303/416 (72.84%), Postives = 350/416 (84.13%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFNDSDFEVSE+LL+NYL QY+ TPWDAL+YLIADINYGGHVTDD DRRLLNTYI+DYFR+E +KEPF+KLS +  YYIPRDG+LN+YREF+T+LP IDHPEAFGQHPNADI SQIQETR+L DTLLSL+PQV    G S+E+KVL++  N+ KQLPE+ID+EGT K+ +TD  PL VVLLQEIQRYN  L LIR QL DL KGIQGLVVMSS+LE IF SI+D  VP+ WSK Y S+KPL SW RDL +R+E+F KWA T H PK+FW+ AFTFPTGFLTAV+QTSAR NNISVD+L+W+F+VL  S+ NI   PKDGVY+  LYLQGAGWD KNS LIEA+PMEL C MP +HFKP+ENKKKS KN Y+ PCYYYPNRAG +DRPS++  VELKTGEK PEHWTKR TA
Sbjct:  754 WNIPYEFNDSDFEVSEHLLTNYLGQYDETPWDALRYLIADINYGGHVTDDWDRRLLNTYISDYFRDEVLKEPFYKLSSLPYYYIPRDGTLNAYREFVTLLPQIDHPEAFGQHPNADITSQIQETRVLLDTLLSLQPQVSQGTGVSREEKVLDLIDNLQKQLPEDIDFEGTMKMFATDHSPLVVVLLQEIQRYNHLLSLIRNQLLDLSKGIQGLVVMSSELEQIFTSIFDGHVPKQWSKTYSSLKPLGSWARDLAARVELFSKWASTTHPPKLFWIGAFTFPTGFLTAVLQTSARKNNISVDSLSWEFSVLATSDPNILVTPKDGVYISNLYLQGAGWDRKNSCLIEAAPMELVCPMPGVHFKPVENKKKSSKNIYVAPCYYYPNRAGTTDRPSFMLGVELKTGEKPPEHWTKRSTA 1169          
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 277/420 (65.95%), Postives = 334/420 (79.52%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSV----GGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNI Y FNDSDFEVSENL+S YLD+YE  PWDALKYLIA +NYGGHVTDD DRRLL TYI DYF E A+  PFFKLS + +YYIPRDGS ++YRE+I  LP ++HPE FGQHPNADIASQI ETR LFDTLLSL+PQV S      G S+EDKVLEIS ++ +++PE +DYE T K+L  DP PLNVVLLQEIQRYN  L  IR  L++LEKGI+GLVVMSS LE++F  I+D +VP LW KAYPS+KPLASWTRDL  R+E F  WA TAH P +FW+S FTFPTGFLTAV+Q+SAR +N+SVDTL+W+F V T+ + N+   PKDGV+++GLYL+GAGWD KNS L+EA PM+L C MP IHF+P+EN+KK  KN Y CPCYY+P R+G + RPS++  V+LK+G  + EHW KRGTA
Sbjct: 3981 WNIVYSFNDSDFEVSENLMSLYLDEYEEIPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTPFFKLSSLPTYYIPRDGSQDTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVLEISADVRQKVPELVDYESTQKLLQDDPSPLNVVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFAHWAETAHPPVLFWLSGFTFPTGFLTAVLQSSARQHNVSVDTLSWEFIVSTVDDNNLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHFRPVENRKKVAKNMYSCPCYYFPVRSGGAGRPSFVVGVDLKSGAVSYEHWIKRGTA 4400          
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000012592.2 (pep primary_assembly:Astyanax_mexicanus-2.0:19:20600848:20643900:-1 gene:ENSAMXG00000012249.2 transcript:ENSAMXT00000012592.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 289.656 bits (740), Expect = 7.291e-91
Identity = 157/422 (37.20%), Postives = 230/422 (54.50%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTD-PCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLW-SKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFN++D  +S   L  +LDQYE  P+DAL+Y+  + NYGG VTDD DRR L T ++ ++    I +P +K      YY P +G  NSY E+   LP    PE FG + NADI     ET+LLFD++L  + +       S +D V E++ +I  +LP + + E   +   T     +N VL+QE+ R+N  L  IR    +++K I+GLVVMS++LE++  SI + ++P +W  K+YPS+KPL  +  D + R+   Q W      P +FW+S F F   FLT   Q  AR + I +D L +DF V+   E      P+DGVY++GL+L G   D                 MPVI  KP+  +   Q+  Y+CP Y    R G         +Y+ ++ L + + +PEHW +RG A
Sbjct:  253 WNIPYEFNETDLRISVQQLHMFLDQYEEVPFDALRYMTGECNYGGRVTDDWDRRTLRTILSIFYTASIITDPQYKFDPSGIYYSPTEGDHNSYIEYTKSLPLYPSPEIFGMNANADITKDQVETQLLFDSILLTQSRTSGGAAKSSDDMVYEVAADILSKLPPDFNMEAAMRKFPTSYNQSMNTVLVQEMGRFNKLLQTIRDSCINIQKAIKGLVVMSAELEEVVTSILNGRIPSMWMKKSYPSLKPLGGYVNDFLERLAFLQGWYDNG-MPPIFWMSGFFFTQAFLTGSQQNYARKHTIPIDLLGFDFEVMDDKEYR--QPPEDGVYIRGLFLDGILHD----------------TMPVIWLKPLRKQDVPQRLCYLCPVYKTSERRGTLSTTGHSTNYVIAMTLNS-DISPEHWIRRGVA 654          
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000035036.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000306.1:28253:41527:-1 gene:ENSAMXG00000034776.1 transcript:ENSAMXT00000035036.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 288.886 bits (738), Expect = 1.136e-90
Identity = 160/426 (37.56%), Postives = 242/426 (56.81%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMS-SYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPC----PLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLW-SKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFN+SD  +S   +  +LD+YE  P +AL YL  + NYGG VTDD DRRLL + ++ ++ +E I++  +++     +YYIP  G   SY E+I  LP    P  +G H NADI    QET  L D +L   P+    G  S ++ V E++ +I  +LP + D E    ++   P      +N VL QE+ R+N    ++R  L ++ K ++G VVMS++LED+F+S+   KVP LW +K+YPS+KPL S+  DL++R+   Q+W I    P VFW+S F F   FLT V Q  AR   I +D +++ + V+        + P+DG YV+GL+L+GA WD +  +L E+ P  L   +P+I  +P ++    Q + Y CP Y    R G         +YI ++ L + ++  +HW  RG A
Sbjct:  230 WNIPYEFNESDLRISMRQIQMFLDEYEEIPLEALTYLTGECNYGGRVTDDKDRRLLISLLSTFYCQELIQQHQYRVCEGGDTYYIPPHGPYESYVEYIRSLPITAEPGVYGLHSNADITKDNQETNQLLDGVLLTLPRQTGGGAKSPQEVVDELAEDIMVKLPCDFDLE---TVMIKYPVMYQESMNTVLRQELIRFNRLTQVVRSSLVNIRKALKGQVVMSAELEDVFNSMLVGKVPALWAAKSYPSLKPLGSYISDLLARLHFLQEW-IDNGPPVVFWLSGFYFTQSFLTGVSQNFARKYTIPIDYISFQYQVM-------GARPEDGAYVRGLFLEGARWDRERGVLAESLPKILFDPLPIIWLQPAQSSASQQHSVYQCPVYKTSARRGTLSTTGHSTNYILTIHLPS-DQPHKHWINRGVA 643          
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 290.041 bits (741), Expect = 1.533e-86
