SMED30026600

Overview
NameSMED30026600
Smed IDSMED30026600
Length (bp)1935
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30026600 (SMED30026600) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30026600 (SMED30026600) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30026600 (SMED30026600) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30026600 (SMED30026600) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026600

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
dorsal ventral margin of the whole animalSMED30026600SMESG000017972.1 AY067799smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
adhesion glandSMED30026600SMESG000017972.1 AY067799smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
adhesion glandSMED30026600SMESG000017972.1 AY067799smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30026600SMESG000017972.1 dd_Smed_v4_769_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30026600SMESG000017972.1 dd_Smed_v4_769_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30026600SMESG000017972.1 dd_Smed_v4_769_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30026600SMESG000017972.1 AY067799.1smed_ncbi_20200123PMID:17942485
Reddien et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
prepharyngeal regionSMED30026600SMESG000017972.1 AY067799.1smed_ncbi_20200123PMID:17942485
Reddien et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
secretory cellSMED30026600SMESG000017972.1 AY067799smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
secretory cellSMED30026600SMESG000017972.1 AY067799smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the whole animalSMED30026600SMESG000017972.1 AY067799smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
dorsal region of the whole animalSMED30026600SMESG000017972.1 AY067799smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30026600SMESG000017972.1 AY067799smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30026600SMESG000017972.1 AY067799smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
marginal adhesive zoneSMED30026600SMESG000017972.1 AY067799smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
marginal adhesive zoneSMED30026600SMESG000017972.1 AY067799smed_ncbi_20200123PMID:20865784
Zayas et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
adhesion glandSMED30026600SMESG000017972.1 AY067799smed_ncbi_20200123PMID:21295481
Molina et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30026600SMESG000017972.1 OX_Smed_1.0.04963ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30026600SMESG000017972.1 HM803280smed_ncbi_20200123PMID:30485821
Tewari et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Alignments
SMED30026600 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005969:16629..18910 -9477
Homology
BLAST of SMED30026600 vs. Ensembl Human
Match: ADGRB2 (adhesion G protein-coupled receptor B2 [Source:HGNC Symbol;Acc:HGNC:944])

HSP 1 Score: 57.3806 bits (137), Expect = 8.010e-8
Identity = 41/149 (27.52%), Postives = 63/149 (42.28%), Query Frame = -1
Query: 1489 CSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKN-SLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSC 1932
            C++  T P+     +W  W  CS+ CG G  SR + C+  Q           K   G    +++ K C    C    +  EW  W PC ++SC +  Q R R+   A    + CT  L ++R C   +CP  ++      A  LC  +C
Sbjct:  355 CNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGG--------KACEGP---ELQTKLCSMAACPVEGQWLEWGPWGPC-STSCANGTQQRSRKCSVAGPAWATCTGALTDTRECSNLECPATDSKWGPWNAWSLCSKTC 491          
BLAST of SMED30026600 vs. Ensembl Human
Match: ADGRB2 (adhesion G protein-coupled receptor B2 [Source:HGNC Symbol;Acc:HGNC:944])

HSP 1 Score: 56.9954 bits (136), Expect = 1.044e-7
Identity = 41/149 (27.52%), Postives = 63/149 (42.28%), Query Frame = -1
Query: 1489 CSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKN-SLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSC 1932
            C++  T P+     +W  W  CS+ CG G  SR + C+  Q           K   G    +++ K C    C    +  EW  W PC ++SC +  Q R R+   A    + CT  L ++R C   +CP  ++      A  LC  +C
Sbjct:  343 CNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGG--------KACEGP---ELQTKLCSMAACPVEGQWLEWGPWGPC-STSCANGTQQRSRKCSVAGPAWATCTGALTDTRECSNLECPATDSKWGPWNAWSLCSKTC 479          
BLAST of SMED30026600 vs. Ensembl Human
Match: ADGRB2 (adhesion G protein-coupled receptor B2 [Source:HGNC Symbol;Acc:HGNC:944])

HSP 1 Score: 56.9954 bits (136), Expect = 1.047e-7
Identity = 41/149 (27.52%), Postives = 63/149 (42.28%), Query Frame = -1
Query: 1489 CSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKN-SLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSC 1932
            C++  T P+     +W  W  CS+ CG G  SR + C+  Q           K   G    +++ K C    C    +  EW  W PC ++SC +  Q R R+   A    + CT  L ++R C   +CP  ++      A  LC  +C
Sbjct:  355 CNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGG--------KACEGP---ELQTKLCSMAACPVEGQWLEWGPWGPC-STSCANGTQQRSRKCSVAGPAWATCTGALTDTRECSNLECPATDSKWGPWNAWSLCSKTC 491          
BLAST of SMED30026600 vs. Ensembl Human
Match: ADGRB2 (adhesion G protein-coupled receptor B2 [Source:HGNC Symbol;Acc:HGNC:944])

HSP 1 Score: 56.9954 bits (136), Expect = 1.056e-7
Identity = 41/149 (27.52%), Postives = 63/149 (42.28%), Query Frame = -1
Query: 1489 CSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKN-SLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSC 1932
            C++  T P+     +W  W  CS+ CG G  SR + C+  Q           K   G    +++ K C    C    +  EW  W PC ++SC +  Q R R+   A    + CT  L ++R C   +CP  ++      A  LC  +C
Sbjct:  355 CNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGG--------KACEGP---ELQTKLCSMAACPVEGQWLEWGPWGPC-STSCANGTQQRSRKCSVAGPAWATCTGALTDTRECSNLECPATDSKWGPWNAWSLCSKTC 491          
BLAST of SMED30026600 vs. Ensembl Human
Match: ADGRB2 (adhesion G protein-coupled receptor B2 [Source:HGNC Symbol;Acc:HGNC:944])

HSP 1 Score: 53.9138 bits (128), Expect = 1.020e-6
Identity = 38/135 (28.15%), Postives = 57/135 (42.22%), Query Frame = -1
Query: 1489 KWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKN-SLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSC 1890
            +W  W  CS+ CG G  SR + C+  Q           K   G    +++ K C    C    +  EW  W PC ++SC +  Q R R+   A    + CT  L ++R C   +CP  ++      A  LC  +C
Sbjct:  317 EWGSWSLCSRSCGRGSRSRMRTCVPPQHGG--------KACEGP---ELQTKLCSMAACPVEGQWLEWGPWGPC-STSCANGTQQRSRKCSVAGPAWATCTGALTDTRECSNLECPATDSKWGPWNAWSLCSKTC 439          
BLAST of SMED30026600 vs. Ensembl Celegans
Match: C36B7.5 (pep chromosome:WBcel235:X:7089228:7096449:-1 gene:WBGene00016468.1 transcript:C36B7.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C36B7.5)

HSP 1 Score: 52.7582 bits (125), Expect = 7.377e-7
Identity = 41/150 (27.33%), Postives = 65/150 (43.33%), Query Frame = -1
Query: 1441 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSH-MNPHVRCVSSTNKC 1887
            W +W+KCSK CGAG T R + C+         ++ ++               C +QPC E    ++W+ W+ C     ++  + R R+ +NA  N+ C  P  +   C    CP  E     E A+  C T+C       +R   S N+C
Sbjct:  451 WGQWEKCSKECGAGHTYRNRECIDGVSCEGASEEKIL---------------CNQQPCPE---WSQWTAWTVCDERCGEESIRLRNRKCMNAENNNACDGPAQDQMSCPYRDCPKWEE--WGEWAD--CSTTCGQGTQKRLRKCDSGNEC 578          
BLAST of SMED30026600 vs. Ensembl Celegans
Match: C36B7.5 (pep chromosome:WBcel235:X:7089228:7096449:-1 gene:WBGene00016468.1 transcript:C36B7.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C36B7.5)

HSP 1 Score: 52.7582 bits (125), Expect = 7.594e-7
Identity = 41/150 (27.33%), Postives = 65/150 (43.33%), Query Frame = -1
Query: 1441 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSH-MNPHVRCVSSTNKC 1887
            W +W+KCSK CGAG T R + C+         ++ ++               C +QPC E    ++W+ W+ C     ++  + R R+ +NA  N+ C  P  +   C    CP  E     E A+  C T+C       +R   S N+C
Sbjct:  451 WGQWEKCSKECGAGHTYRNRECIDGVSCEGASEEKIL---------------CNQQPCPE---WSQWTAWTVCDERCGEESIRLRNRKCMNAENNNACDGPAQDQMSCPYRDCPKWEE--WGEWAD--CSTTCGQGTQKRLRKCDSGNEC 578          
BLAST of SMED30026600 vs. Ensembl Zebrafish
Match: scospondin (subcommissural organ spondin [Source:ZFIN;Acc:ZDB-GENE-051114-1])

HSP 1 Score: 60.077 bits (144), Expect = 1.016e-8
Identity = 51/195 (26.15%), Postives = 78/195 (40.00%), Query Frame = -1
Query: 1363 NKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLN-KIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLIN---ANKNSLCTKPLMESRRC--------MKSQCPCVENAIMHECANIL------CPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1893
            + W  W +CS  CG G   R++N L +             +  G+C   + + +PCF Q C  S + +EW+ WS C +  C      R R   N    N    C     ++  C          +Q  C    I+ + ++ L      CP +CS ++    C   T  C   C C  G   Q+G+CV  S+C C 
Sbjct: 2313 SSWASWSQCSVSCGLGSIFRQKNILRD------------ARPGGSCGGAQFDSRPCFLQACPVSGQWSEWTQWSGC-DVPCAGGLMVRNRTCSNPPPKNGGRDCEGMSRQTHTCNTQSCGSDTDTQSGCTGGMILMDESDCLAGKFSPCPLTCSDLHSERNC---TLNCTAGCHCPPGLFLQSGRCVNVSECECF 2491          

HSP 2 Score: 55.0694 bits (131), Expect = 3.460e-7
Identity = 39/131 (29.77%), Postives = 61/131 (46.56%), Query Frame = -1
Query: 1339 CQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCP---CVENAIMHE--CANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLI 1716
            C++ C  + WS WS C    C   ++ R R+ + ++    C     +S+ C  + CP   C +   + +  CAN  CP SC+ +  HV+C+     C   C C  G L Q+G CV   +C C  P  N  +
Sbjct: 4165 CRDVCDWSSWSRWSVC-KEPCSGGFRHRERRPLTSDPKPHCADLQSQSQSCNTALCPGEHCEDRGRVFDGSCAN-QCPRSCADLWDHVQCLQGV--CHPGCRCPPGQLLQDGSCVPVDECRCGLPMQNGTL 4291          
BLAST of SMED30026600 vs. Ensembl Xenopus
Match: ENSXETT00000006505.1 (SCO-spondin [Source:NCBI gene;Acc:100497129])

HSP 1 Score: 77.0258 bits (188), Expect = 8.280e-14
Identity = 57/179 (31.84%), Postives = 82/179 (45.81%), Query Frame = -1
Query: 1366 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKI-EVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSL--CTKPLMESRRCMKSQC--PCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1887
            WT+W  CS  CG G   R + C       S ++ D +      C ++  EV+ C   PC   C+L+EWS WS C ++SC      R R ++     S   C  PL+  R C    C   C  + +  +CAN+ CP +C+ + P   CV+ T  C   C C  G +  NG C+    C C
Sbjct: 4502 WTEWSTCSVSCGGGHRHRSRMC-------SQEEPDGVP-----CGSETKEVEECNTLPCPADCELSEWSEWSEC-SASCGGGISERKRMVLVLGDLSGNPCPAPLLLHRSCNSHNCTPECPGDQVYSDCANV-CPQTCADLRPGTECVNET--CEPGCSCPVGQVLLNGTCISPENCTC 4664          

HSP 2 Score: 65.4698 bits (158), Expect = 3.213e-10
Identity = 41/131 (31.30%), Postives = 60/131 (45.80%), Query Frame = -1
Query: 1339 CQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVE-----NAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLI 1716
            C++ C  + W  WSPC    C   ++ R R + +     LC  P  +S+ C  + CP  E      A    CAN  CP +C+ +  HV C+    +C   C C  G+L Q+ +CV  S C C  P  +  I
Sbjct: 4341 CEDLCVWSPWGEWSPC-REPCSGGFRVRWRHVYHPVGGKLCQGPRFQSQSCNTAACPGEECEDRGKAFKMSCAN-QCPRACTDLWEHVECLQ--GQCRTGCRCPDGWLLQDKRCVPISDCRCGMPTADATI 4467          

