Ft-2

Overview
NameFt-2
Smed IDSMED30026586
Length (bp)15058
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ft-2 (SMED30026586) t-SNE clustered cells

Violin plots show distribution of expression levels for Ft-2 (SMED30026586) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ft-2 (SMED30026586) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ft-2 (SMED30026586) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026586

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30026586SMESG000017101.1 dd_Smed_v4_7638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30026586SMESG000017101.1 dd_Smed_v4_7638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026586SMESG000017101.1 dd_Smed_v4_7638_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026586SMESG000017101.1 Contig53841newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026586SMESG000017101.1 Contig53841uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30026586SMESG000017101.1 dd_Smed_v6_7638_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ft-2 vs. Ensembl Human
Match: FAT1 (FAT atypical cadherin 1 [Source:HGNC Symbol;Acc:HGNC:3595])

HSP 1 Score: 1159.05 bits (2997), Expect = 0.000e+0
Identity = 1229/4569 (26.90%), Postives = 2040/4569 (44.65%), Query Frame = 3
Query:  216 IESLSISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTK--YTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFY-YLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVKYLS-KYFDPDFNDYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNVFLTPTGELNRYVLKLRAIFSPISTP-AISVTIEAKDLSLNPKTSST---HLTIPLGNLRNINLLSVPEFVSVSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLEGTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMR----NIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXX-XXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSE-----NDKSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKN--FPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNK----RATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIK-PSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILS-RFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNP--TILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWE--IPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSA-LDREERPFVQLLV--LAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIR-VKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNS--KLIYKVLN-EYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRE--RKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAF---VDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKV----NPIITCSIMTIQENNPLNHIVAMCRISSTEMKGK--WSLVPSSSPFDVQND-FEIDSNYGYIRAKKIMDFETQSQYRINVEYRV--DNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHV---TNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPR--VVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQ-IPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPF----LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIV-LLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRT---LWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKP----------------NIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGARNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHCE 13637
            +E   + FT   YNV + ++   + YV H   +MG+       ++ YKI  S +  N F+AE  ++GDF +LRIRTK   TA LNRE    Y L ++ L   K+T       +T+V ++VLD ND  P+F   ++     EN +I T I  V+ATDAD G N E +Y + D++ +        F+I+P SG+I    +L D++       +I A  RG        + S + L++ +   N  AP I+   LS    D    D  +A +TV D D+  N +     I+     +    V   P  +   Y +K        S P   ++T++AKD    P+ SS    H+T P      +      +     I E A  N+ V ++K         + L+  F+  P  +  +S+N  +   S +  V +   A        +  + V  +D   + K     + V   N  PP            EN  IG TV+ + A DPD      ++Y + + N +PF +  F    V   ENLD E M R + +R+  +D G P  R V     I + ++N+  P F    C+ TI    P DL +G  I     +D D    +Q  I + + +   FS++P SG LSL  +   G+ +K++  ++ + A D    ++ + +N +V      + S + + L C +  +       +    N  +N  E     F       +IP F + +P+ I ++E    G+ V  I M + D D   +  + V+ V    E   F I   D  +  + +   LDRET DKY + I V D G P+   ++   + V D NDNPP FL +S+ + ++  E+ ++   I+Q++ATD D   +  + Y +V     F I S TG + +   LDRE +  + + I A D       L +T  + + + D+NDN P F   +Y + + EDLP G+ ++ L A D DL  + Q+RY++       F  D  +GAV ++ +L    +  Y L    KD GKP +LSS    ++    V+ N + P     +    ++E+   G+LV ++     D      + Y+I   S G+ +F+I  E G I T   +DRE    YWL ++  D+    ++  + E+YI+V D NDN P      Y   + EN      ++ ++A D D +   +L YKI SG+  G+FSI   TG I+T+ R +DRE         D + L+V ++D+G P +     + V I+D NDN P F+    F   R    E  +  R      L   V A D D   NA + Y+++       + +    F ++ K+G     +SS  F  S  G   I    +++ A D G P   +      T RL++ E  + PK        ++S      + SD +  +    I  E   IP+    D  G + +   D   G  ++I AK                D+       +T+E T   T    Q    +FIK  + N   P F   S+   ++ I + T P   I  + A                     + D    +IY++ +S DP++++K F ++   G L      +  +     + V  R++    +  + ++ +++ DTN+  P F  S  +  +Y                                         +++G+++  ++A D+D G+N +++++I++ ++  N F +D   G I+  + L         L +  +D G PP     + +V I      ++ P+    +  + + E  S+ S +  +   S +        VV  IK  +TG  F +   +G IIT  +LD E +  I ++ IQ  +  GL +      +V +H+ D NDNAP F+   +  G+ISESA+  S+V        L+     LVI A D D+  N  + Y I+     +YF ID  TG +   L +D E    F   ++++ D G+P+L ++    + + + D NDCPP F K  Y   L+LPT+    ++ +   D D +    +++SI  G     FS+D  TG L +       + +  S   + +RA DG+F    ++ IN  ++  +    L+ +Q V+   + EN  +   L +  A    +  +  + Y +L+   + +I+  +G L       DRE++    ++V    +    +  ++ V V V D+ND  P+F++  Y  +V  + ++    IR V A+D D+G NG V Y   Y+K   +   F I    G I+++     + L K++ + + A D G PA S+   V + +++   P+F+K  YS  + E       V  V+A S  G  + Y+IT+G+    F ++F          VI ++  LD+E  P + L I ATD  +       V I V DIND  P+F + SY+ ++SE   I   ++ +         ++ +  S ++  + S  S  HF ++ +TG IS+   LD+E    H  ++     G  + ++   + V + D NDNPP F Q  + A IS  +  G  V    A D D++   KL Y +L+   +  F ID ++G I  + + +   L P        + V D        V V  +    H P+F+ NE+ + ++EN  +++ +  +  +D D   +G + YH++  F  + F ++       L+K LDRE   + +  +R++  D G K  F TV + +TD NDN P      YEV  I S+ + GT   S++++ A D D      + Y + +   S+S+     ++ ++G ++ K S I      GL N     E +    +  +    S             V V + IL  + ++     P  T    T+ E+ P+   + + R    E  G   +SLV  ++P   +++ F ID   G ++ +K +D ET   Y+ ++  R   D+  ++A+  + I + D ND  P+F++S Y  FI E++P GS+VIQ +A D D      + YSL Q  SVE   SF I+ + GW+ ++  +D+E+     + V ASD    +   +   + ++V DVND  P +T        EI +     SE  P+  V+  LS  D DSE     + + IT  +    +A   +    +V +  PLD EK    L L   A+D    SK   I+ ++V+D ND++PVC + +    I E + PG +I  + A D D  +    +TYTL+  S      + P TG +  + PLDRE  +  + +V A D   + C   I++ + D+NDNAP F   S  P+     EN   G+++ ++ A DAD+G+NRKI+Y ++D +   FSI+  +GI+++   LDRE Q  + L ++A D G P +   T   IV +LD+ND+PP F        V+ED  +G  ++ + A S DI  NAE++Y +I+  E   F ++S +G + +I+ LD+E S EY+LTV A+D G PSLS    V + V D+NDN P F    Y   I E+ ++ +  I  V A D+D   NS + YS +        N  S+       F I+P  GE+ +  + DRE    Y   V  +D+G P   + T V I++ D NDN P F++ ++  +I          QE K  G  F V +L + D+D   N  PF   ++       F     E+  + +LL + ++    +    L V+V DNG+P L     + + VI  S  PP I PL + ++    E   G    I ++   D+   +D LT+      +L  ++ +N F + S  G +   + LD G Y LNV VT+   +T   I + I  +T++M+     I+ +++ P                NI   RR D++++    S                                             P   +DVL+ V      +   +  L+ +I +   D+ +I     + +F  +C     C    C   + V+  +   +     ++F++      + CLC    EG RC    + C   PC     C  DP +     C CP   SG++ + P    G+SS              +  TG  ++ + L E  N L M++    R     A +M  +      + I     G++    D  + P I   +S+  + DG+WH V L + G       +  +V+D +     +    ++  + +  +  G   +I  +     +S  +     GC+  + LN Q+LP    P         V   +++ GC  +     CA+  C+NGG+C            Y C+C   + G +CEI  + C   PC++GG CV    GF C C    TG RCQ    C     PC    TC +         AVC C    RG  CQ D+DEC   P  C  G  +C N H  Y CNC+  YRG HCE
Sbjct:   27 LEQTPLQFTHLEYNVTVQENSAAKTYVGH-PVKMGVYITHPAWEVRYKIV-SGDSENLFKAEEYILGDFCFLRIRTKGGNTAILNREVKDHYTLIVKAL--EKNTN---VEARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDM--------FAIHPTSGVIVLTGRL-DYLETKLYEMEILAADRGMKLYGSSGISSMAKLTVHIEQANECAPVITAVTLSPSELD---RDPAYAIVTVDDCDQGANGDIASLSIVAGDLLQQFRTVRSFPGSK--EYKVKAIGGIDWDSHPFGYNLTLQAKDKGTPPQFSSVKVIHVTSPQFKAGPVKFEK--DVYRAEISEFAPPNTPVVMVKAI----PAYSHLRYVFKSTPG-KAKFSLNYNTGLISILEPVKRQQAA--------HFELEVTTSDRKASTKVL---VKVLGANSNPPEFTQTAYKAAFDENVPIGTTVMSLSAVDPDEGENGYVTYSIANLNHVPFAIDHFT-GAVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFEKINCEGTI----PRDLGVGEQITTVSAIDADELQLVQYQIEAGN-ELDFFSLNPNSGVLSLKRSLMDGLGAKVSFHSLRITATDGENFATPLYINITV------AASHKLVNLQCEETGV-AKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTLPTGIQVKENQPVGSSV--IFMNSTDLDTG-FNGKLVYAVSGGNEDSCFMI---DMETGMLKILSPLDRETTDKYTLNITVYDLGIPQKAAWRLLHVVVVDANDNPPEFLQESYFVEVS--EDKEVHSEIIQVEATDKDLGPNGHVTYSIVTDTDTFSIDSVTGVVNIARPLDRELQHEHSLKIEARDQAREEPQLFSTVVVKVSLEDVNDNPPTFIPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSGQVRYSLLDHGEGNFDVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHPPVFSSFVEKGTVKEDAPVGSLVMTVSAHDEDARRDGEIRYSIRDGS-GVGVFKIGEETGVIETSDRLDRESTSHYWLTVFATDQGVVPLSSFI-EIYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLMYKITSGNPQGFFSIHPKTGLITTTSRKLDREQ-------QDEHILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQK--FYKIRLPEREKPDRERNARREPLY-HVIATDKDEGPNAEISYSIE-------DGNEHGKFFIEPKTG----VVSSKRF--SAAGEYDI----LSIKAVDNGRPQKSS------TTRLHI-EWISKPKPSLEPISFEESFFTFTVMESDPVAHMIG-VISVEPPGIPL--WFDITGGNYDSHFDVDKGTGTIIVAKP--------------LDAEQKSNYNLTVEATDGTTTILTQ----VFIKVIDTNDHRPQF---STSKYEVVIPEDTAPETEILQISA--------------------VDQDEKNKLIYTLQSSRDPLSLKK-FRLDPATGSLYTSEKLDHEAVHQHTLTVMVRDQDVPVKRNFARIVVNVSDTNDHAPWFTASSYKGRVYE---------------------------------------SAAVGSVVLQVTALDKDKGKNAEVLYSIESGNIG-NSFMIDPVLGSIKTAKELDRSNQAEYDLMVKATDKGSPPM--SEITSVRIFVTIADNASPKFTSKEYSVELSETVSIGSFVGMVTAHSQSS-------VVYEIKDGNTGDAFDINPHSGTIITQKALDFETLP-IYTLIIQGTNMAGLSTN----TTVLVHLQDENDNAPVFM-QAEYTGLISESASINSVV--------LTDRNVPLVIRAADADKDSNALLVYHIVEPSVHTYFAIDSSTGAIHTVLSLDYEETSIF-HFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFAKPLYEASLLLPTYKGVKVITVNATDADSSAFSQLIYSITEGNIGEKFSMDYKTGALTVQN-----TTQLRSRYELTVRASDGRFAGLTSVKINVKESKESH---LKFTQDVYSAVVKENSTEAETLAVITA--IGNPINEPLFYHILNPDRRFKISRTSGVLSTTGTPFDREQQEAFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYYAVVKVD-TEVGHVIRYVTAVDRDSGRNGEVHY---YLK--EHHEHFQI-GPLGEISLKKQFELDTLNKEYLVTVVAKDGGNPAFSAEVIVPITVMNKAMPVFEKPFYSAEIAESIQVHSPVVHVQANSPEGLKVFYSITDGDPFSQFTINFNTG-------VINVIAPLDFEAHPAYKLSIRATDSLTGAHAEVFVDIIVDDINDNPPVFAQQSYAVTLSEASVIGTSVVQVRATDSDSEPNRGI--SYQMFGNHSK-SHDHFHVDSSTGLISLLRTLDYEQSRQHTIFVRAVDGGMPTLSSDVIVTVDVTDLNDNPPLFEQQIYEARISEHAPHGHFVTCVKAYDADSSDIDKLQYSILSGNDHKHFVIDSATGIITLSNL-HRHALKP---FYSLNLSVSDGVFRSSTQVHVTVIGGNLHSPAFLQNEYEVELAENAPLHTLVMEVKTTDGDSGIYGHVTYHIVNDFAKDRFYINERGQIFTLEK-LDRETPAEKVISVRLMAKDAGGKVAFCTVNVILTDDNDNAPQFRATKYEVN-IGSSAAKGT---SVVKVLASDADEGSNADITYAIEAD--SESVKENLEINKLSGVITTKESLI------GLEN-----EFFTFFVRAVDNGSPSKESV---------VLVYVKILPPEMQLPKFSEPFYT---FTVSEDVPIGTEIDLIR---AEHSGTVLYSLVKGNTPESNRDESFVIDRQSGRLKLEKSLDHETTKWYQFSILARCTQDDHEMVASVDVSIQVKDANDNSPVFESSPYEAFIVENLPGGSRVIQIRASDADSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTLKELDHEKRDNYQIKVVASDHGEKIQLSSTAIVDVTVTDVNDSPPRFTA-------EIYKGT--VSEDDPQGGVIAILSTTDADSEEINRQVTYFITGGDPLGQFAVETIQNEWKVYVKKPLDREKRDNYL-LTITATDGTFSSKA--IVEVKVLDANDNSPVCEKTLYSDTIPEDVLPGKLIMQISATDADIRSNAE-ITYTLL-GSGAEKFKLNPDTGELKTSTPLDREEQAVYHLLVRATDGGGRFCQASIVLTLEDVNDNAPEF---SADPYAITVFENTEPGTLLTRVQATDADAGLNRKILYSLIDSADGQFSINELSGIIQLEKPLDRELQAVYTLSLKAVDQGLPRRLTATGTVIVSVLDINDNPPVFEYREYGATVSEDILVGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFIIENLDYESSHEYYLTVEATDGGTPSLSDVATVNVNVTDINDNTPVFSQDTYTTVISEDAVLEQSVI-TVMADDADGPSNSHIHYSII------DGNQGSS-------FTIDPVRGEVKVTKLLDRETISGYTLTVQASDNGSPPRVNTTTVNIDVSDVNDNAPVFSRGNYSVII----------QENKPVG--FSVLQLVVTDEDSSHNGPPFFFTIVTGNDEKAF-----EVNPQGVLLTSSAIKRKEKDHYLLQVKVADNGKPQLSSLTYIDIRVIEESIYPPAILPLEI-FITSSGEEYSGG--VIGKIHATDQD-VYDTLTY------SLDPQM-DNLFSVSSTGGKLIAHKKLDIGQYLLNVSVTDGKFTTVADITVHIRQVTQEMLNHTIAIRFANLTPEEFVGDYWRNFQRALRNILGVRRNDIQIVSLQSS--------------------------------------------EPHPHLDVLLFVEKPGSAQ-ISTKQLLHKINSSVTDIEEIIGVRILNVFQKLCAGLD-CPWKFCDEKVSVDESVMSTHSTAR-LSFVTPRHHRAAVCLCK---EG-RCPPVHHGCEDDPCPEGSECVSDPWEEK-HTCVCP---SGRFGQCP----GSSS--------------MTLTGNSYVKYRLTENENKLEMKLTMRLRTYSTHAVVMYARGTDYSILEI---HHGRLQYKFDCGSGPGIVSVQSIQ-VNDGQWHAVALEVNG------NYARLVLDQVHTASGTAPGTLKTLNLDNYVFFGG--HIRQQGTRHGRSPQVGNGFRGCMDSIYLNGQELPLNSKPRSYAHIEESV---DVSPGCFLTATED-CASNPCQNGGVC-----NPSPAGGYYCKCSALYIGTHCEISVNPCSSKPCLYGGTCVVDNGGFVCQCRGLYTGQRCQLSPYCKD--EPCKNGGTCFDS-----LDGAVCQCDSGFRGERCQSDIDECSGNP--CLHG-ALCENTHGSYHCNCSHEYRGRHCE 4163          
BLAST of Ft-2 vs. Ensembl Human
Match: FAT1 (FAT atypical cadherin 1 [Source:HGNC Symbol;Acc:HGNC:3595])

HSP 1 Score: 1154.43 bits (2985), Expect = 0.000e+0
Identity = 1231/4578 (26.89%), Postives = 2041/4578 (44.58%), Query Frame = 3
Query:  216 IESLSISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTK--YTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFY-YLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVKYLS-KYFDPDFNDYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNVFLTPTGELNRYVLKLRAIFSPISTP-AISVTIEAKDLSLNPKTSST---HLTIPLGNLRNINLLSVPEFVSVSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLEGTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMR----NIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXX-XXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSE-----NDKSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKN--FPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFD-------IIVEARNK----RATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVA--LNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIK-PSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILS-RFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNP--TILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWE--IPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSA-LDREERPFVQLLV--LAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIR-VKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNS--KLIYKVLN-EYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRE--RKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAF---VDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKV----NPIITCSIMTIQENNPLNHIVAMCRISSTEMKGK--WSLVPSSSPFDVQND-FEIDSNYGYIRAKKIMDFETQSQYRINVEYRV--DNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHV---TNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPR--VVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQ-IPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPF----LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIV-LLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRT---LWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKP----------------NIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGARNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHCE 13637