Identity = 165/422 (39.10%), Postives = 238/422 (56.40%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTL-LSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPC----PLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPY FN+SD  +S   L  +++ YE  P++A+ YL  + NYGG VTDD DRRLL T +AD++ ++ I+ P +  S    YY P       Y EFI  LP   HPE FG H N DI+  +Q+T+LLFD+L L+             +  +++I+ +I  +LPEN + +     L+  P      +N VL+QE++RYN   + IR  L +L K I+GLVVM ++LE I  S+   KVP  W+K +YPS+KPL S+  D ++R++  Q W  T   P VFW+S F F   FLT  +Q  AR  +I +D L++D+ VL    +  A++P+DGVYV GL+L GA WD K+ +L E  P  L  ++P+I  KP   K         C        +      +++ S+ L T  K P+HW KRG A
Sbjct: 3477 WNIPYGFNESDLRISIRQLQLFVNSYEEVPFEAITYLTGECNYGGRVTDDWDRRLLLTILADFYNKDIIENPRYMFSPSGKYYSPPKSIYEDYVEFIRNLPATQHPEVFGMHENVDISKDLQQTKLLFDSLILTQGGGSKGGASSGGDSTLMDIANDIRTKLPENFNIDSA---LNKFPVLYEESMNTVLVQEMERYNNLCNTIRVSLQNLLKAIKGLVVMDAELEAIAGSLLVGKVPEKWAKRSYPSLKPLGSYITDFLTRLKFLQDWYDTTK-PNVFWLSGFFFTQAFLTGAMQNYARKYSIPIDLLSFDYEVLPFDTS--ATSPEDGVYVHGLFLDGARWDKKSGVLAEQHPKVLFDSVPIIWIKP---KHCCTFLLLSCTSERKGTLSTTGHSTNFVISIMLPTS-KRPQHWIKRGVA 3888          
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 274.633 bits (701), Expect = 3.378e-81
Identity = 158/423 (37.35%), Postives = 230/423 (54.37%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYE---NTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQ-VVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPC--PLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLN-NISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            W+IPYEFN +DF  +   + N+LD  +      W  ++Y+I +I YGG VTDD D+RLLNT+   +F E      F        Y+IPR  S++ Y ++I  LP  D PE FG HPNADI  Q +  + + DT+LS++P+   S GG+++E  V  ++ ++ ++LP +       K L T     P+N+ L QEI R    L L+R  L+DL+  I G +VMS +L D  D +YD ++P  W KA  +   L  W  +L+ R + FQ W I    P  FW++ F  P GFLTA+ Q   R N   ++D +     V    + +I   P++GVYV GLYL+GAGWD +N  L+++ P  L   MPV+     EN        Y CP Y  P R       + I +V+L+T ++ PE+W  RG A
Sbjct: 3755 WSIPYEFNQADFNATVQFVQNHLDDMDMKRGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFNHEF---QFYKDYHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEVMKRLETMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKKASWASSTLGFWFTELLERNQQFQAW-IFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYA-ENNGVKDSRLYSCPIYKKPARTD----QNIIAAVDLRTSQR-PEYWILRGVA 4167          
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000736.1 (pep scaffold:Pmarinus_7.0:GL477446:167298:178455:-1 gene:ENSPMAG00000000670.1 transcript:ENSPMAT00000000736.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 259.996 bits (663), Expect = 1.307e-78
Identity = 149/425 (35.06%), Postives = 219/425 (51.53%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYE---NTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITM-LPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQ-VVSVGGDSKEDKVLEISGNITKQLPEN-IDYEGTAKILSTDPC-PLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLN-NISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNS-YICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFN +DF  +   + N+LD  +      W  ++Y+I +I YGG VTDD D+RLLNT+   +F E      F   S    Y IPR  +++ Y       LP    PE  G H N DI  Q    R + DT L ++P+   + GG+++E  V   +  + ++LP++ I YE   ++       P+N+ L QE++R    + L+R  L+DL   I+G ++MS  L D  D +YD ++P  W KA  +   L  W  +L+ R   F+ W      P  FW++ F  P GFLTA+ Q   R +   ++D++     V      ++  +P +GVYV GL+L+GA WD +N  L EA P  L   MPV+H     N   S+    Y CP Y  P R  +    +YI  V+L+T +  PEHW  RG A
Sbjct:  435 WNIPYEFNQADFNATVQFVQNHLDDMDIKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFTQVWFSENMFLPTF---SFHKDYTIPRCTTVDQYLTLPRQSLPAATTPEVLGLHANGDITYQTTVARDVLDTALGIQPKDSAAGGGETRESIVYAKAQEMLEKLPQDYIPYEVREQLQKMGALQPMNIFLRQEVERMQRVISLVRSTLNDLRLAIEGTIIMSEGLRDALDCMYDARIPARWRKASWASSTLGFWFTELLERDRQFRSWCFQGR-PSCFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNDVTRWLREDVTRSPDEGVYVHGLFLEGAAWDRRNGRLAEARPKALFEPMPVVHIYAANNPAGSKDTQLYSCPIYKKPVRTDL----NYIADVDLRTAQ-PPEHWILRGVA 850          
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 260.766 bits (665), Expect = 4.253e-77
Identity = 161/448 (35.94%), Postives = 240/448 (53.57%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLS-NYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVG-GDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDP-----CPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWS-KAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTIS-------------------EANIA-SAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNI YEFNDSD E +  LL+ N   Q    PWDAL Y+  +I YGG VTD  D+R L T +  +F  + + EP +  S    YY   + +L  ++++I  LP  D PE FG H NA++A Q QET  L  T+L ++P+    G G S ++ V E++ +I  +LPE +D EG  + L T         L  VL QE+ R+N  L +IR  L  L+K I G VVMS ++E I++S  +++VP LWS  AYPS+KPL  W +DL  R      W I    PK FW+S F FP GFLT  +Q  AR  N+ +D L + +  L +                    EA+I   A +DGV V GL++  + WD ++ ++ +A   ++   +PV+HF+P +N  +   + Y  P Y    RAG         +++ +V + + ++  ++W  +G A
Sbjct: 3663 WNIHYEFNDSDRECA--LLNLNLFCQDGRIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPKTL-EPGYLYSTSGIYYASEEKTLQDHKDYIENLPLNDDPEIFGMHENANLAFQRQETGTLVKTILEVQPRSSGQGAGTSNDEIVKELADSILAKLPEILDMEGAMESLFTRDEKGRINSLTTVLEQEVDRFNTLLQVIRSSLHTLKKAIAGFVVMSEEMEKIYNSFLNSQVPVLWSDNAYPSLKPLGGWVKDLALRTTFIDAW-IKTGPPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELGFHYKTLPVYRDQTSVAEAMRTQQFGQELEADIQLPAVQDGVLVHGLFMDASRWDDEDMVMEDALAAQMNPPLPVLHFEPCQN-YQPDPSLYHAPLYKTSARAGTLSTTGHSTNFVVTVFIPS-KRDSDYWISKGAA 4104          