HSP 3 Score: 63.1586 bits (152), Expect = 1.526e-9
Identity = 56/180 (31.11%), Postives = 71/180 (39.44%), Query Frame = -1
Query: 1363 KWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINAN-KNSLCTKPLMESRRCMKSQC---PCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1890
             W+ W  CSK CG G  SR   C    +  S D       +  N    +E   C+ QPCQ SC    WS W+   N SC    Q R R       +   C +   ESR C  S C    C+     + C +       S   P +       +C   C C  G L QNG CV RS+C C+
Sbjct: 4085 DWSDWSPCSKPCGTGLRSRTWRCDC-PVPESPD-------VPCNTTEIVETAACYIQPCQGSCLWGPWSEWT---NCSCHSLLQHRFRDQKGLTFRGDGCEELGTESRLCNLSDCSESSCLPPFEFNPCGSPCEGLCSSRHQPEI--CRDAPRCQAGCYCPRGMLEQNGHCVPRSECGCV 4251          

HSP 4 Score: 61.6178 bits (148), Expect = 4.025e-9
Identity = 54/180 (30.00%), Postives = 74/180 (41.11%), Query Frame = -1
Query: 1369 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGN--CL-NKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQC---PCVENAIMHECAN-ILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCL 1887
            W+ W  CS+ CG G  +R + C            D     NG   CL +  + + C    CQE      WS+WSPC + SC    Q RVR+     +   C    ++S+ C    C    C    +  EC N   CP SC+H+   V C S  + C + C C  G    N  CV    C+
Sbjct: 3407 WSSWSPCSQRCGKGTQTRVRQC------------DSPAPQNGGRECLGDGQQHRDCQSLECQEQESWGPWSSWSPC-SVSCGGGEQIRVREC----QQDECEGKAIQSKSCNGQVCLDVGCPPGRLYRECENGDGCPYSCAHLTQQVECFS--DGCEEGCHCPVGTYIHNSSCVTECPCV 3567          

HSP 5 Score: 57.7658 bits (138), Expect = 7.565e-8
Identity = 28/80 (35.00%), Postives = 41/80 (51.25%), Query Frame = -1
Query:  325 CQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQC 564
            C +C C NG L C    C++    W DWS+W+PCS  CGT +  R+R C     K       G++++     +Q E K+C
Sbjct: 3156 CNNCTCLNGTLSCTKEPCVVAGG-WCDWSSWTPCSKTCGTEMVTRYRSCACPKPKQGGDQCQGVQQYYGDTGVQLERKEC 3234          

HSP 6 Score: 55.8398 bits (133), Expect = 2.343e-7
Identity = 54/192 (28.12%), Postives = 78/192 (40.62%), Query Frame = -1
Query: 1366 PIVVCNN--KWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLT-EWSNWSP-CYNSSCKDEYQTRVRQLIN---ANKNSLCTKPLMESRRCMKSQCPCVE---NAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1911
            P VV      W+ W  CSK CG    +R ++C   +  +  D+   +++  G+   ++E K C   P    C +   W +WSP  Y   C  E   R RQ  N       + C     +S+ C  +   C +     +   C    CP SC  +     C+ S   C   C C  G L QNG CV  S+C C
Sbjct: 3172 PCVVAGGWCDWSSWTPCSKTCGTEMVTRYRSCACPKPKQGGDQCQGVQQYYGDTGVQLERKEC---PSSTFCPVNGNWGSWSPWSYCDGCTGE-SIRTRQCNNPPARFGGAPCQGEARQSQGCQDNSTTCSDCGGGQVSFPCGR-RCPRSCEDLQEDTMCMDSPG-CQATCGCPDGQLMQNGTCVEPSECRC 3357          

HSP 7 Score: 52.373 bits (124), Expect = 3.179e-6
Identity = 26/51 (50.98%), Postives = 32/51 (62.75%), Query Frame = -1
Query:  415 CQSCVCTNGRLVCN-GPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQ 564
            CQ+C CT GRL+C   P C + +  W  WS+WSPCS  CG G + R RQC 
Sbjct: 3380 CQNCTCTAGRLLCTPDPSCRL-DGKWGPWSSWSPCSQRCGKGTQTRVRQCD 3429          

HSP 8 Score: 51.2174 bits (121), Expect = 7.686e-6
Identity = 25/54 (46.30%), Postives = 30/54 (55.56%), Query Frame = -1
Query:  424 NSRVIVDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFR 585
             S +  DC +C C NG LVC    C   +  WS WS WS CS  CG+G + RFR
Sbjct: 3960 GSSLQEDCNNCTCLNGHLVCTNNTCPRLDCQWSQWSKWSQCSVTCGSGTQSRFR 4013          
BLAST of SMED30026600 vs. Ensembl Xenopus
Match: ssu72 (SSU72 homolog, RNA polymerase II CTD phosphatase [Source:Xenbase;Acc:XB-GENE-5725626])

HSP 1 Score: 54.299 bits (129), Expect = 6.517e-7
Identity = 39/125 (31.20%), Postives = 58/125 (46.40%), Query Frame = -1
Query: 1552 GRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKIN-GNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQ 1923
            GR +     +  WT W  CSK C  G  SR          R+I   D   K N G      E + C EQ C  +CKL ++ +WS C +   K +++TR  +  +      CT+ L+ESR C+ ++
Sbjct:   15 GRALSCFCDHYPWTSWSSCSKTCDHGTQSRS---------RTISYDDYYWKHNCGGLCTMRETRSCNEQSCPINCKLGDFGSWSDC-DPCLKKQFRTRSLERPSQFGGEGCTEALVESRICVPAK 129          
BLAST of SMED30026600 vs. Ensembl Xenopus
Match: ssu72 (SSU72 homolog, RNA polymerase II CTD phosphatase [Source:Xenbase;Acc:XB-GENE-5725626])

HSP 1 Score: 53.1434 bits (126), Expect = 1.556e-6
Identity = 37/113 (32.74%), Postives = 54/113 (47.79%), Query Frame = -1
Query: 1552 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKIN-GNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQ 1887
            WT W  CSK C  G  SR          R+I   D   K N G      E + C EQ C  +CKL ++ +WS C +   K +++TR  +  +      CT+ L+ESR C+ ++
Sbjct:   29 WTSWSSCSKTCDHGTQSRS---------RTISYDDYYWKHNCGGLCTMRETRSCNEQSCPINCKLGDFGSWSDC-DPCLKKQFRTRSLERPSQFGGEGCTEALVESRICVPAK 131          
BLAST of SMED30026600 vs. Ensembl Xenopus
Match: ssu72 (SSU72 homolog, RNA polymerase II CTD phosphatase [Source:Xenbase;Acc:XB-GENE-5725626])

HSP 1 Score: 52.7582 bits (125), Expect = 1.961e-6
Identity = 37/113 (32.74%), Postives = 54/113 (47.79%), Query Frame = -1
Query: 1552 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKIN-GNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQ 1887
            WT W  CSK C  G  SR          R+I   D   K N G      E + C EQ C  +CKL ++ +WS C +   K +++TR  +  +      CT+ L+ESR C+ ++
Sbjct:   29 WTSWSSCSKTCDHGTQSRS---------RTISYDDYYWKHNCGGLCTMRETRSCNEQSCPINCKLGDFGSWSDC-DPCLKKQFRTRSLERPSQFGGEGCTEALVESRICVPAK 131          
BLAST of SMED30026600 vs. Ensembl Xenopus
Match: ssu72 (SSU72 homolog, RNA polymerase II CTD phosphatase [Source:Xenbase;Acc:XB-GENE-5725626])

HSP 1 Score: 52.7582 bits (125), Expect = 2.000e-6
Identity = 37/110 (33.64%), Postives = 52/110 (47.27%), Query Frame = -1
Query: 1561 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKIN-GNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCM 1887
            WT W  CSK C  G  SR          R+I   D   K N G      E + C EQ C  +CKL ++ +WS C +   K +++TR  +  +      CT+ L+ESR C+
Sbjct:   29 WTSWSSCSKTCDHGTQSRS---------RTISYDDYYWKHNCGGLCTMRETRSCNEQSCPINCKLGDFGSWSDC-DPCLKKQFRTRSLERPSQFGGEGCTEALVESRICV 128          
BLAST of SMED30026600 vs. Ensembl Mouse
Match: Sspo (SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311])

HSP 1 Score: 61.6178 bits (148), Expect = 3.707e-9
Identity = 52/189 (27.51%), Postives = 82/189 (43.39%), Query Frame = -1
Query: 1363 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCL-NKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINA---NKNSLCTKPLMESRRCMKSQCPC---VENAIMHECANIL-------CPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1887
            W+ W  CS+ CG G   + +     +L+R       +    G+CL ++   + CF Q C  +    EW  W+ C + SC   +Q+R R  ++    N  + C  P  E   C    CP     E  ++H  A +        CP SC  ++P     S +  C++ C C  G L Q+  C+  S+C CL
Sbjct: 2342 WSGWSDCSRSCGLGLIFQHR-----ELLR-------LPLPGGSCLLDQFRSQSCFVQACPVAGAWAEWGPWTAC-SVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKAPCNLQLCPGDTDCEPGLVHVNAELCQKGLVPPCPPSC--LDPEAN-RSCSGHCMEGCRCPPGLLLQDSHCLPLSECPCL 2514          

HSP 2 Score: 60.8474 bits (146), Expect = 6.020e-9
Identity = 52/182 (28.57%), Postives = 72/182 (39.56%), Query Frame = -1
Query: 1366 KWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLI----NANKNSLCTKPLMESRRCMKSQC---PCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1890
             W  W  CS+ CG G  SR  +C        + K+D   K N   L  ++ + C+  PCQ+ C   +WS+W+ C   SCK   Q R R  +     A + + CT+     R C    C    C        C +       +H+N   R       C   C C  G L Q G C+   QC C
Sbjct: 4162 SWGPWGPCSRSCGTGLASRSGSCPC-----LLTKED--SKCNDTFLG-LDTQACYSGPCQDDCTWGDWSSWTRC---SCKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLN--HRLCQDLPPCQPGCYCPKGLLEQAGSCILPEQCNC 4330          

HSP 3 Score: 55.0694 bits (131), Expect = 3.812e-7
Identity = 25/49 (51.02%), Postives = 31/49 (63.27%), Query Frame = -1
Query:  424 VDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFR 570
            +DC +C C +G +VC   RC +    WS W+ WSPCS  C  GIRRRFR
Sbjct: 2798 LDCNNCTCISGEMVCTSKRCPVACG-WSPWTPWSPCSQSCNVGIRRRFR 2845          

HSP 4 Score: 51.6026 bits (122), Expect = 3.498e-6
Identity = 38/129 (29.46%), Postives = 54/129 (41.86%), Query Frame = -1
Query: 1345 CQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCP-----CVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNT 1716
            C ++C+   W  WSPC    C   ++ R R   + +    C  P  ++  C    CP       +     +CAN  CP SC+ +   V+C+     C   C C  G L Q+G CV  S C C  P  N 
Sbjct: 4462 CNDTCQWGPWGPWSPC-QMPCSGGFKLRWRVARDTSAGE-CPGPWAQTESCNMGSCPGESCETRDTVFTLDCAN-QCPRSCADLWDGVQCLQ--GPCSPGCRCPPGQLVQDGHCVPISSCRCGLPSANA 4585          
BLAST of SMED30026600 vs. Ensembl Mouse
Match: Sspo (SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311])

HSP 1 Score: 61.6178 bits (148), Expect = 3.712e-9
Identity = 52/189 (27.51%), Postives = 82/189 (43.39%), Query Frame = -1
Query: 1363 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCL-NKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINA---NKNSLCTKPLMESRRCMKSQCPC---VENAIMHECANIL-------CPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1887
            W+ W  CS+ CG G   + +     +L+R       +    G+CL ++   + CF Q C  +    EW  W+ C + SC   +Q+R R  ++    N  + C  P  E   C    CP     E  ++H  A +        CP SC  ++P     S +  C++ C C  G L Q+  C+  S+C CL
Sbjct: 2487 WSGWSDCSRSCGLGLIFQHR-----ELLR-------LPLPGGSCLLDQFRSQSCFVQACPVAGAWAEWGPWTAC-SVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKAPCNLQLCPGDTDCEPGLVHVNAELCQKGLVPPCPPSC--LDPEAN-RSCSGHCMEGCRCPPGLLLQDSHCLPLSECPCL 2659          