            +E   + FT   YNV + ++   + YV H   +MG+       ++ YKI  S +  N F+AE  ++GDF +LRIRTK   TA LNRE    Y L ++ L   K+T       +T+V ++VLD ND  P+F   ++     EN +I T I  V+ATDAD G N E +Y + D++ +        F+I+P SG+I    +L D++       +I A  RG        + S + L++ +   N  AP I+   LS    D    D  +A +TV D D+  N +     I+     +    V   P  +   Y +K        S P   ++T++AKD    P+ SS    H+T P      +      +     I E A  N+ V ++K         + L+  F+  P  +  +S+N  +   S +  V +   A        +  + V  +D   + K     + V   N  PP            EN  IG TV+ + A DPD      ++Y + + N +PF +  F    V   ENLD E M R + +R+  +D G P  R V     I + ++N+  P F    C+ TI    P DL +G  I     +D D    +Q  I + + +   FS++P SG LSL  +   G+ +K++  ++ + A D    ++ + +N +V      + S + + L C +  +       +    N  +N  E     F       +IP F + +P+ I ++E    G+ V  I M + D D   +  + V+ V    E   F I   D  +  + +   LDRET DKY + I V D G P+   ++   + V D NDNPP FL +S+ + ++  E+ ++   I+Q++ATD D   +  + Y +V     F I S TG + +   LDRE +  + + I A D       L +T  + + + D+NDN P F   +Y + + EDLP G+ ++ L A D DL  + Q+RY++       F  D  +GAV ++ +L       Y L    KD GKP +LSS    ++    V+ N + P     +    ++E+   G+LV ++     D      + Y+I   S G+ +F+I  E G I T   +DRE    YWL ++  D+    ++  + E+YI+V D NDN P      Y   + EN      ++ ++A D D +   +L YKI SG+  G+FSI   TG I+T+ R +DRE         D + L+V ++D+G P +     + V I+D NDN P F+    F   R    E  +  R      L   V A D D   NA + Y+++       + +    F ++ K+G     +SS  F  S  G   I    +++ A D G P   +      T RL++ E  + PK        ++S      + SD +  +    I  E   IP+    D  G + +   D   G  ++I AK                D+       +T+E T   T    Q    +FIK  + N   P F   S+   ++ I + T P   I  + A                     + D    +IY++ +S DP++++K F ++   G L        Y+++  D       + V  R++    +  + ++ +++ DTN+  P F  S  +  +Y                                         +++G+++  ++A D+D G+N +++++I++ +     N F +D   G I+  + L         L +  +D G PP     + +V I      ++ P+    +  + + E  S+ S +  +   S +        VV  IK  +TG  F +   +G IIT  +LD E +  I ++ IQ  +  GL +      +V +H+ D NDNAP F+   +  G+ISESA+  S+V        L+     LVI A D D+  N  + Y I+     +YF ID  TG +   L +D E    F   ++++ D G+P+L ++    + + + D NDCPP F K  Y   L+LPT+    ++ +   D D +    +++SI  G     FS+D  TG L +       + +  S   + +RA DG+F    ++ IN  ++  +    L+ +Q V+   + EN  +   L +  A    +  +  + Y +L+   + +I+  +G L       DRE++    ++V    +    +  ++ V V V D+ND  P+F++  Y  +V  + ++    IR V A+D D+G NG V Y   Y+K   +   F I    G I+++     + L K++ + + A D G PA S+   V + +++   P+F+K  YS  + E       V  V+A S  G  + Y+IT+G+    F ++F          VI ++  LD+E  P + L I ATD  +       V I V DIND  P+F + SY+ ++SE   I   ++ +         ++ +  S ++  + S  S  HF ++ +TG IS+   LD+E    H  ++     G  + ++   + V + D NDNPP F Q  + A IS  +  G  V    A D D++   KL Y +L+   +  F ID ++G I  + + +   L P        + V D        V V  +    H P+F+ NE+ + ++EN  +++ +  +  +D D   +G + YH++  F  + F ++       L+K LDRE   + +  +R++  D G K  F TV + +TD NDN P      YEV  I S+ + GT   S++++ A D D      + Y + +   S+S+     ++ ++G ++ K S I      GL N     E +    +  +    S             V V + IL  + ++     P  T    T+ E+ P+   + + R    E  G   +SLV  ++P   +++ F ID   G ++ +K +D ET   Y+ ++  R   D+  ++A+  + I + D ND  P+F++S Y  FI E++P GS+VIQ +A D D      + YSL Q  SVE   SF I+ + GW+ ++  +D+E+     + V ASD    +   +   + ++V DVND  P +T        EI +     SE  P+  V+  LS  D DSE     + + IT  +    +A   +    +V +  PLD EK    L L   A+D    SK   I+ ++V+D ND++PVC + +    I E + PG +I  + A D D  +    +TYTL+  S      + P TG +  + PLDRE  +  + +V A D   + C   I++ + D+NDNAP F   S  P+     EN   G+++ ++ A DAD+G+NRKI+Y ++D +   FSI+  +GI+++   LDRE Q  + L ++A D G P +   T   IV +LD+ND+PP F        V+ED  +G  ++ + A S DI  NAE++Y +I+  E   F ++S +G + +I+ LD+E S EY+LTV A+D G PSLS    V + V D+NDN P F    Y   I E+ ++ +  I  V A D+D   NS + YS +        N  S+       F I+P  GE+ +  + DRE    Y   V  +D+G P   + T V I++ D NDN P F++ ++  +I          QE K  G  F V +L + D+D   N  PF   ++       F     E+  + +LL + ++    +    L V+V DNG+P L     + + VI  S  PP I PL + ++    E   G    I ++   D+   +D LT+      +L  ++ +N F + S  G +   + LD G Y LNV VT+   +T   I + I  +T++M+     I+ +++ P                NI   RR D++++    S                                             P   +DVL+ V      +   +  L+ +I +   D+ +I     + +F  +C     C    C   + V+  +   +     ++F++      + CLC    EG RC    + C   PC     C  DP +     C CP   SG++ + P    G+SS              +  TG  ++ + L E  N L M++    R     A +M  +      + I     G++    D  + P I   +S+  + DG+WH V L + G       +  +V+D +     +    ++  + +  +  G   +I  +     +S  +     GC+  + LN Q+LP    P         V   +++ GC  +     CA+  C+NGG+C            Y C+C   + G +CEI  + C   PC++GG CV    GF C C    TG RCQ    C     PC    TC +         AVC C    RG  CQ D+DEC   P  C  G  +C N H  Y CNC+  YRG HCE