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010311.1 (pep scaffold:Pmarinus_7.0:GL480858:2016:13852:-1 gene:ENSPMAG00000009337.1 transcript:ENSPMAT00000010311.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 229.565 bits (584), Expect = 8.467e-69
Identity = 120/312 (38.46%), Postives = 182/312 (58.33%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLE-ISGNITKQLPENIDYE-GTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTV 927
            WNIPY FN+SD  +S   L  ++ +YE+ P++A+ YL  + NYGG VTDD DRR L T + D++  + +++  +  S    Y  P  G+     EFI  LP    PE FG H N D++  +Q+TR LFD+L+  +      G  S  D +L+ I+G+I  +LP++ D E G  K        +N VL+QE++R+N  +  IR  L +L+K I+GLVVMSS+LE +  S+   K+P  W+K +YPS+KPL ++  D ++R++    W      P +FW+S F F   FLT  +Q  AR + I +D L ++F V
Sbjct:  335 WNIPYGFNESDLRISIRQLQLFVTEYEHVPFEAISYLTGECNYGGRVTDDWDRRCLLTVLQDFYSPQLLEDAHYNFSPSGLYRAPPRGTYEDCIEFIKKLPFAQQPEVFGMHENVDVSKDLQQTRTLFDSLVLTQGGGRKGGSASNTDSLLQDIAGDILSKLPKDFDIEAGLQKFPVRYEESMNTVLVQEMERFNNLIRTIRSTLQNLQKAIKGLVVMSSELEALTSSLMVGKIPESWAKRSYPSLKPLGNYITDFLARLKFLHDW-FDHGKPHIFWLSGFFFTQAFLTGAMQNYARKHTIPIDLLGFEFEV 645          
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005733.1 (pep scaffold:Pmarinus_7.0:GL479460:527:9078:1 gene:ENSPMAG00000005198.1 transcript:ENSPMAT00000005733.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 222.631 bits (566), Expect = 2.289e-66
Identity = 123/364 (33.79%), Postives = 194/364 (53.30%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVG---GDSKEDKVLEISGNITKQLPENIDYEGTAKIL--STDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPV 1074
            WN  Y FN  D  +S N+L NYL+     PW+ L+YLI +I YGGH+TDD DRRL   Y+ +    E ++  F   S+   +  P +     Y  ++      + P  +G HPNA+I      +  LF  LL L+P+  + G     + E+KV  +  +I ++LPE       A+++  + +  P  +V  QE +R N  L  +R+ L +L+ G++G + +S+++E + ++++   VP  W+K AYPS   LA W  DL+ R      W      P V W+S F  P  FLTA++Q +AR N   +D +     V    + ++  AP++G YV GL+++GA WD +  ++ EA   ELT AMPV
Sbjct:  268 WNRSYPFNTGDLTISCNVLYNYLEANAKVPWEDLRYLIGEIMYGGHITDDWDRRLCRAYLQELVHPEQLEGEF---SLAPGFLAPPNLDYLGYHRYVDECLPPESPALYGLHPNAEIEFLTLTSSALFRKLLELQPRDNASGEGAAGTAEEKVKGVLDDIVERLPEEFH---MAEVMGKTAERSPFVLVCFQECERMNLLLGEVRRSLRELDLGLKGELTISAEMERLQNALFYDLVPDSWTKLAYPSTYGLARWFADLLLRCRELDTWTHDLALPAVVWLSGFFNPQSFLTAIMQVAARRNEWPLDRMTLTVDVTKKGKDDVGHAPREGAYVHGLFMEGARWDGQAGLIAEARLKELTPAMPV 625          
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009595.1 (pep scaffold:Pmarinus_7.0:GL478108:144315:184457:1 gene:ENSPMAG00000008659.1 transcript:ENSPMAT00000009595.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 228.409 bits (581), Expect = 5.294e-66
Identity = 135/430 (31.40%), Postives = 219/430 (50.93%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYE-----NTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADY---FREEAIKEPFFKLSIMSSYYIPRDGSLNSY--REFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVG-GDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYP-SMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVD--TLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WN+ Y+FN+SDF+V   +L  YL +         PW +LKYLI ++ YGG   D  DRR+L TY+ +Y   F  ++ +   F  +  + Y +P DG  ++Y     +  LP  + PE FG H NA+I    Q  R ++  L+ L+PQ    G G S+++ +  ++ +I  +LP   +   T K L     P  VVLLQE+QR+N  L  + + L++L+K + G V MS +L+++  ++++  +P +W +  P ++K LA+W      R + +  W +    P V W+S    P  +LTA++Q + R N   +D  TL    T     E  +   P  G +V GL+L+GA WD++ S L+ + P  L   +PV+   PIE+ +   +++   P Y    R          E+    T  K P HW  +G  
Sbjct: 1868 WNVSYDFNESDFQVCMEILCTYLSKAHEQANGRIPWASLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFLFDSFQVFHFFCNSETDYRLPPDGPKDAYIVTAEVESLPLANTPEVFGLHSNAEIGYYTQAARDMWRHLVDLQPQTGETGSGVSRDEFISGVARDIQARLPLPFELGQTRKRLGAVLSPTAVVLLQEMQRFNALLQRMARSLAELQKALAGEVGMSGELDEVARALFNGTIPAIWRRLAPDTLKSLANWMVHFHQRHQQYSAW-VEDGEPTVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLYTQVTTFRGPE-EVTERPGQGCFVSGLFLEGADWDVEASCLVRSKPKVLMVQLPVLKIIPIESHRLKLQSTLRTPVYTTSTRRNAMGVGLVFEADLFTT--KHPSHWVLQGVC 2293          
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Match: EDO32003 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWB2])

HSP 1 Score: 267.7 bits (683), Expect = 4.036e-85
Identity = 145/423 (34.28%), Postives = 228/423 (53.90%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYE---NTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVG-GDSKEDKVLEISGNITKQLPEN-IDYEGTAKILSTDP-CPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLN-NISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFN +DF  S   + N+LD  +      W+ ++Y++ ++ YGG VTDD D+RLLNT+   +F E    + F      +SY IP+  +L  + E I  +P+ D P+ FG HPNADI  Q    + + DT++S++P+    G G+++E  V+ ++ ++ ++LP + I +E  +++        +N+ L QEI R    + L+R  L+DL   I+G ++MS +L D  D++YD +VP LW K       L  W  + + R   F  W      P  FW++ F  P GFLTA+ Q   R +   ++D++     V+   + +I S P +GVY+ GLYL GA WD +   L+E+ P  L   +PV+H   + +        Y CP Y  P R  +    +YI  + LKT +  P+HW  RG A