HSP 2 Score: 60.8474 bits (146), Expect = 6.344e-9
Identity = 52/182 (28.57%), Postives = 72/182 (39.56%), Query Frame = -1
Query: 1366 KWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLI----NANKNSLCTKPLMESRRCMKSQC---PCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1890
             W  W  CS+ CG G  SR  +C        + K+D   K N   L  ++ + C+  PCQ+ C   +WS+W+ C   SCK   Q R R  +     A + + CT+     R C    C    C        C +       +H+N   R       C   C C  G L Q G C+   QC C
Sbjct: 4305 SWGPWGPCSRSCGTGLASRSGSCPC-----LLTKED--SKCNDTFLG-LDTQACYSGPCQDDCTWGDWSSWTRC---SCKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLN--HRLCQDLPPCQPGCYCPKGLLEQAGSCILPEQCNC 4473          

HSP 3 Score: 55.0694 bits (131), Expect = 3.658e-7
Identity = 25/49 (51.02%), Postives = 31/49 (63.27%), Query Frame = -1
Query:  424 VDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFR 570
            +DC +C C +G +VC   RC +    WS W+ WSPCS  C  GIRRRFR
Sbjct: 2943 LDCNNCTCISGEMVCTSKRCPVACG-WSPWTPWSPCSQSCNVGIRRRFR 2990          

HSP 4 Score: 51.6026 bits (122), Expect = 3.562e-6
Identity = 38/129 (29.46%), Postives = 54/129 (41.86%), Query Frame = -1
Query: 1345 CQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCP-----CVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNT 1716
            C ++C+   W  WSPC    C   ++ R R   + +    C  P  ++  C    CP       +     +CAN  CP SC+ +   V+C+     C   C C  G L Q+G CV  S C C  P  N 
Sbjct: 4605 CNDTCQWGPWGPWSPC-QMPCSGGFKLRWRVARDTSAGE-CPGPWAQTESCNMGSCPGESCETRDTVFTLDCAN-QCPRSCADLWDGVQCLQ--GPCSPGCRCPPGQLVQDGHCVPISSCRCGLPSANA 4728          
BLAST of SMED30026600 vs. Ensembl Mouse
Match: Sspo (SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311])

HSP 1 Score: 61.6178 bits (148), Expect = 3.840e-9
Identity = 52/189 (27.51%), Postives = 82/189 (43.39%), Query Frame = -1
Query: 1363 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCL-NKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINA---NKNSLCTKPLMESRRCMKSQCPC---VENAIMHECANIL-------CPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1887
            W+ W  CS+ CG G   + +     +L+R       +    G+CL ++   + CF Q C  +    EW  W+ C + SC   +Q+R R  ++    N  + C  P  E   C    CP     E  ++H  A +        CP SC  ++P     S +  C++ C C  G L Q+  C+  S+C CL
Sbjct: 2476 WSGWSDCSRSCGLGLIFQHR-----ELLR-------LPLPGGSCLLDQFRSQSCFVQACPVAGAWAEWGPWTAC-SVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKAPCNLQLCPGDTDCEPGLVHVNAELCQKGLVPPCPPSC--LDPEAN-RSCSGHCMEGCRCPPGLLLQDSHCLPLSECPCL 2648          

HSP 2 Score: 60.8474 bits (146), Expect = 6.619e-9
Identity = 52/182 (28.57%), Postives = 72/182 (39.56%), Query Frame = -1
Query: 1366 KWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLI----NANKNSLCTKPLMESRRCMKSQC---PCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1890
             W  W  CS+ CG G  SR  +C        + K+D   K N   L  ++ + C+  PCQ+ C   +WS+W+ C   SCK   Q R R  +     A + + CT+     R C    C    C        C +       +H+N   R       C   C C  G L Q G C+   QC C
Sbjct: 4296 SWGPWGPCSRSCGTGLASRSGSCPC-----LLTKED--SKCNDTFLG-LDTQACYSGPCQDDCTWGDWSSWTRC---SCKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLN--HRLCQDLPPCQPGCYCPKGLLEQAGSCILPEQCNC 4464          

HSP 3 Score: 55.0694 bits (131), Expect = 3.689e-7
Identity = 25/49 (51.02%), Postives = 31/49 (63.27%), Query Frame = -1
Query:  424 VDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFR 570
            +DC +C C +G +VC   RC +    WS W+ WSPCS  C  GIRRRFR
Sbjct: 2932 LDCNNCTCISGEMVCTSKRCPVACG-WSPWTPWSPCSQSCNVGIRRRFR 2979          

HSP 4 Score: 51.6026 bits (122), Expect = 3.748e-6
Identity = 38/129 (29.46%), Postives = 54/129 (41.86%), Query Frame = -1
Query: 1345 CQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCP-----CVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNT 1716
            C ++C+   W  WSPC    C   ++ R R   + +    C  P  ++  C    CP       +     +CAN  CP SC+ +   V+C+     C   C C  G L Q+G CV  S C C  P  N 
Sbjct: 4596 CNDTCQWGPWGPWSPC-QMPCSGGFKLRWRVARDTSAGE-CPGPWAQTESCNMGSCPGESCETRDTVFTLDCAN-QCPRSCADLWDGVQCLQ--GPCSPGCRCPPGQLVQDGHCVPISSCRCGLPSANA 4719          
BLAST of SMED30026600 vs. Ensembl Mouse
Match: Sspo (SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311])

HSP 1 Score: 58.151 bits (139), Expect = 2.803e-8
Identity = 52/182 (28.57%), Postives = 72/182 (39.56%), Query Frame = -1
Query: 1366 KWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLI----NANKNSLCTKPLMESRRCMKSQC---PCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1890
             W  W  CS+ CG G  SR  +C        + K+D   K N   L  ++ + C+  PCQ+ C   +WS+W+ C   SCK   Q R R  +     A + + CT+     R C    C    C        C +       +H+N   R       C   C C  G L Q G C+   QC C
Sbjct:  336 SWGPWGPCSRSCGTGLASRSGSCPC-----LLTKED--SKCNDTFLG-LDTQACYSGPCQDDCTWGDWSSWTRC---SCKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLN--HRLCQDLPPCQPGCYCPKGLLEQAGSCILPEQCNC 504          

HSP 2 Score: 50.447 bits (119), Expect = 8.025e-6
Identity = 38/129 (29.46%), Postives = 54/129 (41.86%), Query Frame = -1
Query: 1345 CQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCP-----CVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNT 1716
            C ++C+   W  WSPC    C   ++ R R   + +    C  P  ++  C    CP       +     +CAN  CP SC+ +   V+C+     C   C C  G L Q+G CV  S C C  P  N 
Sbjct:  636 CNDTCQWGPWGPWSPC-QMPCSGGFKLRWRVARDTSAGE-CPGPWAQTESCNMGSCPGESCETRDTVFTLDCAN-QCPRSCADLWDGVQCLQ--GPCSPGCRCPPGQLVQDGHCVPISSCRCGLPSANA 759          
BLAST of SMED30026600 vs. Ensembl Mouse
Match: Adgrb2 (adhesion G protein-coupled receptor B2 [Source:MGI Symbol;Acc:MGI:2451244])

HSP 1 Score: 55.4546 bits (132), Expect = 2.244e-7
Identity = 41/149 (27.52%), Postives = 60/149 (40.27%), Query Frame = -1
Query: 1489 CSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKN-SLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSC 1932
            C++  T P+     +W  W  CS+ CG G  SR + C+  Q           K   G    +++ K C    C    +  EW  W PC +SSC +  Q R R+   A    + C   L ++R C    CP  +       A  LC  +C
Sbjct:  346 CNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGG--------KACEG---PELQTKLCSMAACPVEGQWLEWGPWGPC-SSSCANGTQQRSRKCSVAGPAWATCAGALTDTRECSNLDCPATDGKWGPWNAWSLCSKTC 482          
BLAST of SMED30026600 vs. UniProt/SwissProt
Match: sp|Q700K0|SSPO_RAT (SCO-spondin OS=Rattus norvegicus OX=10116 GN=Sspo PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.327e-10
Identity = 54/188 (28.72%), Postives = 75/188 (39.89%), Query Frame = -1
Query: 1366 KWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNC---LNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLI----NANKNSLCTKPLMESRRCMKSQC---PCVENAIMHECAN---ILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1890
             W  W  CS+ CG G  SR  +C             L+ K +  C    + ++ + C+  PCQE C  ++WS+W+ C   SCK   Q R R  +     A + +LCT      R C    C    C+       C +    LC T  SH     +       C   C C  G L Q+G C+   QC C
Sbjct: 4311 SWGPWGPCSRSCGTGLASRSGSCPC-----------LLTKEDSECNDTFSGLDTQACYPGPCQEDCMWSDWSSWTRC---SCKILVQQRYRHQVPAPGQAGEGTLCTGLDGHFRPCAIGNCSEDSCLPPFEFQSCGSPCAGLCATHLSH-----QLCQDLPPCQPGCYCPMGLLEQDGGCILPEQCNC 4479          

HSP 2 Score: 62.003 bits (149), Expect = 1.599e-8
Identity = 52/189 (27.51%), Postives = 79/189 (41.80%), Query Frame = -1
Query: 1363 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCL-NKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINA---NKNSLCTKPLMESRRCMKSQCPC---VENAIMHECANIL-------CPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1887
            W+ W  CS+ CG G   + +  L   L              G+CL +++  +PCF Q C  +    +W  W PC + SC   +Q+R R  ++    N  + C  P  E   C    CP     E   +H  A +        CP SC  ++P     S +  C++ C C  G   Q+  C+  S+C CL
Sbjct: 2491 WSGWSDCSRSCGLGLIFQHRELLRPPL------------PGGSCLLDQLRSQPCFVQACPVAGAWAKWGPWEPC-SVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKVLCNLQLCPGDTDCEPGRVHVNAELCQKGLLPPCPPSC--LDPEAN-RSCSGHCVEGCRCPPGLFLQDSHCLPLSECPCL 2663          

HSP 3 Score: 56.6102 bits (135), Expect = 8.195e-7
Identity = 53/184 (28.80%), Postives = 68/184 (36.96%), Query Frame = -1
Query: 1366 WTKWKKCSKIC--GAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLI-NANKNSLCTKPLMESRRCMKSQC--PCVENAIMHECANIL-----CPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1887
            WT W  CS+ C    G+  RRQ   L    R                   + +PC    C        W++WS C ++SC    QTR R    +A  N +C  P  ++R C    C   C  N +       L     CP  C   +P V C   T  C   C C  G    N  C+ RSQC C
Sbjct: 2763 WTSWSSCSQSCLVPGGDPGRRQRSRLCPSSRDTFCPG----------EATQEEPCSPSLCPVPSAWGLWASWSAC-SASCNGGIQTRGRSCSGSAPGNPVCLGPHTQTRDCNVHPCTAQCPGNMVFRSAEKCLEEGGPCPQLCLAQDPGVEC---TGSCAPGCSCPPGLFLHNASCLPRSQCPC 2932          

HSP 4 Score: 56.225 bits (134), Expect = 1.211e-6
Identity = 25/49 (51.02%), Postives = 32/49 (65.31%), Query Frame = -1
Query:  424 VDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFR 570
            +DC +C C++G +VC   RC +    WS W+ WSPCS  C  GIRRRFR
Sbjct: 2947 LDCNNCTCSSGEMVCTSERCPVACG-WSPWTPWSPCSQSCNVGIRRRFR 2994          

HSP 5 Score: 54.299 bits (129), Expect = 4.152e-6
Identity = 39/129 (30.23%), Postives = 55/129 (42.64%), Query Frame = -1
Query: 1345 CQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCP-----CVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNT 1716
            C ++C+   W  WSPC    C   ++ R R+  + N    C  P  ++  C    CP       +     +CAN  CP SC+ +   V+C+     C   C C  G L Q+G CV  S C C  P  N 
Sbjct: 4605 CHDTCQWGPWGPWSPC-QVPCSGGFKLRWREASD-NSVGECRGPWAQTESCNMGSCPGESCETRDTVFTLDCAN-QCPRSCADLWEGVQCLQ--GPCSPGCRCPPGQLVQDGHCVPISSCRCGLPSANA 4728          
BLAST of SMED30026600 vs. UniProt/SwissProt
Match: sp|Q8CG65|SSPO_MOUSE (SCO-spondin OS=Mus musculus OX=10090 GN=Sspo PE=2 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 2.593e-8
Identity = 52/189 (27.51%), Postives = 82/189 (43.39%), Query Frame = -1
Query: 1363 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCL-NKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINA---NKNSLCTKPLMESRRCMKSQCPC---VENAIMHECANIL-------CPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1887
            W+ W  CS+ CG G   + +     +L+R       +    G+CL ++   + CF Q C  +    EW  W+ C + SC   +Q+R R  ++    N  + C  P  E   C    CP     E  ++H  A +        CP SC  ++P     S +  C++ C C  G L Q+  C+  S+C CL
Sbjct: 2342 WSGWSDCSRSCGLGLIFQHR-----ELLR-------LPLPGGSCLLDQFRSQSCFVQACPVAGAWAEWGPWTAC-SVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKAPCNLQLCPGDTDCEPGLVHVNAELCQKGLVPPCPPSC--LDPEAN-RSCSGHCMEGCRCPPGLLLQDSHCLPLSECPCL 2514          