Sbjct:   27 LEQTPLQFTHLEYNVTVQENSAAKTYVGH-PVKMGVYITHPAWEVRYKIV-SGDSENLFKAEEYILGDFCFLRIRTKGGNTAILNREVKDHYTLIVKAL--EKNTN---VEARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDM--------FAIHPTSGVIVLTGRL-DYLETKLYEMEILAADRGMKLYGSSGISSMAKLTVHIEQANECAPVITAVTLSPSELD---RDPAYAIVTVDDCDQGANGDIASLSIVAGDLLQQFRTVRSFPGSK--EYKVKAIGGIDWDSHPFGYNLTLQAKDKGTPPQFSSVKVIHVTSPQFKAGPVKFEK--DVYRAEISEFAPPNTPVVMVKAI----PAYSHLRYVFKSTPG-KAKFSLNYNTGLISILEPVKRQQAA--------HFELEVTTSDRKASTKVL---VKVLGANSNPPEFTQTAYKAAFDENVPIGTTVMSLSAVDPDEGENGYVTYSIANLNHVPFAIDHFT-GAVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFEKINCEGTI----PRDLGVGEQITTVSAIDADELQLVQYQIEAGN-ELDFFSLNPNSGVLSLKRSLMDGLGAKVSFHSLRITATDGENFATPLYINITV------AASHKLVNLQCEETGV-AKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTLPTGIQVKENQPVGSSV--IFMNSTDLDTG-FNGKLVYAVSGGNEDSCFMI---DMETGMLKILSPLDRETTDKYTLNITVYDLGIPQKAAWRLLHVVVVDANDNPPEFLQESYFVEVS--EDKEVHSEIIQVEATDKDLGPNGHVTYSIVTDTDTFSIDSVTGVVNIARPLDRELQHEHSLKIEARDQAREEPQLFSTVVVKVSLEDVNDNPPTFIPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSGQVRYSLLDHGEGNFDVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHPPVFSSFVEKGTVKEDAPVGSLVMTVSAHDEDARRDGEIRYSIRDGS-GVGVFKIGEETGVIETSDRLDRESTSHYWLTVFATDQGVVPLSSFI-EIYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLMYKITSGNPQGFFSIHPKTGLITTTSRKLDREQ-------QDEHILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQK--FYKIRLPEREKPDRERNARREPLY-HVIATDKDEGPNAEISYSIE-------DGNEHGKFFIEPKTG----VVSSKRF--SAAGEYDI----LSIKAVDNGRPQKSS------TTRLHI-EWISKPKPSLEPISFEESFFTFTVMESDPVAHMIG-VISVEPPGIPL--WFDITGGNYDSHFDVDKGTGTIIVAKP--------------LDAEQKSNYNLTVEATDGTTTILTQ----VFIKVIDTNDHRPQF---STSKYEVVIPEDTAPETEILQISA--------------------VDQDEKNKLIYTLQSSRDPLSLKK-FRLDPATGSL--------YTSEKLDHEAVPAHLTVMVRDQDVPVKRNFARIVVNVSDTNDHAPWFTASSYKGRVYE---------------------------------------SAAVGSVVLQVTALDKDKGKNAEVLYSIESGTFGNIGNSFMIDPVLGSIKTAKELDRSNQAEYDLMVKATDKGSPPM--SEITSVRIFVTIADNASPKFTSKEYSVELSETVSIGSFVGMVTAHSQSS-------VVYEIKDGNTGDAFDINPHSGTIITQKALDFETLP-IYTLIIQGTNMAGLSTN----TTVLVHLQDENDNAPVFM-QAEYTGLISESASINSVV--------LTDRNVPLVIRAADADKDSNALLVYHIVEPSVHTYFAIDSSTGAIHTVLSLDYEETSIF-HFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFAKPLYEASLLLPTYKGVKVITVNATDADSSAFSQLIYSITEGNIGEKFSMDYKTGALTVQN-----TTQLRSRYELTVRASDGRFAGLTSVKINVKESKESH---LKFTQDVYSAVVKENSTEAETLAVITA--IGNPINEPLFYHILNPDRRFKISRTSGVLSTTGTPFDREQQEAFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYYAVVKVD-TEVGHVIRYVTAVDRDSGRNGEVHY---YLK--EHHEHFQI-GPLGEISLKKQFELDTLNKEYLVTVVAKDGGNPAFSAEVIVPITVMNKAMPVFEKPFYSAEIAESIQVHSPVVHVQANSPEGLKVFYSITDGDPFSQFTINFNTG-------VINVIAPLDFEAHPAYKLSIRATDSLTGAHAEVFVDIIVDDINDNPPVFAQQSYAVTLSEASVIGTSVVQVRATDSDSEPNRGI--SYQMFGNHSK-SHDHFHVDSSTGLISLLRTLDYEQSRQHTIFVRAVDGGMPTLSSDVIVTVDVTDLNDNPPLFEQQIYEARISEHAPHGHFVTCVKAYDADSSDIDKLQYSILSGNDHKHFVIDSATGIITLSNL-HRHALKP---FYSLNLSVSDGVFRSSTQVHVTVIGGNLHSPAFLQNEYEVELAENAPLHTLVMEVKTTDGDSGIYGHVTYHIVNDFAKDRFYINERGQIFTLEK-LDRETPAEKVISVRLMAKDAGGKVAFCTVNVILTDDNDNAPQFRATKYEVN-IGSSAAKGT---SVVKVLASDADEGSNADITYAIEAD--SESVKENLEINKLSGVITTKESLI------GLEN-----EFFTFFVRAVDNGSPSKESV---------VLVYVKILPPEMQLPKFSEPFYT---FTVSEDVPIGTEIDLIR---AEHSGTVLYSLVKGNTPESNRDESFVIDRQSGRLKLEKSLDHETTKWYQFSILARCTQDDHEMVASVDVSIQVKDANDNSPVFESSPYEAFIVENLPGGSRVIQIRASDADSGTNGQVMYSLDQSQSVEVIESFAINMETGWITTLKELDHEKRDNYQIKVVASDHGEKIQLSSTAIVDVTVTDVNDSPPRFTA-------EIYKGT--VSEDDPQGGVIAILSTTDADSEEINRQVTYFITGGDPLGQFAVETIQNEWKVYVKKPLDREKRDNYL-LTITATDGTFSSKA--IVEVKVLDANDNSPVCEKTLYSDTIPEDVLPGKLIMQISATDADIRSNAE-ITYTLL-GSGAEKFKLNPDTGELKTSTPLDREEQAVYHLLVRATDGGGRFCQASIVLTLEDVNDNAPEF---SADPYAITVFENTEPGTLLTRVQATDADAGLNRKILYSLIDSADGQFSINELSGIIQLEKPLDRELQAVYTLSLKAVDQGLPRRLTATGTVIVSVLDINDNPPVFEYREYGATVSEDILVGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFIIENLDYESSHEYYLTVEATDGGTPSLSDVATVNVNVTDINDNTPVFSQDTYTTVISEDAVLEQSVI-TVMADDADGPSNSHIHYSII------DGNQGSS-------FTIDPVRGEVKVTKLLDRETISGYTLTVQASDNGSPPRVNTTTVNIDVSDVNDNAPVFSRGNYSVII----------QENKPVG--FSVLQLVVTDEDSSHNGPPFFFTIVTGNDEKAF-----EVNPQGVLLTSSAIKRKEKDHYLLQVKVADNGKPQLSSLTYIDIRVIEESIYPPAILPLEI-FITSSGEEYSGG--VIGKIHATDQD-VYDTLTY------SLDPQM-DNLFSVSSTGGKLIAHKKLDIGQYLLNVSVTDGKFTTVADITVHIRQVTQEMLNHTIAIRFANLTPEEFVGDYWRNFQRALRNILGVRRNDIQIVSLQSS--------------------------------------------EPHPHLDVLLFVEKPGSAQ-ISTKQLLHKINSSVTDIEEIIGVRILNVFQKLCAGLD-CPWKFCDEKVSVDESVMSTHSTAR-LSFVTPRHHRAAVCLCK---EG-RCPPVHHGCEDDPCPEGSECVSDPWEEK-HTCVCP---SGRFGQCP----GSSS--------------MTLTGNSYVKYRLTENENKLEMKLTMRLRTYSTHAVVMYARGTDYSILEI---HHGRLQYKFDCGSGPGIVSVQSIQ-VNDGQWHAVALEVNG------NYARLVLDQVHTASGTAPGTLKTLNLDNYVFFGG--HIRQQGTRHGRSPQVGNGFRGCMDSIYLNGQELPLNSKPRSYAHIEESV---DVSPGCFLTATED-CASNPCQNGGVC-----NPSPAGGYYCKCSALYIGTHCEISVNPCSSKPCLYGGTCVVDNGGFVCQCRGLYTGQRCQLSPYCKD--EPCKNGGTCFDS-----LDGAVCQCDSGFRGERCQSDIDECSGNP--CLHG-ALCENTHGSYHCNCSHEYRGRHCE 4165          
BLAST of Ft-2 vs. Ensembl Human
Match: FAT2 (FAT atypical cadherin 2 [Source:HGNC Symbol;Acc:HGNC:3596])

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 911/3510 (25.95%), Postives = 1535/3510 (43.73%), Query Frame = 3
Query: 1581 ISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINH---PNNYEESNKPIFGMRN------IPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDADSKD---IQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSENDKSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPS------YKTEAILLVA---DSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISP---ANAYSNQTFDIIVEARN---KRATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAI-KNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFA-SYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKI-STNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKS-ALDREERPFVQLLV----------LAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSP--TNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVL--NEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMH--ELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQND-FEIDSNYGYIRAKKIMDFETQSQYRINV-EYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKAGHV---TNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFV--HTSIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKP-PKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDE--LTDECILLVAGSLYLGVRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKP-----------NIFFARRLDLK 11873