Sbjct:   29 WNIPYEFNQADFTASVQFIQNHLDDLDIKKGISWNTVRYMLGEVQYGGRVTDDYDKRLLNTFAKVWFGEHMFPDDF---CFYTSYPIPKCKTLEQFMEAIQAMPSTDTPQVFGLHPNADITYQSNTAKEVLDTIMSIQPKDSGGGAGETRESIVMRMANDMLEKLPPDYIPHEVKSRLQKMGALTSMNIFLRQEIDRMQRVITLVRHTLTDLNLAIEGTIIMSENLRDALDNMYDARVPALWRKISWESSTLGFWFTEFLERNSQFSAWLFQGR-PNTFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLHNDVIKQMKEDITSPPAEGVYIYGLYLDGASWDRRGCKLVESQPKVLFTNLPVVHVYAVNSTAPKDPRLYQCPVYKKPQRTDL----TYITPLWLKTVQN-PDHWIMRGVA 442          
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Match: EDO42621 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0Y2])

HSP 1 Score: 281.952 bits (720), Expect = 3.109e-84
Identity = 164/422 (38.86%), Postives = 231/422 (54.74%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYY-IPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWS-KAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            +NIPYEF   D  +  + LS +LD+YE  P+  LKY    INYGG VTDD DRR + T I D F    + E   K SI   Y+ +P       Y  +I  LP  D PE F  H NA+I     ET  L   +L ++P+  +  G S+E+ + E +  I +++P+              P PL  ++ +   RY   ++    +   L +G QG + M   LE++ +S++D  VP LW+ KAYPS+KPLASW  DLV+RI+  QKW I    P VFW+S F FP GFLT  +Q  AR  +IS+D + +DF VL   E  + + PKDG Y++GL+L+GA WD ++  L E+ P EL   MP+I  KP  N++K     Y CP Y    RAG         +++ SVE+ +G K  +HW K+G A
Sbjct: 1280 FNIPYEFTTGDLRICISQLSMFLDEYEGIPFKVLKYTAGHINYGGRVTDDWDRRCIMT-ILDSFYSPNVVESQHKFSISGIYHSLPDSTDHEGYVHYIRSLPINDTPEIFSLHDNANITFAQNETFNLLHGILKMQPKASTGKGRSREEVMEETAKGILERVPQ--------------PIPLGPLMEKYPVRYEESMNTTDAE--RLAQGTQGSLGMFQTLENMSNSLFDNSVPDLWAGKAYPSLKPLASWVLDLVARIQFVQKW-IDNGIPPVFWISGFFFPQGFLTGTLQNFARAYSISIDVIAFDFEVLKQQEDELKTRPKDGCYIRGLFLEGARWDTESHELAESRPKELFTDMPIIWLKPAANREKPSSGIYDCPVYKTLTRAGTLSTTGHSTNFVLSVEIPSG-KPQDHWIKQGVA 1682          
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Match: EDO45806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR2])

HSP 1 Score: 274.633 bits (701), Expect = 1.485e-81
Identity = 151/422 (35.78%), Postives = 235/422 (55.69%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNA-DIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGT-AKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLW-SKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIES--VELKTGEKAP-EHWTKRGTA 1248
            WNIPYEFN++D  +S   L  ++++Y+   ++ALKYL  + NYGG VTDD DRR L T +  ++    IK+  +K S   +YY P DG   +Y E+   LP I+HPE F  H N   + + ++   +L     + +  ++S GG S ++ V  +S +I  ++P+  D +    K  +T    +N VL+QE+ R+N  + ++R  L +++K I+GLVVMSS+LE++   I   K+P LW  K+YPS+KPL S+  DL++R++  Q W     AP VFW+S F F   FLT   Q  AR   I +D L +DF VL   +    + P+DGVYV GL+++GA WD     + E+    L  ++PV+   P + +   ++  Y+ P Y    R G      +  +  +E++     P EHW  RG A
Sbjct: 3517 WNIPYEFNETDLRISVQQLHMFMNKYDEVQYEALKYLTGECNYGGRVTDDRDRRTLLTILNKFYTPGVIKDDRYKFSPSGNYYAPDDGDYETYIEYARSLPLINHPEIFDMHANVFSLRTSMRHISVLTHQTCT-QCVLLSGGGRSDDEIVASVSEDILSKMPQEFDTDAALRKFPTTYTQSMNTVLVQEMVRFNRLIKVVRSSLVNIQKAIKGLVVMSSELEEVVSGILKGKIPGLWMKKSYPSLKPLGSYVNDLLARLKFLQDWYDNG-APSVFWISGFFFTQAFLTGSKQNFARKYTIPIDLLTFDFEVL--EDKKYETPPEDGVYVNGLFMEGARWDRDTKAIGESQAKVLFDSLPVMWLCPCKTEDIKKRPHYVTPVYKTSERRGTLSTTGHSTNFVMEMRLPSDQPQEHWVMRGVA 3934          
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Match: EDO35603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ5])

HSP 1 Score: 273.478 bits (698), Expect = 3.535e-81
Identity = 151/423 (35.70%), Postives = 226/423 (53.43%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYE---NTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQ-VVSVGGDSKEDKVLEISGNITKQLPEN-IDYEGTAKILSTDP-CPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNI-SVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFN +DF  S   + N+LD  +      W+ ++Y++ ++ YGG VTDD D+RLLNT+   +F E      F   +    Y IP+  S+  + E I  L  +D PE FG HPNADI  Q    +   DT+LS++P+   S GG+++E  V +++ ++ ++LPE+ I +E  A++    P  P+N+ L QEI R    +  +R  L+DL+  I G ++MS  L D  D +YD ++P  W K       +  W  +L+ R   F+ W      P VFW++ F  P GFLTA+ Q   R +   ++D++     V    + +I + P +GVYV GL+L GAGWD +   L+E     L   +PVIH   I +        Y CP Y  P R  +    +YI  V+LKT +  P+HW  RG A
Sbjct: 4195 WNIPYEFNQADFTASVQFVQNHLDDMDIKKGVSWNTVRYMLGEVQYGGRVTDDFDKRLLNTFAKVWFSEGMFHPSF---NFYKGYVIPKGTSVQQFLEHIDGLKLVDSPEVFGLHPNADITYQSNLAKDCLDTILSIQPKDSSSGGGETRESIVHKMADDMLEKLPEDYIQHEVKARLQKMGPLSPMNIFLRQEIDRMQRVITAVRITLTDLKLAIDGTIIMSETLRDSLDCMYDARIPTHWKKVSWESSTIGFWFTELIERNAQFRTWCFDGR-PNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLHNDVTRFFKDDITTPPAEGVYVHGLFLDGAGWDRRGCKLVEPPAKVLFTPVPVIHIYAINSTGGRDNRLYQCPIYKKPRRTDL----TYIACVDLKTNQN-PDHWILRGVA 4608          
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Match: EDO31800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW2])

HSP 1 Score: 271.937 bits (694), Expect = 1.163e-80