HSP 2 Score: 60.8474 bits (146), Expect = 4.211e-8
Identity = 52/182 (28.57%), Postives = 72/182 (39.56%), Query Frame = -1
Query: 1366 KWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLI----NANKNSLCTKPLMESRRCMKSQC---PCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1890
             W  W  CS+ CG G  SR  +C        + K+D   K N   L  ++ + C+  PCQ+ C   +WS+W+ C   SCK   Q R R  +     A + + CT+     R C    C    C        C +       +H+N   R       C   C C  G L Q G C+   QC C
Sbjct: 4162 SWGPWGPCSRSCGTGLASRSGSCPC-----LLTKED--SKCNDTFLG-LDTQACYSGPCQDDCTWGDWSSWTRC---SCKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLN--HRLCQDLPPCQPGCYCPKGLLEQAGSCILPEQCNC 4330          

HSP 3 Score: 55.0694 bits (131), Expect = 2.666e-6
Identity = 25/49 (51.02%), Postives = 31/49 (63.27%), Query Frame = -1
Query:  424 VDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFR 570
            +DC +C C +G +VC   RC +    WS W+ WSPCS  C  GIRRRFR
Sbjct: 2798 LDCNNCTCISGEMVCTSKRCPVACG-WSPWTPWSPCSQSCNVGIRRRFR 2845          
BLAST of SMED30026600 vs. UniProt/SwissProt
Match: sp|P98167|SSPO_BOVIN (SCO-spondin OS=Bos taurus OX=9913 GN=SSPO PE=2 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 3.380e-8
Identity = 52/190 (27.37%), Postives = 80/190 (42.11%), Query Frame = -1
Query: 1363 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCL-NKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINA---NKNSLCTKPLMESRRCMKSQCP----CVENAIMHECANIL-------CPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1887
            W+ W  CS+ CG G   +R+  L   L              G+C  +++  +PCF Q C  +    EW  W PC + SC   +++R R  ++    N  + C  P  E   C    C     C +  + H  A +        CP SC  ++P     S +  C++ C C  G L Q+  C+  S+C CL
Sbjct: 2485 WSGWSSCSRSCGLGLAFQRRELLRPPL------------PGGSCPPDRLRSQPCFVQACPVAGAWAEWEAWGPC-SVSCGGGHRSRRRSCMDPPPKNGGAPCPGPPQERAPCGLQPCAGGTDCGQGRV-HVSAELCRKGLVPPCPPSC--LDPEAN-RSCSGLCLEGCRCPPGLLLQDAGCLPLSECPCL 2657          
BLAST of SMED30026600 vs. UniProt/SwissProt
Match: sp|Q2PC93|SSPO_CHICK (SCO-spondin OS=Gallus gallus OX=9031 GN=SSPO PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 7.920e-8
Identity = 54/190 (28.42%), Postives = 76/190 (40.00%), Query Frame = -1
Query: 1366 NKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKIN-----GNCLN-KIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLIN-ANKNSLCTKPLMESRRC----MKSQCP-CVENAIMHEC--ANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1893
            + WT W  CS+ C                   +D++    +       G C    ++ +PC   PC  +     WS WS C ++ C    QTR R     A   + CT P +++R C      +QCP  ++     EC  +   CP  C  +   V C   T +C   C C  G L QNG CV  S CLC
Sbjct: 2853 SSWTPWSPCSRSC----------------FHHVDQRGRRHRFRHCEGMGTCPGLGVQEEPCDTAPCPVAGVWMPWSAWSEC-SAPCDAGVQTRSRTCTPPAFGGAECTGPHLQTRNCNTRPCGAQCPDTMQYLTAEECRHSEGRCPWICQDLGAGVAC---TAQCQPGCHCPAGLLLQNGTCVPPSHCLC 3022          

HSP 2 Score: 57.3806 bits (137), Expect = 4.300e-7
Identity = 43/133 (32.33%), Postives = 56/133 (42.11%), Query Frame = -1
Query: 1336 CQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVE-----NAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC-LAPDFNTLIL 1716
            CQE C  + W  W PC    C   ++ R R L     +  C     +S  C  + CP  +           CAN  CP +C+ +  HV CV     C   C C  G L Q+G CV  +QC C L+ D  T  L
Sbjct: 4607 CQELCLWSPWGPWGPC-QQPCSGSFRLRHRHLQRLAGSGQCQGAQTQSESCNTAVCPGEDCEKQGRVFATTCANS-CPRACADLWQHVECVQ--GGCKPGCRCPQGQLLQDGLCVPTAQCRCGLSGDNGTQEL 4735          

HSP 3 Score: 55.4546 bits (132), Expect = 1.985e-6
Identity = 52/190 (27.37%), Postives = 74/190 (38.95%), Query Frame = -1
Query: 1339 KWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFE-QPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSL-CTKPLMESRRC--MKSQCP-CVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL-APDFNTLI 1890
            +W+ W  CS+ CG    +R + C      +         + +G+   +++ + C    PC E      W  WS C         +TR      A    L C     +SR C    S CP C    +   C    CP SC  +     C++ T +C+ AC C  G L Q+G CV    C C  AP  N  I
Sbjct: 3415 EWSPWTPCSRSCGDEAATRHRVCSCPAPQQGGAGCPGGLEGHGDTGMQLQHQECPSVPPCPEDGAWAAWGPWSGCGGCG-GQAVRTRSCSSPPARFGGLPCAGEARQSRACPWATSSCPECAGGLVAFTCGKP-CPHSCEDLREDTACMA-TPRCLPACACPHGQLLQDGDCVPPELCRCAWAPSKNGSI 3601          

HSP 4 Score: 53.1434 bits (126), Expect = 9.967e-6
Identity = 49/190 (25.79%), Postives = 72/190 (37.89%), Query Frame = -1
Query: 1366 NKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLN-KIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINA---NKNSLCTKPLMESRRCMKSQC----PCVENAIM---HECANIL---CPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1893
            + W  W +CS  CG G TSR++  L   L              G C   +++ + CF + C        W  WS C ++ C    ++R R   +    N    C    ++S+ C    C     C    ++    +C   L   CP  C  ++    C S    C + C C  G   Q G CV  SQC C
Sbjct: 2579 SPWGGWSQCSHSCGLGVTSRQRVLLRGAL------------PGGTCHTPRLDTRACFLRACPVPGAWAAWGVWSSC-DAECGGGMRSRTRSCTDPPPKNGGQPCAGEALQSQPCNLQPCGDTRECGPGMVLVQEGDCVQGLVPPCPQVCGDLSATSSCQS---PCQEGCRCPPGLFLQEGTCVNASQCHC 2752          
BLAST of SMED30026600 vs. UniProt/SwissProt
Match: sp|A2VEC9|SSPO_HUMAN (SCO-spondin OS=Homo sapiens OX=9606 GN=SSPO PE=2 SV=2)

HSP 1 Score: 58.151 bits (139), Expect = 2.602e-7
Identity = 50/185 (27.03%), Postives = 73/185 (39.46%), Query Frame = -1
Query: 1366 KWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNC---LNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSL----CTKPLMESRRCMKSQC---PCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1890
             W  W  CS+ CG G  SR  +C             L+ K +  C      ++ + C+  PC E C  + WS+W+ C   SC+   Q R R    A++ +     CT+     R C+ S C    C      H C +       +H++ H  C      C   C C  G L Q G C+   +C C
Sbjct: 4314 SWGPWGPCSRSCGPGLASRSGSCPC-----------LMAKADPTCNSTFLHLDTQGCYSGPCPEECVWSSWSSWTRC---SCRVLVQQRYRHQGPASRGARAGAPCTRLDGHFRPCLISNCSEDSCTPPFEFHACGSPCAGLCATHLS-HQLC-QDLPPCQPGCYCPKGLLEQAGGCIPPEECNC 4482          

HSP 2 Score: 54.299 bits (129), Expect = 3.880e-6
Identity = 49/188 (26.06%), Postives = 75/188 (39.89%), Query Frame = -1
Query: 1363 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINA---NKNSLCTKPLMESRRCMKSQCPC---VENAIMHECANIL-------CPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1887
            W+ W  CS+ CG G T +RQ  L   L      +D           +   + CF Q C  +     W  W PC + SC   +Q+R R  ++    N  + C     E   C    C      E   ++  A++        CP SC  ++P     S +  C++ C C  G L  + +C+  S+C CL
Sbjct: 2507 WSVWSSCSRSCGLGLTFQRQELLRPPLPGGSCPRD-----------RFRSQSCFVQACPVAGAWAMWEAWGPC-SVSCGGGHQSRQRSCVDPPPKNGGAPCPGASQERAPCGLQPCSGGTDCELGRVYVSADLCQKGLVPPCPPSC--LDPKAN-RSCSGHCVEGCRCPPGLLLHDTRCLPLSECPCL 2679          
BLAST of SMED30026600 vs. TrEMBL
Match: A0A5J6BVN2 (Adhesive protein 2b (Fragment) OS=Minona ileanae OX=60013 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.857e-25
Identity = 71/191 (37.17%), Postives = 112/191 (58.64%), Query Frame = -1
Query: 1366 CSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQC--PCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1932
            C  G  + ++ C + W+ W  CS  C AG  SR++ CLL +    ++KK+L  +++  CL ++  +PCF+Q C++ C +T+WS WS C   +C  + Q R+R L+   K+      L ESRRC   +C   C    I  +CAN  CP +C H++  V C S+ + C+  C+C  GY++Q+GKCV+ S+CLC
Sbjct:  318 CRRGVVVNLLKCGD-WSHWTDCSSSCNAGIRSRKRACLLTE--SGVNKKELRHQLDQQCLLQLVREPCFKQICKKHCVVTDWSQWSAC-TRTCGFDQQVRIRNLVEPAKDGGDCNSLKESRRCPLPECTKTCPNRMIYDKCANQHCPYNCDHLSGLVDC-SNKSICVPGCICDKGYIFQHGKCVKASECLC 503          

HSP 2 Score: 83.9593 bits (206), Expect = 3.825e-21
Identity = 46/119 (38.66%), Postives = 68/119 (57.14%), Query Frame = -1
Query:  241 HLNANSRVIVDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSCVFSKELMKVSVIVQTFLESII 597
            ++  NS   ++CQ+C C NG+L C GP CI   N WS W+ WS CS +CGTGIRRR+R C       ++  E  LK    T +   E + C+   C CV++K+++K S +  + L S +
Sbjct:  707 YITFNSTTKMNCQNCTCINGKLECTGPTCI-ELNPWSSWTDWSECSALCGTGIRRRYRGC-------LADKELCLK----TGEQGVEQRPCVTSPCKCVYTKQILK-SYLEDSMLNSPV 812          

HSP 3 Score: 48.521 bits (114), Expect = 3.825e-21
Identity = 22/49 (44.90%), Postives = 28/49 (57.14%), Query Frame = -2
Query:   24 SAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKCT 170
            S  W+EKD   G+T   E V SG II+   TI  +C +C C NG F C+
Sbjct:  810 SPVWMEKDGKSGMTRKDEAVLSGAIIRHEETILLQCARCRCDNGHFSCS 858          
BLAST of SMED30026600 vs. TrEMBL
Match: A0A498M5S6 (SCO-spondin OS=Labeo rohita OX=84645 GN=ROHU_028461 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.098e-14
Identity = 58/176 (32.95%), Postives = 81/176 (46.02%), Query Frame = -1
Query: 1363 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQ-LINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1887
            W+ W  CS+ CGAG  SRR+ C+  +        D+ +          E++ C+++PC  +C ++EWS WS C   SC  +YQ R R  LI+A+    CT    ++R C    C   E   +       C   C  +     C S  N C   C C  G L QNG CVR  QC C+
Sbjct: 4320 WSPWSSCSRSCGAGVISRRRQCVCEETGDHACPPDIQRDAE-------EMQLCYKRPC-PACPMSEWSTWSEC---SCVSQYQQRFRAPLISASGGQHCTDLEKQNRPCKPDNCTDCEKPFLFSECGSPCEKHCDLLGQMDTCTSRQN-CTSGCFCPEGLLQQNGSCVRPDQCGCV 4483          