            I + D N   P+   +    T+ EN   G +VL + A D D      ++Y +     LPF +  +   ++   + +D E M+R +  RV  +D G+P  R       +++ ++N+ +P F    C  +I +  P    I    A D+D     N++  I S + +   F ++  SG +SL   F +    + T++++ + A+D    +S   LN +VV           + + C K  +    Q T+  TI H     N E S++    +         P F  + P  I + E     T + ++     D     +  + V+ +    E+  F I   +  +  + VA  LD E  + Y + + V D G P+   +K   + V+D NDN PRF    +Q  +T+ E+ ++   I ++   DADS+D   ++Y L++    F +H  TG L +  +LDRE    Y + + A D       L +   L I + D+NDN P        L +PEDLP G+ L  L A+D DL    ++RY +       F  D  TGA+ L  +L       Y L     D G+P A  +    ++    V+ N + P     +    ++EN   GT V  +  +  D      +        G++ F IN + G I+T++ +DRE    YWL +   DR    ++ +  EVYI+VTD NDN P   +A +  S+ E+      ++ + A D D + K +L + I SG+  G+F I     + ++ + +DRE         D + L+V + D+G P   +T  + V I+D        +NDN  +F+  L    +       +   + R+ A D+D  LN  V Y+++         S  E FS+D+ +G +    SSS F     G   I T K    A D G P      P   ++RL++                ++ +    SI + +DE   S       V + DP   +  V +   +G   + W   SG          KT   +++A   D+       +T+E+T  +     Q ++   I   N + P F     E   + +   T P   +  V+A                     + D  + +IY+I  S DP     LF ++ ++G L  +      +  S  T  ++V  +    KR  ++ + IH+ D N   P F                                 Q H + S+  +        + GT L  + A D D G N ++ +++ K +S    +F ++   G I + + L    +    LT+   D G P   + + V + +       S P   +S+  + + E+  V S +  +   S +++    +      + +   +F +   +G I T   LD E+I    S  ++++  + +   +  ++ V + I D NDNAP FL      G ISE+A   S++        + K+    VI+A D D+  N  + Y IL   A  +FKID   G L++  ++D E + SF    + + D+GSP L +    +++I + D ND PP+F +  Y   ++ P  P   LL +R  D D    + +SI  G      +I P TG + + +   + +S K      + IRA DG ++ +  + I S     +K L  ++      + EN  D   LV+  A+   +H + ++ Y LL+      + +  G L+ +  A DRE++   +L V          +A+G         V VS+ D ND  P F    Y  ++           +V A D D G NG V Y   + + + Y   F ID   G I+++     + L  K+ + + A D G P+L S  +V V + +  +PLF    Y V VPE+      +   +A S  G  ++Y I       LF  DF          V+ + G LDYE+K  H   + ATD +       TV + V D+ND  P F +  Y+ S+SE +P    +I +    Q    ++ V +  +++ED S   S+ F+ING+TG +S  + LD+EA     F + V+   +  P  T    + V++ D NDNPP+F QP + A +S  ++ G LV+   A D D+   S+L Y +L  N+  + F I+ SSG I    +   +K L SS     +V   D        V +N  +   + P F  + +   ++EN  V +++  ++A D D   +G + Y +I    SE F ++   G +   + LDRE  +     ++V+  D G +  F TV I +TD NDN P  + + Y V++    +S  +    ++Q+ A D D      + Y +    L + +  ++ +TG V +K S +      GL N    L+ + I  Q    P ++     +++   + V  K   L   K   P+ T S     E+ P    + + +  + +    +SLV  ++P   ++  F +D + G I+ +K MD E+   Y+I+V  + + N+ +++  ++ I + D ND  P+F+   Y   ++E++P+G+ VIQ  A DKD      + Y L           F ID + GW+ ++  +D E  +  +  V A D    +   +   + +S+ D ND  P +       G  +  +  G       +V  L   D D   Q   +   IT  +    +   +V +   +     LD E   K L L+  ASD     +    + I V+DVND++P C Q+     + E + PG  I  + A D D+      +TY+L      +   ++P TG +     LDRE     N V  A D   + C   I ++V D+NDNAPRF   H ++A F +N    + +  + A D D G N ++VY + D ++  FSID  TG++R+   L    Q    L + ASD G P P S +  V + ++ + D  P F+N    ++V ED   G  ++ +  ++       +  Y++++  EQ  FRL++ +G L +   LDFE S +YFL++  S K   SLS  T V++ + DVN++ PQFP  PY   + EN LV  + +  V+A D D  LNS +TYS +              N + H F I+PK GE+ +    DRE+  +Y  ++  TD G P     T++ I++ D NDNPP F Q ++   +          QE    G   +V +L + D D P N  P+  ++      S F V  D   +T E +   A   Y     L +Q +D+G P L     V V+V   S+  P   PL +       E   G    + ++   DR P  D LT+     ETL        F + +  G I   + L  G YS NV V++ T +T   + + +  + ++ ++ A  +    + P             F + +LD+K
Sbjct:  446 IDIVDCNNHAPLFNRSSYDGTLDENIPPGTSVLAVTATDRDHGENGYVTYSIAGPKALPFSIDPY-LGIISTSKPMDYELMKRIYTFRVRASDWGSPFRREKEVSIFLQLRNLNDNQPMFEEVNCTGSIRQDWPVGKSIMTMSAIDVDE--LQNLKYEIVSGN-ELEYFDLNHFSGVISLKRPFINLTAGQPTSYSLKITASDGKNYASPTTLNITVVKDPHFE-----VPVTCDKTGVLT--QFTK--TILHFIGLQNQESSDEEFTSLSTYQINHYTPQFEDHFPQSIDVLESVPINTPLARLAATDPDAG---FNGKLVYVIADGNEEGCFDI---ELETGLLTVAAPLDYEATNFYILNVTVYDLGTPQKSSWKLLTVNVKDWNDNAPRFPPGGYQ--LTISEDTEVGTTIAELTTKDADSEDNGRVRYTLLSPTEKFSLHPLTGELVVTGHLDRESEPRYILKVEARDQPSKGHQLFSVTDLIITLEDVNDNSPQCITEHNRLKVPEDLPPGTVLTFLDASDPDLGPAGEVRYVLMDGAHGTFRVDLMTGALILERELDFERRAGYNLSLWASDGGRPLARRTLCHVEVIVLDVNENLHPPHFASFVHQGQVQENSPSGTQVIVVAAQDDDSGLDGELQYFLRAGTGLAAFSINQDTGMIQTLAPLDREFASYYWLTVLAVDRGSVPLSSV-TEVYIEVTDANDNPPQMSQAVFYPSIQEDAPVGTSVLQLDAWDPDSSSKGKLTFNITSGNYMGFFMIHPVTGLLSTAQQLDRE-------NKDEHILEVTVLDNGEPSLKSTSRVVVGILD--------VNDNPPIFSHKLFNVRLPERLSPVSPGPVYRLVASDLDEGLNGRVTYSIE--------DSDEEAFSIDLVTGVVS---SSSTF