Identity = 169/448 (37.72%), Postives = 244/448 (54.46%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVS-ENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVL-EISGNITKQLPENIDYEGTAK-ILSTDP----CPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVL-------TISEANIA-------------SAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGI----SDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNI YEFNDSD   + ENL    +D  EN PWDAL ++   I YGG VTD+ D+R L T +  +F  + I E  +K S    Y+ P   SL+ YRE++  LP  D PE FG H NA+IA Q QET  L  T+L ++P++ S GG    D+++ E++ +I  +L + +D E   K +  TD       L  VL QE+ R+N  L +I+  L+ L+K I+GLVVMS +L+ ++ S  + +VP +W+  +YPS+KPL SW +DLV R    ++W I    PK FW+S F FP GFLT  +Q  AR  N+ +D L + + VL        ++E                   P DGV V GLYL GA WD  + +L +A   E+   +P++H +P  N      + Y+ P Y    RAG+        +++ SV L T +     W ++GTA
Sbjct: 3446 WNIKYEFNDSDRMCALENLKMFLVD--ENIPWDALTFITGQITYGGRVTDEWDQRCLTTILGRFFSPK-ILEDNYKFSESGIYFPPGFESLHDYREYVDNLPLTDEPEVFGMHENANIAFQTQETHQLIYTVLEVQPRLASSGGGKTNDEIVYELADSILGKLMDVLDMEKAEKSLFETDAKGRYNSLTTVLGQEVDRFNNLLKVIKNSLTQLQKAIKGLVVMSLELDKVYTSFLNNQVPDMWANSSYPSLKPLGSWVKDLVLRTMFVEQWIIHG-PPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDQLTFSYNVLPQYRNQEEVAEETAKLEYGQALPLDEELDCPDDGVLVHGLYLDGARWDDDSMMLGDARYGEMNPPLPILHMEPQMN-LVPDPSQYMSPLYKTSARAGVLSTTGHSTNFVVSVYLPT-DLPQAFWIEKGTA 3887          
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Match: ENSORLT00000041771.1 (pep primary_assembly:ASM223467v1:18:6917414:6928264:1 gene:ENSORLG00000022425.1 transcript:ENSORLT00000041771.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 296.59 bits (758), Expect = 3.202e-93
Identity = 167/374 (44.65%), Postives = 218/374 (58.29%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASA-PKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKN 1119
            WN+ Y+FN SDFEVSENLL  YLD+Y+N PWDALK+LIADI YGGHVTD  DRRLL TY+ D+F E ++      LS+          + +SY   I  LP+ +HPE FGQHPNADIASQI ET++LFD LLS++PQ  S            ISG      P   D   T+                             +  + LE GI+G VVMSS +E  F  I++        +AYPS+KPLA+WTRDL  R+  F  WA TA  P +FW+S FT P GFLTAV+Q+ AR  +  +  + W F     S  ++     +DGV+V GL+L+GA WD KNS L+E +PM++ C +P IHFKP++ +KK  K+
Sbjct:  339 WNVVYDFNHSDFEVSENLLCFYLDKYDNIPWDALKHLIADIIYGGHVTDQWDRRLLTTYMDDFFCERSVCA-VPPLSLSPLPLPSPSHTRSSYSLHIQALPSTEHPELFGQHPNADIASQIAETKMLFDNLLSMQPQFSSS----------SISGGAQ---PTKEDAVRTS-----------------------------RDATQLENGIKGFVVMSSGMEQTFTCIHE-------GRAYPSLKPLAAWTRDLHQRVAQFGHWANTAQPPILFWLSGFTSPNGFLTAVLQSYAR--HWVLCLVLWIFEKPECSITHVVFGYHQDGVFVWGLFLEGASWDTKNSCLVEPTPMQMVCPVPPIHFKPVKKRKKPSKS 660          
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 298.901 bits (764), Expect = 1.302e-89
Identity = 178/428 (41.59%), Postives = 246/428 (57.48%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVL-EISGNI-TKQLPENIDYEGTAKILSTDPC----PLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNS-YICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPY FN+SD  +S   L  ++++Y+  P++A+ YL  + NYGG VTDD DRRLL T +AD++ E+ IK   + LS    Y+ P   S   Y +FI  LP    PE FG H N DI+  +Q+T+LLFD+LL  +      G  S  D  L +I+ NI T+QLP   D E    +L   P      +N VL+QE++RYN     I   L +L K ++GLVVM S+LE +  ++   KVP  W+K +YPS+KPL S+  D ++R++  Q W      PKVFW+S F F   FLT V+Q  AR   I +D L +DF VL I ++   + P+DGVYV GL+L GA WD K  +L E  P  L  +MP+I  KP E K   Q +S Y+CP Y    R G         +++ ++ L T +K P+HW KRG A
Sbjct: 3258 WNIPYGFNESDLHISMRQLQQFVNEYDKVPFEAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCEDIIKTFRYPLSPSGKYFAPPKSSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSGGDNTLYDIANNILTQQLPPTFDREA---VLLKYPVLYEESMNTVLVQEMERYNL-CSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQ-PKVFWLSGFFFTQAFLTGVMQNFARKYQIPIDLLTFDFEVLPIDKSE--TPPEDGVYVNGLFLDGARWD-KEGVLTEQHPRILFDSMPIIWVKP-EKKNMIQTDSLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLST-KKRPQHWIKRGVA 3675          
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Match: ENSORLT00000020555.2 (pep primary_assembly:ASM223467v1:9:27094964:27108302:1 gene:ENSORLG00000016407.2 transcript:ENSORLT00000020555.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 273.478 bits (698), Expect = 2.267e-83
Identity = 151/422 (35.78%), Postives = 239/422 (56.64%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFIT-MLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVG---GDSKEDKVLEISGNITKQLPENIDY-EGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WN PY FN  D  +S N+L NYL+     P++ L+YL  +I YGGH+TDD DRRL  +Y+ ++ + E ++   F   +   + +P +     Y ++I   LP  + P  +G HPNA+I    Q +  LF T+L ++P+  +VG   G ++E+KV  +   IT +LP+  +  E  AK  + +  P  VV LQE +R NF +  IR  L +L  G++G + M+SD+E + ++++   VP  W+K AYPS   LA W  DL++RI   + W+++   P V W+S F  P  FLTA++Q  AR N + +D++     V   +  + +S P++G Y+ GL+++GA WD +  I++ A   ELT  MPV++ K +   K+  K+ Y CP Y    R      P+Y+ + +LK+ EK P  WT  G A
Sbjct:  384 WNRPYPFNIGDLTISVNVLQNYLEANRKVPYEDLRYLFGEIMYGGHITDDWDRRLCCSYLEEFIKPEMMEGKVF---LAPKFPLPGNMQYEGYHKYIDDNLPG-ESPYLYGLHPNAEIGFLTQTSEKLFSTVLEMQPRDEAVGEEGGMTREEKVCAVMEEITGRLPDQFNMSELFAK--AQERSPYEVVALQECERMNFLIREIRSSLRELSLGLKGELTMTSDMESLQNALFLDAVPDGWTKLAYPSTLSLALWFSDLLTRISQLEAWSVSFCLPPVVWLSGFFNPQSFLTAIMQDIARRNKLPLDSMRLQCEVTKRNLEHFSSPPREGAYIHGLFMEGAQWDTQKGIIVPAGMKELTSPMPVMYIKAVPASKQDTKDVYRCPVYKTHQRG-----PTYVWTFDLKSKEK-PSTWTIAGVA 793          
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 267.314 bits (682), Expect = 1.199e-78