HSP 2 Score: 70.8626 bits (172), Expect = 9.141e-9
Identity = 55/180 (30.56%), Postives = 78/180 (43.33%), Query Frame = -1
Query: 1366 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGN--CLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANK--NSLCTKPLMESRRCMKSQC--PCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1887
            W  W +CS  CG G+ +RR++C               K   G   C N I+ + C   PC   C ++EWS+W+ C ++SC      R + ++   +     C  PL +   C  + C   C    +   CA   CP SC  + P  +CV  T  C   C C  G +  NG CV  SQC C
Sbjct: 4702 WGSWSECSVTCGTGQRTRRRSC---------------KHTTGGPTCTNTIQSESCSLLPCPAGCVVSEWSSWTDC-SASCGGGVSLRRKTVLQEPEPGGLSCPGPLEQHSACNTNSCLPDCPAGQVFSSCAGS-CPYSCEDLWPENQCVPLT--CSPGCSCPPGTVMLNGSCVPPSQCPC 4862          
BLAST of SMED30026600 vs. TrEMBL
Match: A0A411ACY6 (Adhesion protein 2 OS=Macrostomum lignano OX=282301 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 8.177e-13
Identity = 58/149 (38.93%), Postives = 82/149 (55.03%), Query Frame = -1
Query: 1366 KDLIKKIN----GNCLNKIEVKPCFEQPCQES-CKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTK-PLMESRRCMKSQ-CPCVE-NAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1788
            +DLI + N      C N++E +PCF + C ++ C   EW  WSPC +  C      R RQ  +A  +  C K  L ESR C K++ C C + NA  + C+N  CP +C H++    CV  T+ C+  C CK GY  Q+G+CV +SQC C
Sbjct: 13089 RDLIARQNLTSLEKCFNQVEREPCFNRRCSKTECNPAEWGPWSPC-SGECSTLLSERKRQPGSAVLSEFCKKVQLPESRLCPKTEKCLCKDPNAAWNNCSN-QCPFTCGHLSEQSACVM-TSACVPGCACKPGYYLQDGRCVPQSQCRC 13234          
BLAST of SMED30026600 vs. TrEMBL
Match: B3LF39 (SCO-spondin (Fragment) OS=Danio rerio OX=7955 GN=scospondin PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.687e-12
Identity = 57/177 (32.20%), Postives = 87/177 (49.15%), Query Frame = -1
Query: 1363 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVR-QLINANKNSLCTKPLMESRRCMKSQC-PCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1887
            W+ W +CS  CGAG  SRR+ C+ ++     D++D    +     ++ + + C+++ C   C ++EWS WS C    C  +++ RVR  L+ +     CT    +SR C    C  C +  +  EC +  C   C  M     C+SS N C   C C  G + QNG CVR  QC C+
Sbjct: 4223 WSTWSRCSVSCGAGLMSRRRQCVCDE-----DEQDCPSDVQ---RDEEQTQMCYKRAC-PVCPMSEWSVWSECL---CNSQFELRVRVPLVLSTGGQRCTDVEKQSRPCRPQNCKDCEKPFVFSECGSP-CEKHCDLMGKADACMSSQN-CTPGCYCPVGLVQQNGSCVRPDQCGCV 4385          
BLAST of SMED30026600 vs. TrEMBL
Match: A0A0F8BY78 (SCO-spondin OS=Larimichthys crocea OX=215358 GN=EH28_06775 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.707e-12
Identity = 55/176 (31.25%), Postives = 83/176 (47.16%), Query Frame = -1
Query: 1363 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLIN-ANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1887
            W+ W  CS+ CGAG  SR + C+  +   +    ++  +      N+ E + C++QPC   C ++EWS WS C   SC+ + Q R R  ++ A +   CT    +SR C  SQC   E   ++      C   CS       C+    +C + C C  G L QNG CV   +C C+
Sbjct: 4337 WSPWSPCSRSCGAGSVSRHRVCVCEEGGDAACPTEIEAE-----RNREETQLCYKQPC-PGCPMSEWSVWSQC---SCESQRQQRYRVALSPATRGQQCTPVETQSRTCSLSQCDDCEAPFVYSACGSPCEKQCSLHGRGDVCL-GVRECTRGCYCPEGLLQQNGSCVPPEECGCI 4502          

HSP 2 Score: 63.5438 bits (153), Expect = 1.638e-6
Identity = 52/195 (26.67%), Postives = 80/195 (41.03%), Query Frame = -1
Query: 1363 NKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLN-KIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLIN---ANKNSLCTKPLMESRRC--------MKSQCPCVENAIMHECANIL------CPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1893
            + WT W  CS  CG G   R+++ L   L              G C   + + + CF + C      +EW+ WS C ++ C    + R R        N    C    ++S+ C        + +Q  CV   ++   A+        CP +CSH++    C   T  C++ C C  G   Q G+CV  SQC+CL
Sbjct: 2656 STWTAWSACSVSCGLGSLFRQRDILREALP------------GGACGGAQFDSRACFPRACPVDGHWSEWTEWSEC-DAPCGGGVRQRNRTCTAPPPKNGGRDCEGMTLQSQSCNSQPCSKDVSTQTGCVNGMVLVTEADCQAGRVEPCPPTCSHLSSTSNC---TAACVQGCRCPDGLYLQGGRCVNASQCVCL 2834          
BLAST of SMED30026600 vs. Ensembl Cavefish
Match: scospondin (subcommissural organ spondin [Source:ZFIN;Acc:ZDB-GENE-051114-1])

HSP 1 Score: 72.4034 bits (176), Expect = 1.189e-12
Identity = 51/161 (31.68%), Postives = 78/161 (48.45%), Query Frame = -1
Query: 1339 SIDKKDLIKKINGNCLNKIEVKPCFEQP--CQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCP---CVENAIMHE--CANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLI 1800
             ID    +K   G C   +E +    QP  C++ C+ + W  WS C +  C   ++ R R+ +  N    CT+   +S+ C  + CP   C +   ++E  CAN  CP SC+ +  HV+C+  T  C   C C  G+L Q G+CVR + C C  P  N  +
Sbjct: 4407 DIDTGLPVKGREGECSKPLEEERICPQPDICEDLCQWSVWGPWSVCQDP-CSGGFRQRERKALAVNPGPSCTRQQSQSQNCNTALCPGERCEDRGRVYEANCAN-QCPRSCADLWEHVQCLQGT--CHPGCRCPDGWLLQEGECVRVTACRCGLPTENGTL 4563          

HSP 2 Score: 67.3958 bits (163), Expect = 4.341e-11
Identity = 54/195 (27.69%), Postives = 80/195 (41.03%), Query Frame = -1
Query: 1363 NKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLN-KIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLIN---ANKNSLCTKPLMESRRCMKSQCP--------CVENAIM---HECANIL---CPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1893
            + WT W  CS  CG G   R++  L +             +  G+C   + + + CF Q C       EWS WS C +++C    + R R   N    N    C    M+S+ C    C         CV   ++    +CA      CP +CS ++    C   ++ C+  C C  G   Q+G CV  S+CLCL
Sbjct: 2372 SAWTAWSPCSTSCGLGSLFRKREILRD------------ARAGGSCGGAQFDSRACFLQACPVDGHWAEWSEWSEC-DAACGGGVRMRSRSCSNPPSKNGGKECEGMAMQSQGCNMQPCGSGTDIQTGCVNGLVLVTELDCAEGRVEPCPLTCSDLHSERNC---SHHCLTGCRCPAGLFLQDGHCVNASKCLCL 2550          

HSP 3 Score: 60.4622 bits (145), Expect = 6.756e-9
Identity = 51/176 (28.98%), Postives = 77/176 (43.75%), Query Frame = -1
Query: 1363 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQ-LINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1887
            W+ W  CS+ CGAG   RR+ C+  +       + +  +      ++ E + C+ +PC + C ++ WS W+ C   SC   +Q R R  L  A K   CT+   ESR C + QC           A + C + C       +CV   +  + A     G L QN  CV   QC C+
Sbjct: 4153 WSIWSPCSRSCGAGVAYRRRQCVCEEEGDHACPEHIEAE-----RDREETQLCYRRPCPD-CPMSGWSEWTVC---SCVSPFQQRYRAPLTTATKGQHCTELETESRPCKQQQCQSESPT-----ACVYCASPCEK-----QCVLQASLKLHAFWWFQGLLQQNDTCVPPEQCGCI 4309          

HSP 4 Score: 56.9954 bits (136), Expect = 6.374e-8
Identity = 32/82 (39.02%), Postives = 43/82 (52.44%), Query Frame = -1
Query:  415 NSKQTVTKFPGFSLSTTDKTHLNANSRVIVDCQSCVCTNGRLVCNG-PRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQ 657
            N+  T  ++PG      D  + N+   +I DC +C C  G L C+  P C + +  WS W  WS CS  CG G+R RFRQC 
Sbjct: 3453 NTSNTSWEWPG----RNDWQYANSGDSIIRDCSNCTCEAGILNCDSVPGCHV-DGGWSQWGPWSECSVPCGGGVRLRFRQCD 3529          

HSP 5 Score: 52.7582 bits (125), Expect = 1.568e-6
Identity = 48/182 (26.37%), Postives = 74/182 (40.66%), Query Frame = -1
Query: 1363 KWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLIN---ANKNSLCTKPLMESRRCMKSQCP---CVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1890
            +W +W  CS+ CG G+  R      + L   ++       + GN  N+     C  + C+     + WS WS C + +C      R R   +    N    C     + + C    C    C        CAN  CP  CS +   ++C +ST +C   C C  G + Q+G CV+  QC C+
Sbjct: 3790 EWGEWSACSRSCGVGQQRR----FRSFLAPGVNGTWCPDILEGNLENRF----CNIRACRVDGSWSRWSPWSHC-DKACGGGRSIRTRSCSSPPPKNGGRKCVGEKNQVKPCNTKPCDTHGCPPGQEFVPCAN-QCPQRCSDLQQGIQCKAST-ECQPGCRCPRGEMQQDGTCVKLWQCDCM 3960          

HSP 6 Score: 50.447 bits (119), Expect = 6.928e-6
Identity = 28/60 (46.67%), Postives = 32/60 (53.33%), Query Frame = -1
Query:  418 HLNANSRVIVDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQC 597
             L+    V VDC +CVC NG LVC    C     T+  W +WS CS  CGTG R R R C
Sbjct: 4564 ELSPGQNVTVDCNTCVCINGSLVCTNQPC----PTYGSWGSWSECSVSCGTGQRIRRRSC 4619          
BLAST of SMED30026600 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000912.1 (pep scaffold:Pmarinus_7.0:GL477542:3:94122:1 gene:ENSPMAG00000000814.1 transcript:ENSPMAT00000000912.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 1.091e-8
Identity = 47/187 (25.13%), Postives = 74/187 (39.57%), Query Frame = -1
Query: 1336 NKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECA-NILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLIL 1893
              WT W  C++ CG G   R + C         D         G      E K C  + C +S   +EWS W+ C +  C    QTR R  ++     L T     +    ++   C  + +  EC  +  CP +C+H+     C   T  C + C C  G     G+CV+  +C C+  +   ++L
Sbjct: 1395 GSWTGWSACARSCGDGVQYRYRLC---------DSPAPHAGGRGCAGPSREEKECRARSCVDSWPWSEWSPWANC-SVGCGGGEQTRHRSCLHPPCPGLATHSKACNTHVCQASAGCPADKLFRECVQDEECPYTCAHVRGEAECRGET--CEEGCHCPVGTWLHQGRCVQ--ECPCVLDEATAVLL 1567          

HSP 2 Score: 55.4546 bits (132), Expect = 4.293e-8
Identity = 52/184 (28.26%), Postives = 71/184 (38.59%), Query Frame = -1
Query: 1366 NKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLIN---ANKNSLCTKPLMESRRCMKSQCP---CVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVC--KFGYLYQNGKCVRRSQCLC 1893
            N WT W  CS+ CG G+  R +      L       D+I           EV+ C    C+     + WS W+PC + +C      RVR   N    N    C     +   C    C    C    ++ +C N  CP SC+ +     CV   + C   C C    G L Q+G+CV   QC C
Sbjct: 1778 NAWTAWSTCSRPCGVGQQQRMRT-YNPPLGNGSWCPDIIA-------GNWEVRFCNTDVCKVDGGWSSWSPWAPC-DRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTVCNTQPCDGEGCPPEMLLSDCGN-RCPRSCADLQQGFACVDPEH-CQPGCSCPDGIGLLEQDGRCVPTWQCEC 1950          