Identity = 160/423 (37.83%), Postives = 228/423 (53.90%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYEN---TPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQ-VVSVGGDSKEDKVLEISGNITKQLPEN-IDYEGTAKILSTDPC-PLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLN-NISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFN +DF  +   + N+LD  +      W+ ++Y+I +I YGG VTDD D+RLLNT+   +F +   +  F   +    Y IP+  S++ Y  +I  LP  D PE FG HPNADI  Q ++ + + DT+LS++P+   S GG+++E  V  ++ ++ ++LP + I +E   ++    P  P+N+ L QEI R    + L+R  L DL+  I G ++MS +L D  D +YD ++P  W K++ S   L  W  +L+ R   FQ W      P  FW++ F  P GFLTA+ Q  AR N   ++D +     V    + +I   P  GVYV GLYL+GA WD  N  L E+ P  L   MPVI     EN        Y CP Y  P R  I    + I SV LKT +  PEHW  RG A
Sbjct: 3697 WNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDF---NFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFE-VKRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKSWAS-STLGFWFTELLERNRQFQTWLFKGR-PNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA-ENNVVKDPRLYSCPIYKKPTRTDI----NCIASVGLKTTQ-PPEHWVLRGVA 4107          
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 267.314 bits (682), Expect = 1.390e-78
Identity = 162/430 (37.67%), Postives = 231/430 (53.72%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYEN---TPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQ-VVSVGGDSKEDKVLEISGNITKQLPEN-IDYEGTAKILSTDPC-PLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLN-NISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVI-----HFKPIENKKKSQKNS--YICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFN +DF  +   + N+LD  +      W+ ++Y+I +I YGG VTDD D+RLLNT+   +F +   +  F   +    Y IP+  S++ Y  +I  LP  D PE FG HPNADI  Q ++ + + DT+LS++P+   S GG+++E  V  ++ ++ ++LP + I +E   ++    P  P+N+ L QEI R    + L+R  L DL+  I G ++MS +L D  D +YD ++P  W K   +   L  W  +L+ R   FQ W      P  FW++ F  P GFLTA+ Q  AR N   ++D +     V    + +I   P  GVYV GLYL+GA WD  N  L E+ P  L   MPVI     +    E KKK  K+   Y CP Y  P R  I    + I SV LKT +  PEHW  RG A
Sbjct: 2262 WNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDF---NFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFE-VKRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKESWASSTLGFWFTELLERNRQFQTWLFKGR-PNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNGSSEKKKKIVKDPRLYSCPIYKKPTRTDI----NCIASVGLKTTQ-PPEHWVLRGVA 2681          
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Match: SMESG000033128.1 (SMESG000033128.1)

HSP 1 Score: 871.692 bits (2251), Expect = 0.000e+0
Identity = 415/416 (99.76%), Postives = 415/416 (99.76%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFNDSDFEVSENLLSNYLDQYE TPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA
Sbjct: 4140 WNIPYEFNDSDFEVSENLLSNYLDQYETTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 4555          
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Match: SMESG000033128.1 (SMESG000033128.1)

HSP 1 Score: 871.307 bits (2250), Expect = 0.000e+0
Identity = 415/416 (99.76%), Postives = 415/416 (99.76%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPYEFNDSDFEVSENLLSNYLDQYE TPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA
Sbjct: 4091 WNIPYEFNDSDFEVSENLLSNYLDQYETTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTA 4506          
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Match: SMESG000065732.1 (SMESG000065732.1)

HSP 1 Score: 319.701 bits (818), Expect = 6.936e-97
Identity = 177/424 (41.75%), Postives = 246/424 (58.02%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKIL--STDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKS-QKNSYICPCYYYPNRAGI----SDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPY FNDSD  +S   L  ++++YE  P+DA++YL  + NYGG VTDD DRR L T + D++ E  I +  +K S   +Y +P       Y EFI  LP+I +PE FG H N DI  ++Q++RLL D++L    Q+ S GG S E+++ EI+ +I  ++P + D E  A+I    T    +N VL+QE++R+N   + IR+ L +L K I+GLVVMS +LE +  S+   K+P +WSK +YPS+KPL S+  DL+ R+   QKW      P  FWVS F F   FLT V+Q  AR   I +D L +DF VL  S  N+   P DG Y+ GL+L GA W+ +   L E  P  L  A+PVI  KP +    S  +N Y CP Y    R G+        +++  V L T E+   HW KRGTA
Sbjct: 3538 WNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTSSGGGSSENQLSEIANDILGKMPASFDLE-KAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKW-FNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNV--QPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPT-EEPVSHWVKRGTA 3956          
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Match: SMESG000065732.1 (SMESG000065732.1)

HSP 1 Score: 319.316 bits (817), Expect = 8.415e-97
Identity = 177/424 (41.75%), Postives = 246/424 (58.02%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKIL--STDPCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSK-AYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKS-QKNSYICPCYYYPNRAGI----SDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNIPY FNDSD  +S   L  ++++YE  P+DA++YL  + NYGG VTDD DRR L T + D++ E  I +  +K S   +Y +P       Y EFI  LP+I +PE FG H N DI  ++Q++RLL D++L    Q+ S GG S E+++ EI+ +I  ++P + D E  A+I    T    +N VL+QE++R+N   + IR+ L +L K I+GLVVMS +LE +  S+   K+P +WSK +YPS+KPL S+  DL+ R+   QKW      P  FWVS F F   FLT V+Q  AR   I +D L +DF VL  S  N+   P DG Y+ GL+L GA W+ +   L E  P  L  A+PVI  KP +    S  +N Y CP Y    R G+        +++  V L T E+   HW KRGTA