HSP 3 Score: 55.0694 bits (131), Expect = 5.089e-8
Identity = 46/187 (24.60%), Postives = 72/187 (38.50%), Query Frame = -1
Query: 1366 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLIN---ANKNSLCTKPLMESRRCMKSQCP----CVENAIM---HECANIL---CPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1887
            WT+W +CS+ CG G   R+++ L  +       + L+             + CF Q C    +   WS WSPC +  C    + R R        N    C    ++  RC    C     C  + +     +C       CP +C H++    C      C + C CK G   ++G+CV   +C C
Sbjct:  312 WTEWSQCSRSCGLGVMFRQRDVLREEQTGGSCNRTLMGS-----------RACFMQACPVEGQWGAWSAWSPC-DVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPCARPSDCGPDMVFVSAEDCKRRTVEPCPLTCDHLDKSPDC---RVPCAEGCRCKPGLYLKSGRCVEAGECQC 483          

HSP 4 Score: 50.8322 bits (120), Expect = 1.203e-6
Identity = 30/115 (26.09%), Postives = 51/115 (44.35%), Query Frame = -1
Query: 1549 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANK--NSLCTKPLMESRRCMKSQC 1887
            W+ W +CS+ CG G  +R ++C       +   +              + + C  QPC+  C L +W+ WS C ++SC     +R R ++ A     + C +PL+  R C    C
Sbjct: 2524 WSAWGECSRSCGGGTRARHRDCPDASAPHACPGE------------PQQSEACSPQPCRADCVLGDWAAWSSC-SASCGGGVSSRNRSVVTAAAFGGAECPEPLVAQRSCNNYNC 2625          

HSP 5 Score: 50.0618 bits (118), Expect = 1.734e-6
Identity = 32/100 (32.00%), Postives = 47/100 (47.00%), Query Frame = -1
Query:  319 TDKTHLNANSRVIVD-CQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATND--IQAEDKQCMI 609
            T + H   ++    D C +C C +G LVC    C + +  W +WS W+PCS  CG+    R+R C     +D     AG +R     D  +Q E K C +
Sbjct: 1114 TGRRHPPGDTVPHADGCNNCTCMHGALVCTNQPCPV-DGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQRGHEHRDVGVQLEAKPCNL 1212          

HSP 6 Score: 49.6766 bits (117), Expect = 2.564e-6
Identity = 24/57 (42.11%), Postives = 32/57 (56.14%), Query Frame = -1
Query:  418 NSRVIVDCQSCVCTNGRLV-CNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQC 585
             S + + C  C C NG    C    C + +  WSDWS W+PCS  CG G++RR+R C
Sbjct:  966 RSPIQIGCTKCTCENGEAARCVSVDCDV-DGAWSDWSPWTPCSAPCGLGVQRRYRFC 1021          
BLAST of SMED30026600 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000917.1 (pep scaffold:Pmarinus_7.0:GL477542:941:92377:1 gene:ENSPMAG00000000814.1 transcript:ENSPMAT00000000917.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 1.557e-8
Identity = 46/187 (24.60%), Postives = 74/187 (39.57%), Query Frame = -1
Query: 1366 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLIN---ANKNSLCTKPLMESRRCMKSQCP----CVENAIM---HECANIL---CPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1887
            WT+W +CS+ CG G   R+++ L  +       + L+             + CF Q C    +   WS+WSPC +  C    + R R        N    C    ++  RC    C     C  + +     +C       CP +C H++    C      C++ C CK G   ++G+CV   +C C
Sbjct:  255 WTEWSQCSRSCGLGVMFRQRDVLREEQTGGSCNRTLMGS-----------RACFMQACPVEGQWGAWSSWSPC-DVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPCARPSDCGPDMVFVSAEDCKRRTVEPCPLTCDHLDKSPDC---RVPCVEGCRCKPGLYLKSGRCVEAGECQC 426          

HSP 2 Score: 54.6842 bits (130), Expect = 6.339e-8
Identity = 52/184 (28.26%), Postives = 71/184 (38.59%), Query Frame = -1
Query: 1366 NKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLIN---ANKNSLCTKPLMESRRCMKSQCP---CVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVC--KFGYLYQNGKCVRRSQCLC 1893
            N WT W  CS+ CG G+  R +      L       D+I           EV+ C    C+     + WS W+PC + +C      RVR   N    N    C     +   C    C    C    ++ +C N  CP SC+ +     CV   + C   C C    G L Q+G+CV   QC C
Sbjct: 1722 NAWTAWSTCSRPCGVGQQQRMRT-YNPPLGNGSWCPDIIA-------GNWEVRFCNTDVCKVDGGWSSWSPWAPC-DRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTVCNTQPCDGEGCPPEMLLSDCGN-RCPRSCADLQQGFACVDPEH-CQPGCSCPDGIGLLEQDGRCVPTWQCEC 1894          

HSP 3 Score: 50.0618 bits (118), Expect = 1.870e-6
Identity = 32/100 (32.00%), Postives = 47/100 (47.00%), Query Frame = -1
Query:  319 TDKTHLNANSRVIVD-CQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATND--IQAEDKQCMI 609
            T + H   ++    D C +C C +G LVC    C + +  W +WS W+PCS  CG+    R+R C     +D     AG +R     D  +Q E K C +
Sbjct: 1121 TGRRHPPGDTVPHADGCNNCTCMHGALVCTNQPCPV-DGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQRGHEHRDVGVQLEAKPCNL 1219          

HSP 4 Score: 50.0618 bits (118), Expect = 1.951e-6
Identity = 29/86 (33.72%), Postives = 40/86 (46.51%), Query Frame = -1
Query:  349 SRVIVDCQSCVCTNGRLV-CNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQC-------QGINCKDMSTSEAGLKRFMATND 582
            S + + C  C C NG    C    C + +  WSDWS W+PCS  CG G++RR+R C       +G +C    + E        T D
Sbjct:  916 SPIQIGCTKCTCENGEAARCVSVDCDV-DGAWSDWSPWTPCSAPCGLGVQRRYRFCTEPPPAGEGRDCGGPGSEERVCNTHACTQD 1000          
BLAST of SMED30026600 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000925.1 (pep scaffold:Pmarinus_7.0:GL477542:4188:92377:1 gene:ENSPMAG00000000814.1 transcript:ENSPMAT00000000925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 2.600e-8
Identity = 46/187 (24.60%), Postives = 74/187 (39.57%), Query Frame = -1
Query: 1366 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLIN---ANKNSLCTKPLMESRRCMKSQCP----CVENAIM---HECANIL---CPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLC 1887
            WT+W +CS+ CG G   R+++ L  +       + L+             + CF Q C    +   WS+WSPC +  C    + R R        N    C    ++  RC    C     C  + +     +C       CP +C H++    C      C++ C CK G   ++G+CV   +C C
Sbjct:  103 WTEWSQCSRSCGLGVMFRQRDVLREEQTGGSCNRTLMGS-----------RACFMQACPVEGQWGAWSSWSPC-DVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPCARPSDCGPDMVFVSAEDCKRRTVEPCPLTCDHLDKSPDC---RVPCVEGCRCKPGLYLKSGRCVEAGECQC 274          

HSP 2 Score: 54.299 bits (129), Expect = 1.006e-7
Identity = 52/184 (28.26%), Postives = 71/184 (38.59%), Query Frame = -1
Query: 1366 NKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLIN---ANKNSLCTKPLMESRRCMKSQCP---CVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVC--KFGYLYQNGKCVRRSQCLC 1893
            N WT W  CS+ CG G+  R +      L       D+I           EV+ C    C+     + WS W+PC + +C      RVR   N    N    C     +   C    C    C    ++ +C N  CP SC+ +     CV   + C   C C    G L Q+G+CV   QC C
Sbjct: 1547 NAWTAWSTCSRPCGVGQQQRMRT-YNPPLGNGSWCPDIIA-------GNWEVRFCNTDVCKVDGGWSSWSPWAPC-DRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTVCNTQPCDGEGCPPEMLLSDCGN-RCPRSCADLQQGFACVDPEH-CQPGCSCPDGIGLLEQDGRCVPTWQCEC 1719          

HSP 3 Score: 49.2914 bits (116), Expect = 2.726e-6
Identity = 29/86 (33.72%), Postives = 40/86 (46.51%), Query Frame = -1
Query:  349 SRVIVDCQSCVCTNGRLV-CNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQC-------QGINCKDMSTSEAGLKRFMATND 582
            S + + C  C C NG    C    C + +  WSDWS W+PCS  CG G++RR+R C       +G +C    + E        T D
Sbjct:  753 SPIQIGCTKCTCENGEAARCVSVDCDV-DGAWSDWSPWTPCSAPCGLGVQRRYRFCTEPPPAGEGRDCGGPGSEERVCNTHACTQD 837          

HSP 4 Score: 49.2914 bits (116), Expect = 2.942e-6
Identity = 32/100 (32.00%), Postives = 47/100 (47.00%), Query Frame = -1
Query:  319 TDKTHLNANSRVIVD-CQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATND--IQAEDKQCMI 609
            T + H   ++    D C +C C +G LVC    C + +  W +WS W+PCS  CG+    R+R C     +D     AG +R     D  +Q E K C +
Sbjct:  958 TGRRHPPGDTVPHADGCNNCTCMHGALVCTNQPCPV-DGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQRGHEHRDVGVQLEAKPCNL 1056          
BLAST of SMED30026600 vs. Ensembl Nematostella
Match: EDO49895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF43])

HSP 1 Score: 55.0694 bits (131), Expect = 3.863e-8
Identity = 41/119 (34.45%), Postives = 58/119 (48.74%), Query Frame = -1
Query: 1540 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQES--CKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKP-LMESRRCMKSQCPCV 1887
            W+KW  CS  CG GE  R ++ +       + + D I      C N  E +PC  Q C  +  C++T WS WS C   SC    + R R++I  +  S  T P L++ R+C  S C CV
Sbjct:  239 WSKWTSCSVTCGVGEQIRGRDII------RVPEHDGIP-----CPNLYEHRPCARQRCSSTKKCEVTPWSAWSSC-RGSCGVGRKVRTRRIIRQSSLSGMTCPSLVKKRKCKLSPCHCV 345          
BLAST of SMED30026600 vs. Ensembl Nematostella
Match: EDO37341 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFY2])

HSP 1 Score: 50.0618 bits (118), Expect = 1.432e-6
Identity = 42/148 (28.38%), Postives = 61/148 (41.22%), Query Frame = -1
Query: 1486 PIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDE-YQTRVRQLIN-----ANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCS 1911
            P+      W+KW  CSK C     SRR+     +   S   ++  K   G    ++E++ C  +PC      + WS WS C + +C    +  R R   N       KN  CT   +E +RC    CP V+       A   CP+ CS
Sbjct:  116 PVDGGLGAWSKWSPCSKTCNTTALSRRE-----RKCDSPPPRNGGKPCAGE---RVELRNCGTEPCPVDGGFSPWSEWSHCPSVACGTHFFSKRTRTCTNPMPKYGGKN--CTHAWIERKRCALPDCP-VDGGFSEWSAWSACPSKCS 252          
BLAST of SMED30026600 vs. Ensembl Medaka
Match: scospondin (SCO-spondin [Source:NCBI gene;Acc:101172449])

HSP 1 Score: 58.5362 bits (140), Expect = 2.214e-8
Identity = 49/161 (30.43%), Postives = 71/161 (44.10%), Query Frame = -1
Query: 1423 KWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVR-QLINANKNSLCTKPLMESRRCMKSQCP----CVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVC 1890
            +W+ W  CS+ CGAG  SRR+ CL ++            +I     N+ E + C++QPC   C ++ WS WS C   SC  + Q R R  L +A +   C     +SR+C  SQC       E   ++      C   CS +     C+ S   C   C C
Sbjct: 3652 RWSPWSPCSQSCGAGSASRRRLCLCDEDDGDE-GDSCPPEIEAE-KNREETQLCYKQPC---CPMSAWSVWSQC---SCMSQRQQRYRVALTSATRGQQCNPVETQSRKCSLSQCDGEFGSCEAPFVYSACGAPCDKQCSLLGRADLCLPSAG-CTPGCYC 3803          