Sbjct: 3585 WNIPYGFNDSDLRISARQLQMFVNEYEQVPFDAIRYLTGECNYGGRVTDDWDRRCLMTILDDFYNEHVIMDAKYKFSPSGTYIVPPKMEYTEYIEFIKALPSIQNPEVFGMHENVDITRELQDSRLLLDSVLITLGQLTSSGGGSSENQLSEIANDILGKMPASFDLE-KAEIAYPVTYNESMNTVLVQEMERFNKLSNAIRESLQNLLKAIKGLVVMSGELEAMASSLLVGKIPAMWSKYSYPSLKPLGSYINDLIERLNFLQKW-FNEGKPSTFWVSGFYFTQAFLTGVMQNFARKYTIPIDLLGFDFEVLKTSHMNV--QPNDGAYIAGLFLDGARWNSETMKLGEQKPKVLYEAVPVIWLKPAKRDVISTTENRYKCPVYKTSERKGVLSTTGHSTNFVLPVFLPT-EEPVSHWVKRGTA 4003          
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Match: SMESG000012956.1 (SMESG000012956.1)

HSP 1 Score: 305.064 bits (780), Expect = 7.347e-92
Identity = 169/422 (40.05%), Postives = 241/422 (57.11%), Query Frame = 1
Query:    1 WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKVLEISGNITKQLPENIDYEGTAKILSTD-PCPLNVVLLQEIQRYNFQLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLW-SKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPMELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAG----ISDRPSYIESVELKTGEKAPEHWTKRGTA 1248
            WNI YEFN++D  +S   L  ++DQY++  +DAL+YL  + NYGG VTDD DRR L T +  ++  +  ++P +K      YY P D     Y E+I  LP    P  FG H NADI    QET+LLFD++L  + +  S GG S +D V E+S ++  +LP N D E   +   T     +N VL+QE+ R+N  L  IR  L ++ K I+GLVVMSSDLE++  S+  +K+P +W  K+YPS+KPL S+  D ++R++    W      P +FW+S F F   FLT V Q  AR   I +D L++D+ +L   + N   AP+DG YVKGL+L GA WD K  ++ E+ P  L   MPVI  KP++  +   K SY+ P Y    R G         +++ ++ L T +K  EHW  RG A
Sbjct: 3605 WNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDW-FDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEIL--DDRNYDEAPEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPT-DKPEEHWIMRGVA 4022          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH20.000e+064.11dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
DNAH20.000e+064.11dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
DNAH73.088e-9436.97dynein axonemal heavy chain 7 [Source:HGNC Symbol;... [more]
DNAH122.617e-9138.30dynein axonemal heavy chain 12 [Source:HGNC Symbol... [more]
DNAH123.111e-9138.30dynein axonemal heavy chain 12 [Source:HGNC Symbol... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dhc-11.483e-1020.62Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-11.483e-1020.62Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-11.554e-1020.62Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-35.319e-922.29Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kl-26.215e-14152.74gene:FBgn0001313 transcript:FBtr0346722[more]
Dhc36C1.766e-8137.41gene:FBgn0013810 transcript:FBtr0304742[more]
Dhc62B1.952e-7835.90gene:FBgn0013811 transcript:FBtr0303106[more]
CG94924.240e-7334.75gene:FBgn0037726 transcript:FBtr0344344[more]
CG94924.893e-7334.75gene:FBgn0037726 transcript:FBtr0309027[more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah20.000e+063.57dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
dnah20.000e+063.57dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
dnah79.139e-9638.86dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:Z... [more]
dnah128.745e-9340.38dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
dnah71.574e-9138.86dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH20.000e+065.63dynein, axonemal, heavy chain 2 [Source:NCBI gene;... [more]
xpo71.039e-9239.20exportin 7 [Source:Xenbase;Acc:XB-GENE-491338][more]
ttc21a2.672e-9240.24tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a2.690e-9240.24tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a3.323e-9240.24tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah20.000e+064.35dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
Dnah20.000e+064.35dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
Dnah11.045e-9341.47dynein, axonemal, heavy chain 1 [Source:MGI Symbol... [more]
Dnah7c3.385e-9339.19dynein, axonemal, heavy chain 7C [Source:MGI Symbo... [more]
Dnah123.073e-9239.48dynein, axonemal, heavy chain 12 [Source:MGI Symbo... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0C6F1|DYH2_MOUSE0.000e+064.35Dynein heavy chain 2, axonemal OS=Mus musculus OX=... [more]
sp|Q9P225|DYH2_HUMAN0.000e+064.11Dynein heavy chain 2, axonemal OS=Homo sapiens OX=... [more]
sp|Q9MBF8|DYH1B_CHLRE3.204e-14749.88Dynein-1-beta heavy chain, flagellar inner arm I1 ... [more]
sp|Q63164|DYH1_RAT2.891e-9441.55Dynein heavy chain 1, axonemal OS=Rattus norvegicu... [more]
sp|E9Q8T7|DYH1_MOUSE7.308e-9341.47Dynein heavy chain 1, axonemal OS=Mus musculus OX=... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|238585900.000e+072.36tr|V4AL85|V4AL85_LOTGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|207091250.000e+071.39tr|A0A504Z1Y4|A0A504Z1Y4_FASGI Dynein heavy chain ... [more]
gnl|BL_ORD_ID|228899980.000e+072.84tr|A0A3Q0KTZ4|A0A3Q0KTZ4_SCHMA Dynein heavy chain,... [more]
gnl|BL_ORD_ID|190630040.000e+071.15tr|A0A4E0RK79|A0A4E0RK79_FASHE Dynein heavy chain ... [more]
gnl|BL_ORD_ID|228280870.000e+072.84tr|A0A5K4F755|A0A5K4F755_SCHMA Uncharacterized pro... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah20.000e+065.95dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
ENSAMXT00000012592.27.291e-9137.20pep primary_assembly:Astyanax_mexicanus-2.0:19:206... [more]
ENSAMXT00000035036.11.136e-9037.56pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
dnah121.533e-8639.10dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
dnah53.378e-8137.35dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000736.11.307e-7835.06pep scaffold:Pmarinus_7.0:GL477446:167298:178455:-... [more]
DNAH64.253e-7735.94dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
ENSPMAT00000010311.18.467e-6938.46pep scaffold:Pmarinus_7.0:GL480858:2016:13852:-1 g... [more]
ENSPMAT00000005733.12.289e-6633.79pep scaffold:Pmarinus_7.0:GL479460:527:9078:1 gene... [more]
ENSPMAT00000009595.15.294e-6631.40pep scaffold:Pmarinus_7.0:GL478108:144315:184457:1... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320034.036e-8534.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426213.109e-8438.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458061.485e-8135.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356033.535e-8135.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318001.163e-8037.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000041771.13.202e-9344.65pep primary_assembly:ASM223467v1:18:6917414:692826... [more]
dnah121.302e-8941.59dynein axonemal heavy chain 12 [Source:NCBI gene;A... [more]
ENSORLT00000020555.22.267e-8335.78pep primary_assembly:ASM223467v1:9:27094964:271083... [more]
dnah51.199e-7837.83dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah51.390e-7837.67dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Dynein heavy chain axonemal vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033128.10.000e+099.76SMESG000033128.1[more]
SMESG000033128.10.000e+099.76SMESG000033128.1[more]
SMESG000065732.16.936e-9741.75SMESG000065732.1[more]
SMESG000065732.18.415e-9741.75SMESG000065732.1[more]
SMESG000012956.17.347e-9240.05SMESG000012956.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026601 ID=SMED30026601|Name=Dynein heavy chain axonemal|organism=Schmidtea mediterranea sexual|type=transcript|length=1349bp
TGGAATATTCCTTATGAATTTAATGACTCAGATTTTGAAGTATCTGAAAA
TTTATTATCGAATTACTTAGATCAATATGAAAACACTCCGTGGGATGCCC
TTAAATATTTGATTGCTGATATTAATTACGGAGGGCACGTGACTGATGAT
CTTGATAGGCGTTTGCTCAACACATATATTGCTGATTATTTCCGAGAAGA
AGCTATTAAAGAACCTTTTTTCAAATTATCTATCATGTCATCGTATTATA
TTCCTCGTGATGGTTCCCTCAATTCATATAGAGAATTCATTACAATGTTG
CCTAATATTGATCATCCAGAAGCATTTGGACAACATCCTAATGCAGATAT
CGCTTCCCAAATTCAAGAAACCAGATTACTCTTTGATACATTACTTTCAT
TAAAACCACAGGTAGTAAGTGTGGGAGGAGATTCTAAGGAAGATAAAGTA
TTGGAAATATCTGGAAATATTACAAAACAATTGCCAGAAAATATTGATTA
TGAAGGCACTGCTAAAATTCTTAGTACTGATCCTTGTCCACTAAATGTGG
TATTGCTACAAGAAATCCAAAGATATAACTTTCAGTTAGATTTAATCAGA
AAACAATTGAGTGATTTAGAAAAGGGCATCCAAGGTCTTGTTGTTATGTC
TTCAGATTTAGAGGATATTTTTGACTCTATTTATGATACCAAAGTTCCAC
GATTATGGAGCAAAGCATATCCTTCGATGAAACCTCTGGCATCTTGGACA
CGAGATCTTGTGAGTAGAATAGAAATGTTTCAAAAATGGGCTATTACTGC
GCATGCACCTAAAGTATTTTGGGTTTCGGCATTTACATTCCCAACAGGAT
TTCTTACTGCAGTTATTCAAACATCAGCCAGACTTAATAATATTAGTGTT
GATACCCTTAACTGGGATTTTACTGTCCTTACGATATCAGAAGCTAATAT
TGCTTCAGCTCCAAAAGATGGTGTATATGTAAAAGGTCTTTATCTTCAAG
GCGCTGGGTGGGATATGAAAAACTCGATTTTAATTGAAGCTAGTCCTATG
GAATTAACATGTGCTATGCCAGTTATTCATTTCAAACCGATAGAAAATAA
AAAGAAATCTCAAAAAAATTCATATATTTGTCCCTGCTATTATTATCCAA
ATCGTGCCGGAATTTCAGATCGTCCATCATATATAGAAAGTGTCGAATTA
AAAACCGGTGAGAAAGCACCAGAACATTGGACCAAAAGAGGAACAGCACT
TCTTATGAGTTTAGATAGTTAACGATTAGATTAAACATTTTTATTCATTT
TTATTAGAGTTTGTTAAAAGTTATTTTGGTTTATTTTTTGATTATCAAG
back to top

protein sequence of SMED30026601-orf-1

>SMED30026601-orf-1 ID=SMED30026601-orf-1|Name=SMED30026601-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=424bp
WNIPYEFNDSDFEVSENLLSNYLDQYENTPWDALKYLIADINYGGHVTDD
LDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITML
PNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKEDKV
LEISGNITKQLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNFQLDLIR
KQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWT
RDLVSRIEMFQKWAITAHAPKVFWVSAFTFPTGFLTAVIQTSARLNNISV
DTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEASPM
ELTCAMPVIHFKPIENKKKSQKNSYICPCYYYPNRAGISDRPSYIESVEL
KTGEKAPEHWTKRGTALLMSLDS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003777microtubule motor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR041228Dynein_C
IPR041658AAA_lid_11
IPR043160Dynein_C_barrel
IPR042219AAA_lid_11_sf
IPR004273Dynein_heavy_D6_P-loop
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR041228Dynein heavy chain, C-terminal domainPFAMPF18199Dynein_Ccoord: 122..419
e-value: 3.5E-101
score: 338.5
IPR041658Dynein heavy chain AAA lid domainPFAMPF18198AAA_lid_11coord: 1..115
e-value: 2.9E-42
score: 144.3
IPR043160Dynein heavy chain, C-terminal domain, barrel regionGENE3DG3DSA:3.10.490.20coord: 281..422
e-value: 7.5E-12
score: 47.2
IPR042219Dynein heavy chain AAA lid domain superfamilyGENE3DG3DSA:1.10.8.720coord: 1..111
e-value: 8.1E-33
score: 115.5
NoneNo IPR availableGENE3DG3DSA:1.20.1270.280coord: 135..278
e-value: 5.4E-12
score: 47.8
NoneNo IPR availablePANTHERPTHR46454:SF2coord: 1..423
NoneNo IPR availablePANTHERPTHR46454FAMILY NOT NAMEDcoord: 1..423