HSP 2 Score: 54.6842 bits (130), Expect = 3.658e-7
Identity = 52/182 (28.57%), Postives = 72/182 (39.56%), Query Frame = -1
Query: 1363 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLN-KIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLIN---ANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPH--VRCVSSTNKCIKA-CVCKFGYLYQNGKCVRRSQCLCL 1887
            WT W  CS  CG G   R++  L + L R            G+C   + + + CF Q C      +EWS WS C ++ C     TR R   +    N    C    ++S+ C     PC     +H            +M P      +   N C+ A C C  G   Q G+CV  SQC+CL
Sbjct: 1938 WTAWSSCSVTCGLGSLFRQREILRDALPR------------GSCGGAQFDSRACFPQACPVHGHWSEWSEWSVC-DALCGGGISTRNRNCSSPPPKNGGRDCYGMTLQSQSCNHH--PCTNYTDIHRGKP-------GYMLPFHLFESIPWLNICVSAGCRCSSGLYLQEGRCVNSSQCVCL 2097          

HSP 3 Score: 51.2174 bits (121), Expect = 3.686e-6
Identity = 52/188 (27.66%), Postives = 75/188 (39.89%), Query Frame = -1
Query: 1366 NKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWS----PCYNSSCKDEYQTRVR-------QLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGY-LYQNGKCVRRSQCLC 1893
            + W  W  CS  CG G  SR          RS    D ++   G    KI+ +PCF   C    +   W +WS    PC     +    T  R       QL   +  S+  KP   +  C++++CP   N + H C    CP SC+H++    C S    C   C C  G  +    +CV   +C+C
Sbjct: 1512 SSWGPWGPCSTSCGTGSMSRE---------RSCPHGDPLRHCRG---QKIQHQPCFRTTCPVDGQWLSWVSWSNCSTPCGGVQVRQRSCTPPRYGGQDCSQLPGPSNLSVQIKPC-PADGCVEARCP--PNLVRHSCGP--CPMSCAHISSGTSCDS---PCFSGCWCPEGQAMNHMQQCVSPDECMC 1679          

HSP 4 Score: 50.447 bits (119), Expect = 6.679e-6
Identity = 52/189 (27.51%), Postives = 74/189 (39.15%), Query Frame = -1
Query: 1363 KWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVR-----------QLINANKNSL--CTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCL 1890
            +W +W  CS+ CG G+  R    +        +       I GN    +E + C  +PC+ +   + WS WS C +  C      R R           Q     KN +  C     E +RC  SQ           CA+  CP  CS +   ++C   T +C   C C  G L Q+G CV   QC C+
Sbjct: 3294 EWGEWSLCSRSCGVGQQQR----IRTYFHPGTNGSWCEDIIGGN----LENRFCNIRPCRVNGGWSRWSPWSRC-DKLCGGGRSIRTRSCSSPPPKNGGQKCEGEKNQIKPCNTKPCEGKRCPASQ-------EFDPCAS-QCPQRCSDLQQGLQCQGDT-ECQPGCRCPKGQLQQDGLCVEVWQCDCV 3464          
BLAST of SMED30026600 vs. Ensembl Medaka
Match: c6 (complement C6 [Source:NCBI gene;Acc:101156343])

HSP 1 Score: 56.9954 bits (136), Expect = 6.221e-8
Identity = 40/114 (35.09%), Postives = 58/114 (50.88%), Query Frame = -1
Query: 1552 WTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCL-NKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSC-KDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQ 1887
            WT W  C++ C  G  +RR         R I   D   K + + L +  +V+ C EQPC  +C LT++S WSPC  SSC K +Y+TR  +  +      C++ L E R C  S+
Sbjct:   30 WTSWSPCTQTCNHGVQNRR---------RQIHYDDYYWKNSCHQLCDSQDVRACNEQPCHINCALTDYSQWSPC--SSCAKKQYRTRSVETPSQFGGMQCSEELSEERPCYPSK 132          
BLAST of SMED30026600 vs. Planmine SMEST
Match: SMESG000017972.1 (SMESG000017972.1)

HSP 1 Score: 916.376 bits (2367), Expect = 0.000e+0
Identity = 531/555 (95.68%), Postives = 534/555 (96.22%), Query Frame = -1
Query:  271 ICSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLILXXXXXXXXXXXXXTKYTGQTNAXXXXXXXXXXXXXXXXXXXXXXXXSNVIIXXXXXXXXXXXXXXXXLTPPWGPGYTNPPLYQASPAWYAGETPAGATIKLPSDSVTAQNTYNVPTGSKATNPLYTPETSPTIKFFVTNKYVPXXXXXXXXXXXXSGAXXXXXXXXXXXXXXXXXXXXSELHFPPIRIIIIDY*NVFVENPSSQPDQATQSPGSVNSGSNQPTNSGNSKQTVTKFPGFSLSTTDKTHLNANSRVIVDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSCVFSKELMKVSV 1935
            ICSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLILSKSSSTSDSQNSTTKYTGQTNAGSSESSGDSKGSSSTSSSSTTTKLSNVIIKELSKEELKEMENKKQLTPPWGPGYTNPPLYQASPAWYAGETPAGATIKLPSDSVTAQNTYNVPTGSKATNPLYTPETSPTIKFFVTNKYVPSNSNENQNQNQNSGASTTTQKSQQLNSNSLLPGSS                    +NPSSQPDQATQSPGSVNSGSNQPTNSGNSKQTVTKFPGFSLSTTDKTHLNANSRVIVDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSCVFSKELMK+ +
Sbjct: 3881 ICSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLILSKSSSTSDSQNSTTKYTGQTNAGSSESSGDSKGSSSTSSSSTTTKLSNVIIKELSKEELKEMENKKQLTPPWGPGYTNPPLYQASPAWYAGETPAGATIKLPSDSVTAQNTYNVPTGSKATNPLYTPETSPTIKFFVTNKYVPSNSNENQNQNQNSGASTTTQKSQQLNSNSLLPGSS--------------------KNPSSQPDQATQSPGSVNSGSNQPTNSGNSKQTVTKFPGFSLSTTDKTHLNANSRVIVDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSCVFSKELMKIHI 4415          

HSP 2 Score: 151.369 bits (381), Expect = 0.000e+0
Identity = 71/73 (97.26%), Postives = 72/73 (98.63%), Query Frame = -2
Query:    6 LKQIHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKCTTECTQP 224
            L +IHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKCTTECTQP
Sbjct: 4410 LMKIHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKCTTECTQP 4482          
BLAST of SMED30026600 vs. Planmine SMEST
Match: SMESG000017972.1 (SMESG000017972.1)

HSP 1 Score: 915.605 bits (2365), Expect = 0.000e+0
Identity = 531/555 (95.68%), Postives = 534/555 (96.22%), Query Frame = -1
Query:  271 ICSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLILXXXXXXXXXXXXXTKYTGQTNAXXXXXXXXXXXXXXXXXXXXXXXXSNVIIXXXXXXXXXXXXXXXXLTPPWGPGYTNPPLYQASPAWYAGETPAGATIKLPSDSVTAQNTYNVPTGSKATNPLYTPETSPTIKFFVTNKYVPXXXXXXXXXXXXSGAXXXXXXXXXXXXXXXXXXXXSELHFPPIRIIIIDY*NVFVENPSSQPDQATQSPGSVNSGSNQPTNSGNSKQTVTKFPGFSLSTTDKTHLNANSRVIVDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSCVFSKELMKVSV 1935
            ICSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLILSKSSSTSDSQNSTTKYTGQTNAGSSESSGDSKGSSSTSSSSTTTKLSNVIIKELSKEELKEMENKKQLTPPWGPGYTNPPLYQASPAWYAGETPAGATIKLPSDSVTAQNTYNVPTGSKATNPLYTPETSPTIKFFVTNKYVPSNSNENQNQNQNSGASTTTQKSQQLNSNSLLPGSS                    +NPSSQPDQATQSPGSVNSGSNQPTNSGNSKQTVTKFPGFSLSTTDKTHLNANSRVIVDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSCVFSKELMK+ +
Sbjct: 3889 ICSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLILSKSSSTSDSQNSTTKYTGQTNAGSSESSGDSKGSSSTSSSSTTTKLSNVIIKELSKEELKEMENKKQLTPPWGPGYTNPPLYQASPAWYAGETPAGATIKLPSDSVTAQNTYNVPTGSKATNPLYTPETSPTIKFFVTNKYVPSNSNENQNQNQNSGASTTTQKSQQLNSNSLLPGSS--------------------KNPSSQPDQATQSPGSVNSGSNQPTNSGNSKQTVTKFPGFSLSTTDKTHLNANSRVIVDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSCVFSKELMKIHI 4423          

HSP 2 Score: 151.369 bits (381), Expect = 0.000e+0
Identity = 71/73 (97.26%), Postives = 72/73 (98.63%), Query Frame = -2
Query:    6 LKQIHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKCTTECTQP 224
            L +IHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKCTTECTQP
Sbjct: 4418 LMKIHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKCTTECTQP 4490          
BLAST of SMED30026600 vs. Planmine SMEST
Match: SMESG000017972.1 (SMESG000017972.1)

HSP 1 Score: 914.835 bits (2363), Expect = 0.000e+0
Identity = 531/555 (95.68%), Postives = 534/555 (96.22%), Query Frame = -1
Query:  271 ICSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLILXXXXXXXXXXXXXTKYTGQTNAXXXXXXXXXXXXXXXXXXXXXXXXSNVIIXXXXXXXXXXXXXXXXLTPPWGPGYTNPPLYQASPAWYAGETPAGATIKLPSDSVTAQNTYNVPTGSKATNPLYTPETSPTIKFFVTNKYVPXXXXXXXXXXXXSGAXXXXXXXXXXXXXXXXXXXXSELHFPPIRIIIIDY*NVFVENPSSQPDQATQSPGSVNSGSNQPTNSGNSKQTVTKFPGFSLSTTDKTHLNANSRVIVDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSCVFSKELMKVSV 1935
            ICSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLILSKSSSTSDSQNSTTKYTGQTNAGSSESSGDSKGSSSTSSSSTTTKLSNVIIKELSKEELKEMENKKQLTPPWGPGYTNPPLYQASPAWYAGETPAGATIKLPSDSVTAQNTYNVPTGSKATNPLYTPETSPTIKFFVTNKYVPSNSNENQNQNQNSGASTTTQKSQQLNSNSLLPGSS                    +NPSSQPDQATQSPGSVNSGSNQPTNSGNSKQTVTKFPGFSLSTTDKTHLNANSRVIVDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSCVFSKELMK+ +
Sbjct: 3885 ICSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLILSKSSSTSDSQNSTTKYTGQTNAGSSESSGDSKGSSSTSSSSTTTKLSNVIIKELSKEELKEMENKKQLTPPWGPGYTNPPLYQASPAWYAGETPAGATIKLPSDSVTAQNTYNVPTGSKATNPLYTPETSPTIKFFVTNKYVPSNSNENQNQNQNSGASTTTQKSQQLNSNSLLPGSS--------------------KNPSSQPDQATQSPGSVNSGSNQPTNSGNSKQTVTKFPGFSLSTTDKTHLNANSRVIVDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSCVFSKELMKIHI 4419          

HSP 2 Score: 151.369 bits (381), Expect = 0.000e+0
Identity = 71/73 (97.26%), Postives = 72/73 (98.63%), Query Frame = -2
Query:    6 LKQIHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKCTTECTQP 224
            L +IHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKCTTECTQP
Sbjct: 4414 LMKIHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKCTTECTQP 4486          
BLAST of SMED30026600 vs. Planmine SMEST
Match: SMESG000017972.1 (SMESG000017972.1)

HSP 1 Score: 914.45 bits (2362), Expect = 0.000e+0
Identity = 531/555 (95.68%), Postives = 534/555 (96.22%), Query Frame = -1
Query:  271 ICSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLILXXXXXXXXXXXXXTKYTGQTNAXXXXXXXXXXXXXXXXXXXXXXXXSNVIIXXXXXXXXXXXXXXXXLTPPWGPGYTNPPLYQASPAWYAGETPAGATIKLPSDSVTAQNTYNVPTGSKATNPLYTPETSPTIKFFVTNKYVPXXXXXXXXXXXXSGAXXXXXXXXXXXXXXXXXXXXSELHFPPIRIIIIDY*NVFVENPSSQPDQATQSPGSVNSGSNQPTNSGNSKQTVTKFPGFSLSTTDKTHLNANSRVIVDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSCVFSKELMKVSV 1935
            ICSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLILSKSSSTSDSQNSTTKYTGQTNAGSSESSGDSKGSSSTSSSSTTTKLSNVIIKELSKEELKEMENKKQLTPPWGPGYTNPPLYQASPAWYAGETPAGATIKLPSDSVTAQNTYNVPTGSKATNPLYTPETSPTIKFFVTNKYVPSNSNENQNQNQNSGASTTTQKSQQLNSNSLLPGSS                    +NPSSQPDQATQSPGSVNSGSNQPTNSGNSKQTVTKFPGFSLSTTDKTHLNANSRVIVDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSCVFSKELMK+ +
Sbjct: 3893 ICSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKKDLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQTRVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCSHMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLILSKSSSTSDSQNSTTKYTGQTNAGSSESSGDSKGSSSTSSSSTTTKLSNVIIKELSKEELKEMENKKQLTPPWGPGYTNPPLYQASPAWYAGETPAGATIKLPSDSVTAQNTYNVPTGSKATNPLYTPETSPTIKFFVTNKYVPSNSNENQNQNQNSGASTTTQKSQQLNSNSLLPGSS--------------------KNPSSQPDQATQSPGSVNSGSNQPTNSGNSKQTVTKFPGFSLSTTDKTHLNANSRVIVDCQSCVCTNGRLVCNGPRCIIGNNTWSDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSCVFSKELMKIHI 4427          

HSP 2 Score: 150.984 bits (380), Expect = 0.000e+0
Identity = 71/73 (97.26%), Postives = 72/73 (98.63%), Query Frame = -2
Query:    6 LKQIHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKCTTECTQP 224
            L +IHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKCTTECTQP
Sbjct: 4422 LMKIHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKCTTECTQP 4494          
The following BLAST results are available for this feature:
BLAST of SMED30026600 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADGRB28.010e-827.52adhesion G protein-coupled receptor B2 [Source:HGN... [more]
ADGRB21.044e-727.52adhesion G protein-coupled receptor B2 [Source:HGN... [more]
ADGRB21.047e-727.52adhesion G protein-coupled receptor B2 [Source:HGN... [more]
ADGRB21.056e-727.52adhesion G protein-coupled receptor B2 [Source:HGN... [more]
ADGRB21.020e-628.15adhesion G protein-coupled receptor B2 [Source:HGN... [more]
back to top
BLAST of SMED30026600 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C36B7.57.377e-727.33pep chromosome:WBcel235:X:7089228:7096449:-1 gene:... [more]
C36B7.57.594e-727.33pep chromosome:WBcel235:X:7089228:7096449:-1 gene:... [more]
back to top
BLAST of SMED30026600 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026600 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
scospondin1.016e-826.15subcommissural organ spondin [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of SMED30026600 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000006505.18.280e-1431.84SCO-spondin [Source:NCBI gene;Acc:100497129][more]
ssu726.517e-731.20SSU72 homolog, RNA polymerase II CTD phosphatase [... [more]
ssu721.556e-632.74SSU72 homolog, RNA polymerase II CTD phosphatase [... [more]
ssu721.961e-632.74SSU72 homolog, RNA polymerase II CTD phosphatase [... [more]
ssu722.000e-633.64SSU72 homolog, RNA polymerase II CTD phosphatase [... [more]
back to top
BLAST of SMED30026600 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sspo3.707e-927.51SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311][more]
Sspo3.712e-927.51SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311][more]
Sspo3.840e-927.51SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311][more]
Sspo2.803e-828.57SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311][more]
Adgrb22.244e-727.52adhesion G protein-coupled receptor B2 [Source:MGI... [more]
back to top
BLAST of SMED30026600 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q700K0|SSPO_RAT4.327e-1028.72SCO-spondin OS=Rattus norvegicus OX=10116 GN=Sspo ... [more]
sp|Q8CG65|SSPO_MOUSE2.593e-827.51SCO-spondin OS=Mus musculus OX=10090 GN=Sspo PE=2 ... [more]
sp|P98167|SSPO_BOVIN3.380e-827.37SCO-spondin OS=Bos taurus OX=9913 GN=SSPO PE=2 SV=... [more]
sp|Q2PC93|SSPO_CHICK7.920e-828.42SCO-spondin OS=Gallus gallus OX=9031 GN=SSPO PE=2 ... [more]
sp|A2VEC9|SSPO_HUMAN2.602e-727.03SCO-spondin OS=Homo sapiens OX=9606 GN=SSPO PE=2 S... [more]
back to top
BLAST of SMED30026600 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J6BVN21.857e-2537.17Adhesive protein 2b (Fragment) OS=Minona ileanae O... [more]
A0A498M5S62.098e-1432.95SCO-spondin OS=Labeo rohita OX=84645 GN=ROHU_02846... [more]
A0A411ACY68.177e-1338.93Adhesion protein 2 OS=Macrostomum lignano OX=28230... [more]
B3LF391.687e-1232.20SCO-spondin (Fragment) OS=Danio rerio OX=7955 GN=s... [more]
A0A0F8BY781.707e-1231.25SCO-spondin OS=Larimichthys crocea OX=215358 GN=EH... [more]
back to top
BLAST of SMED30026600 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
scospondin1.189e-1231.68subcommissural organ spondin [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of SMED30026600 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000000912.11.091e-825.13pep scaffold:Pmarinus_7.0:GL477542:3:94122:1 gene:... [more]
ENSPMAT00000000917.11.557e-824.60pep scaffold:Pmarinus_7.0:GL477542:941:92377:1 gen... [more]
ENSPMAT00000000925.12.600e-824.60pep scaffold:Pmarinus_7.0:GL477542:4188:92377:1 ge... [more]
back to top
BLAST of SMED30026600 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026600 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO498953.863e-834.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373411.432e-628.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30026600 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
scospondin2.214e-830.43SCO-spondin [Source:NCBI gene;Acc:101172449][more]
c66.221e-835.09complement C6 [Source:NCBI gene;Acc:101156343][more]
back to top
BLAST of SMED30026600 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000017972.10.000e+095.68SMESG000017972.1[more]
SMESG000017972.10.000e+095.68SMESG000017972.1[more]
SMESG000017972.10.000e+095.68SMESG000017972.1[more]
SMESG000017972.10.000e+095.68SMESG000017972.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026600 ID=SMED30026600|Name=SMED30026600|organism=Schmidtea mediterranea sexual|type=transcript|length=1935bp
CATCAGGGTTGCGTGCATTCTGTGGTACACTTGAATTGGCCGTTCTTACA
GGAGCATTGAGTGCATTTGGCCTGAATGGTGATTCCACTTTTAATGATGT
CTCCAGATTTCACTAGTTCCTTGCTGTGCGTCAAGCCTTTCACGTTGTCT
TTTTCAATCCAGAATGCCGATAAATCGATATTGAACTTATTGATGGAATC
CAATCCGATATGGATCTGTTTCAAAGAATTATTGATAGATTATTATCGAT
TCCAGGAATGTTTGAACTATTACACTTACCTTCATTAATTCTTTGGAAAA
TACACAAGAACATTCTTTAATCATGCATTGTTTATCTTCAGCTTGGATAT
CATTGGTTGCCATAAATCTTTTCAATCCAGCTTCACTAGTGGACATATCT
TTACAATTGATTCCCTGGCATTGTCTAAATCTCCGTCTTATTCCCGTTCC
ACAAATACCACTGCAAGGAGACCATGTCGACCAATCTGACCAAGTATTAT
TGCCAATGATACATCGAGGCCCGTTGCACACCAATCGGCCGTTAGTACAG
ACACATGATTGGCAGTCTACGATCACTCTTGAATTTGCATTCAGGTGGGT
TTTATCGGTTGTCGACAAGCTGAAACCCGGAAATTTTGTCACTGTCTGTT
TTGAATTGCCAGAGTTGGTCGGTTGATTGGAGCCACTGTTTACTGAGCCA
GGAGACTGAGTAGCTTGATCAGGCTGTGAACTTGGATTTTCTACAAAAAC
ATTTTAATAGTCAATAATAATGATTCTGATCGGGGGAAAATGCAACTCAC
TTGATGAGCCAGGTAAAAGTGAATTTGAGTTCAACTGTTGAGATTTCTGA
GTGGTTGTGGATGCGCCCGAATTTTGATTTTGATTTTGGTTCTCATTGGA
ATTTGATGGGACGTATTTATTGGTTACGAAAAATTTAATAGTCGGTGATG
TTTCGGGGGTATATAAAGGATTGGTAGCTTTAGAACCTGTTGGTACATTG
TAAGTATTTTGTGCCGTCACGGAATCGCTTGGCAATTTAATTGTCGCTCC
CGCTGGAGTTTCACCCGCATACCACGCTGGGCTTGCTTGATAAAGCGGTG
GATTTGTGTATCCTGGCCCCCATGGTGGAGTTAATTGTTTTTTATTTTCC
ATTTCTTTCAGTTCTTCCTTTGAAAGTTCTTTGATTATAACATTCGATAA
CTTGGTTGTCGTAGACGATGATGATGTTGAACTGGATCCTTTTGAATCCC
CGGAACTTTCAGAAGAGCCTGCATTGGTTTGTCCGGTATATTTAGTTGTC
GAGTTTTGACTATCAGACGTTGAAGATGACTTAGAAAGGATTAAAGTGTT
AAAATCTGGCGCCAAGCACAAACACTGAGATCTGCGAACACATTTTCCAT
TTTGGTAAAGATAACCAAATTTACAAACACAGGCTTTTATACATTTATTC
GTGCTGGAAACGCATCTTACATGGGGATTCATATGACTGCATGATGTTGG
ACATAGGATATTAGCACACTCGTGCATGATGGCATTTTCCACACAAGGAC
ATTGCGACTTCATGCATCTTCGAGATTCCATCAATGGCTTTGTACAAAGG
CTATTTTTATTTGCATTAATAAGTTGTCTGACTCTGGTTTGATATTCATC
TTTACAACTGCTGTTGTAGCATGGACTCCAATTGGACCATTCGGTTAATT
TACACGATTCTTGACAAGGTTGCTCAAAACAAGGTTTAACTTCTATTTTG
TTCAAACAATTTCCATTAATTTTCTTGATTAAATCTTTTTTGTCAATGCT
TCGCATCAATTGGTTTAACAAACAATTCTGACGCCTTGAAGTTTCACCTG
CTCCACAAATTTTAGAGCATTTCTTCCATTTCGTCCATTTATTATTACAG
ACAACAATTGGTATCGTTCGGCCATCAGAACAGAT
back to top

protein sequence of SMED30026600-orf-1

>SMED30026600-orf-1 ID=SMED30026600-orf-1|Name=SMED30026600-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=394bp
ICSDGRTIPIVVCNNKWTKWKKCSKICGAGETSRRQNCLLNQLMRSIDKK
DLIKKINGNCLNKIEVKPCFEQPCQESCKLTEWSNWSPCYNSSCKDEYQT
RVRQLINANKNSLCTKPLMESRRCMKSQCPCVENAIMHECANILCPTSCS
HMNPHVRCVSSTNKCIKACVCKFGYLYQNGKCVRRSQCLCLAPDFNTLIL
SKSSSTSDSQNSTTKYTGQTNAGSSESSGDSKGSSSTSSSSTTTKLSNVI
IKELSKEELKEMENKKQLTPPWGPGYTNPPLYQASPAWYAGETPAGATIK
LPSDSVTAQNTYNVPTGSKATNPLYTPETSPTIKFFVTNKYVPSNSNENQ
NQNQNSGASTTTQKSQQLNSNSLLPGSSSELHFPPIRIIIIDY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000105secretory cell
PLANA:0000141dorsal region of the whole animal
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0000421tail
PLANA:0002054marginal adhesive zone
PLANA:0002142parenchyma
PLANA:0007538adhesion gland
Vocabulary: INTERPRO
TermDefinition
IPR036383TSP1_rpt_sf
IPR030119SCO-spondin
IPR036084Ser_inhib-like_sf
IPR000884TSP1_rpt
IPR002919TIL_dom
Vocabulary: biological process
TermDefinition
GO:0030154cell differentiation
GO:0007399nervous system development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 13..74
e-value: 0.1
score: 18.0
coord: 79..129
e-value: 7.1E-4
score: 28.9
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 11..74
score: 8.036
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 76..129
score: 9.386
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 12..73
e-value: 5.2E-5
score: 25.6
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 74..128
e-value: 2.9E-9
score: 39.0
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 72..128
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 129..187
e-value: 2.0E-6
score: 29.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 346..375
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 208..243
NoneNo IPR availablePANTHERPTHR11339EXTRACELLULAR MATRIX GLYCOPROTEIN RELATEDcoord: 121..224
IPR030119SCO-spondinPANTHERPTHR11339:SF358SCO-SPONDINcoord: 121..224
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 129..187