---TAGEYNILTIK----ATDSGQP------PLSASVRLHIE---------------WIPWPRPSSIPLAFDETYYSF-----TVMETDP--VNHMVGVISVEGRPGLFWFNISGGDKDMDFDIEKTTGSIVIARPLDTRRRSNYNLTVEVTDGSRTIATQVHI-FMIANINHHRPQFLETRYE---VRVPQDTVPGVELLRVQA--------------------IDQDKGKSLIYTIHGSQDP-GSASLFQLDPSSGVLVTVGKLDLGSGPSQHTLTVMVRDQEIPIKR-NFVWVTIHVEDGNLHPPRF--------------------------------TQLHYEASVPDTI-------APGTELLQVRAMDADRGVNAEVHYSLLKGNSEG--FFNINALLGIITLAQKLDQANHAPHTLTVKAEDQGSPQWHDLATVIIHVYPS--DRSAPIFSKSEYFVEIPESIPVGSPILLVSAMSPSEVTYELR------EGNKDGVFSMNSYSGLISTQKKLDHEKIS---SYQLKIRGSN-MAGAFTDVMVV-VDIIDENDNAPMFLKS-TFVGQISEAAPLYSMI--------MDKNNNPFVIHASDSDKEANSLLVYKILEPEALKFFKIDPSMGTLTIVSEMDYESMPSF-QFCVYVHDQGSPVLFAPRPAQVIIHVRDVNDSPPRFSEQIYEVAIVGPIHPGMELLMVRASDEDSE--VNYSIKTGNADEAVTIHPVTGSISVLNPAFLGLSRK------LTIRASDGLYQDTALVKI-SLTQVLDKSLQFDQDVYWAAVKENLQDRKALVILGAQ--GNHLNDTLSYFLLNGTDMFHMVQSAGVLQTRGVAFDREQQDTHELAVEVRDNRTPQRVAQGL--------VRVSIEDVNDNPPKFKHLPYYTIIQDGTEPGDVLFQVSATDEDLGTNGAVTYE--FAEDYTY---FRIDPYLGDISLKKPFDYQAL-NKYHLKVIARDGGTPSLQSEEEVLVTVRNKSNPLFQSPYYKVRVPENITLYTPILHTQARSPEGLRLIYNIVEEEPLMLFTTDFKTG-------VLTVTGPLDYESKTKHVFTVRATDTALGSFSEATVEVLVEDVNDNPPTFSQLVYTTSISEGLPAQTPVIQLLASDQDSGRNRDVSY--QIVEDGSDV-SKFFQINGSTGEMSTVQELDYEAQ--QHFHVKVRAMDKGDPPLTGETLVVVNVSDINDNPPEFRQPQYEANVSELATCGHLVLKVQAIDPDSRDTSRLEYLILSGNQDRHFF-INSSSGIISMFNL--CKKHLDSS--YNLRVGASDGVFRATVPVYINTTNANKYSPEFQQHLYEAELAENAMVGTKVIDLLAIDKDSGPYGTIDYTIINKLASEKFSINP-NGQIATLQKLDRENSTERVIAIKVMARDGGGRVAFCTVKIILTDENDNPPQFKASEYTVSI----QSNVSKDSPVIQVLAYDADEGQNADVTYSVNPEDLVKDVIEINPVTGVVKVKDSLV------GLEN--QTLDFF-IKAQDGGPPHWN-----SLVPVRLQVVPKKVSL--PKFSEPLYTFS---APEDLPEGSEIGIVKAVAAQDPVIYSLVRGTTPESNKDGVFSLDPDTGVIKVRKPMDHESTKLYQIDVMAHCLQNTDVVSLVSVNIQVGDVNDNRPVFEADPYKAVLTENMPVGTSVIQVTAIDKDTGRDGQVSYRLSADPGSNVHELFAIDSESGWITTLQELDCETCQTYHFHVVAYDHGQTIQLSSQALVQVSITDENDNAPRFASE-EYRGSVVENSEPG------ELVATLKTLDADISEQNRQVTCYITEGDPLGQFGISQVGDEWRISSRKTLDREHTAKYL-LRVTASDGKF--QASVTVEIFVLDVNDNSPQCSQLLYTGKVHEDVFPGHFILKVSATDLDTDTNAQ-ITYSL-HGPGAHEFKLDPHTGELTTLTALDRERKDVFNLVAKATDGGGRSCQADITLHVEDVNDNAPRFFPSHCAVAVF-DNTTVKTPVAVVFARDPDQGANAQVVYSLPDSAEGHFSIDATTGVIRLEKPLQVRPQAPLELTVRASDLGTPIPLSTLGTVTVSVVGLEDYLPVFLNTEHSVQVPEDAPPGTEVLQLATLTRPGA--EKTGYRVVSGNEQGRFRLDARTGILYVNASLDFETSPKYFLSIECSRKSSSSLSDVTTVMVNITDVNEHRPQFPQDPYSTRVLENALVGDVIL-TVSATDEDGPLNSDITYSLIGG------------NQLGH-FTIHPKKGELQVAKALDREQASSYSLKLRATDSGQPPLHEDTDIAIQVADVNDNPPRFFQLNYSTTV----------QENSPIGS--KVLQLILSDPDSPENGPPYSFRITKGNNGSAFRVTPDGWLVTAEGLSRRAQEWY----QLQIQASDSGIPPLSSLTSVRVHVTEQSHYAPSALPLEIFITVGEDEFQGGM---VGKIHATDRDPQ-DTLTYSLAEEETL-----GRHFSVGAPDGKIIAAQGLPRGHYSFNVTVSDGTFTTTAGVHVYVWHVGQEALQQAMWMGFYQLTPEELVSDHWRNLQRFLSHKLDIK 3662          

HSP 2 Score: 224.942 bits (572), Expect = 2.430e-57
Identity = 423/1905 (22.20%), Postives = 762/1905 (40.00%), Query Frame = 3
Query: 5853 SIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLL-QLRVHDPDLNPTILFSIL------NGKESRFFSI---DPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINS----FDNTRNKVLPLEK-SQVVWEIPENRNDVPDLVLPRAKFYF---SHQHPSIKYILL--SEQPKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQP-ALSSFTDVFVDI--VSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS-STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPI----------FLK---------------------SSY---------------SASVSENMPINHEIISISVLLQKVS-NSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLN--EYYNIFKIDQS---SGFIRFNQVPNI-----EKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGN---KHDFATVLIHVTDINDNI-PVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVN---PIITCSIM--TIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSP-LMATRTILIDLIDQNDCPPIFDNSRYAIFISEDI-PLG-SKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVS------------ESGEVLLLHPLDAEKILK-PLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDP---YLLVVEPLTGRVIVNAPLD---REFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRF--------VHTSIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRIL-DESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMI--TEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLP--YVFNIPENTLVSKLTIGK------VTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPA-FSSK-TNVTIEIEDKNDNPPEFAQPSFRFLI 11156
            ++  V +HI D ND  P F             + P   V +  D    S   K   + A D D G+N +  Y   +R +  F I   +GV+++A K           L++  + K   ++L+ +R   M  I + N     F     L V + P     P +  + V  PD N    ++ +      +G E     +   DP   +  I +          SV  IN   +   F  S      S    +   R   LP  K S + +E    R  + +   P ++      +   P+++Y+L   SE    ++N  TG +     +D  +R   QL +       S     V + + D N++ P+F    Y+  +  N+      + V A D D GENG V YSI   K     L F+ID   G+I+       EL+ + +T  ++A+D G P        +F+ +  ++D  P+F++   +  + +D      + T+ AI       + Y I +GN+ E FDL+  +  +      I L           ++L I+A+D  +  S +T  +  V D + E+P+          F K                     S+Y               S  V E++PIN  +  ++        N K+V     +I D +      F I   TG +++   LD+EA   +   + V   G    ++   + V++ D NDN P+F    +  TIS ++  G+ +      D D+  N ++ Y +L+  E +++  +      +G +     P        +  PS G   F V           ++ +    + ++ P  +     + V E+    + +  + ASD D    G +RY ++ G     F +D +TGAL+L++ LD ER++ + L +  SD G    +     V + V D+N+N+ P    ++     +     +GT    ++ + A+D D      + Y            F+ + TG  +     INQ++  G+  T + L+         E   Y +     V   S+ ++    +  +    N   P ++ ++   +IQE+ P+   V        +   K  L  + +  +    F I    G +   + +D E + ++ + V    +  P L +T  +++ ++D ND PPIF +  + + + E + P+    V +  A D D      + YS+   D      +F ID   G V S S     E  +  L + A+D      + ++ + +         W   P    I +          F    Y  +  + D  +        + +    P   +F +S             +G +++  PLD  +     L ++     R   ++    +   + ++N H P   +   ++ + +   PG  +  +QA D+D   K  +L YT+    DP    L  ++P +G ++    LD        T+  +V   ++  K+    + I+V D N + PRF        V  +IAP       G+ + ++ A+DAD G+N ++ Y +L   S+  F+I+   GI+ +A  LD+     H L ++A D G P   ++  V I +   + S P F      + + E   +G  ++ + A+S      +EV+Y++    +   F + S SG ++  KKLD E    Y L +R S+         T V++ V  +++N     FL   +V  I E   +  + + K      + A DSD   NS+L Y  L   PE              FF+I+P  G + +    D E  P+++F V V D G P  F+ +   V I + D ND+PP F++  +   I
Sbjct:  130 ALTRVVVHILDQNDLKPLF-------------SPPSYRVTISEDMPLKSPICK---VTATDADLGQNAEFYYAFNTR-SEMFAIHPTSGVVTVAGK-----------LNVTWRGKHELQVLAVDR---MRKISEGN----GFGSLAALVVHVEPALRKPPAIASVVVTPPDSNDGTTYATVLVDANSSGAEVESVEVVGGDPGKHFKAIKSYARSNEFSLVSVKDINWMEYLHGFNLSLQARSGSGPYFYSQIRGFHLPPSKLSSLKFEKAVYRVQLSEFSPPGSRVVMVRVTPAFPNLQYVLKPSSENVGFKLNARTGLITTTKLMDFHDRAHYQLHIRTSPGQAS---TVVVIDIVDCNNHAPLFNRSSYDGTLDENIPPGTSVLAVTATDRDHGENGYVTYSIAGPKA----LPFSIDPYLGIISTSKPMDYELMKRIYTFRVRASDWGSPFRREKEVSIFLQLRNLNDNQPMFEEVNCTGSIRQDWPVGKSIMTMSAIDVDELQNLKYEIVSGNELEYFDLNHFSGVISLKRPFINLTAGQPTS----YSLKITASDGKNYASPTTLNITVVKDPHFEVPVTCDKTGVLTQFTKTILHFIGLQNQESSDEEFTSLSTYQINHYTPQFEDHFPQSIDVLESVPINTPLARLAATDPDAGFNGKLV----YVIADGN--EEGCFDIELETGLLTVAAPLDYEATNFYILNVTVYDLGTPQKSSWKLLTVNVKDWNDNAPRFPPGGYQLTISEDTEVGTTIAELTTKDADSEDNGRVRYTLLSPTEKFSLHPLTGELVVTGHLDRESEPRYILKVEARDQPSKGHQLFSV----------TDLIITLEDVNDNSPQCITEHNRLKVPEDLPPGTVLTFLDASDPDLGPAGEVRYVLMDGAHG-TFRVDLMTGALILERELDFERRAGYNLSLWASDGGRPLARRTLCHVEVIVLDVNENLHPPHFASFVHQGQVQENSPSGT---QVIVVAAQDDDSGLDGELQY------------FLRAGTGLAAFS---INQDT--GMIQTLAPLDR--------EFASYYWLTVLAVDRGSVPLSSVTEVYIEVTDANDNPPQMSQAVFYPSIQEDAPVGTSVLQLDAWDPDSSSKGKLTFNITSGNYMGFFMIHPVTGLLSTAQQLDRENKDEHILEVTVLDNGEPSLKSTSRVVVGILDVNDNPPIFSHKLFNVRLPERLSPVSPGPVYRLVASDLDEGLNGRVTYSIEDSDE----EAFSIDLVTGVVSSSSTFTAGEYNI--LTIKATDSGQPPLSASVRLHI--------EWIPWPRPSSIPL---------AFDETYYSFTVMETDPVNHMVG----VISVEGRPGLFWFNISGGDKDMDFDIEKTTGSIVIARPLDTRRRSNYNLTVEVTDGSRTIATQVHIFM---IANINHHRPQFLETRYEVRVPQDTVPGVELLRVQAIDQD---KGKSLIYTIHGSQDPGSASLFQLDPSSGVLVTVGKLDLGSGPSQHTLTVMVRDQEIPIKRNFVWVTIHVEDGNLHPPRFTQLHYEASVPDTIAP-------GTELLQVRAMDADRGVNAEVHYSLLKGNSEGFFNINALLGIITLAQKLDQANHAPHTLTVKAEDQGSPQWHDLATVIIHVYPSDRSAPIFSKSEYFVEIPESIPVGSPILLVSAMSP-----SEVTYELREGNKDGVFSMNSYSGLISTQKKLDHEKISSYQLKIRGSNMA----GAFTDVMVVVDIIDENDNAPMFLKSTFVGQISEAAPLYSMIMDKNNNPFVIHASDSDKEANSLLVYKILE--PEAL-----------KFFKIDPSMGTLTIVSEMDYESMPSFQFCVYVHDQGSPVLFAPRPAQVIIHVRDVNDSPPRFSEQIYEVAI 1881          

HSP 3 Score: 120.553 bits (301), Expect = 1.005e-25
Identity = 189/837 (22.58%), Postives = 342/837 (40.86%), Query Frame = 3
Query: 1521 LTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPD-ISRTKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITI-SRQAPYDLK-IGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSG------------------------LVSSKMALNFSVVDANSR-------SLSGRP-------------IKLDCVKND----IYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFAT---NIPSVIHIREE--SAKGTI--VQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYH-MTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLV--NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI-HGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTS-------IRPETSDKEPQSFVYTISGHSNGISLFRIN-NEGEIRTVSSIDREKEESYWLYIYIEDRNDEII-NKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDT 3803
            LT+      S+       + I V D N+ PP +       +++E+  +G +VL + A+DPD  S+ K+++ +   N + F +      ++   + LD E  +    + V V D+G P  +S  +   + I DVN+  P F +K   + +  R +P     +   +A DLD      +  SI      +  FSI   +G +S   TF  G  + LT     ++A DSG                        L   +   +F+V++ +         S+ GRP             +  D  K      I  P  T R S  N      + ++ I    +I + A    + P  +  R E    + T+  V+ + ++  D+D+       ++ +   ++    S+ + D  S  +V   +LD  +    H +T+ V DQ  P    F    I VED N +PPRF        ++P+       ++Q++A DAD   + ++ Y L+  N    F I++  G + L   LD+     + + + A D    +      AT+ I V   + + PIF+K+ Y + +PE +P+GS ++ + A        S++ Y +  G     F  ++ +G +    KL    ++ Y+L    K  G   A  +  D  +    +  N   P   +      I E     +++         I    SDKE  S +         +  F+I+ + G +  VS +D E   S+   +Y+ D+   ++     A+V I V D ND+ P      Y+ ++   +     L+ V+A+D D    +E+ Y I +G+ 
Sbjct: 1105 LTVLAVDRGSVPLSSVTEVYIEVTDANDNPPQMSQAVFYPSIQEDAPVGTSVLQLDAWDPDSSSKGKLTFNITSGNYMGFFMIHPVTGLLSTAQQLDREN-KDEHILEVTVLDNGEPSLKST-SRVVVGILDVNDNPPIFSHKLFNVRLPERLSPVSPGPVYRLVASDLDEGLNGRVTYSIEDS--DEEAFSIDLVTGVVSSSSTFTAGEYNILT-----IKATDSGQPPLSASVRLHIEWIPWPRPSSIPLAFDETYYSFTVMETDPVNHMVGVISVEGRPGLFWFNISGGDKDMDFDIEKTTGSIVIARPLDTRRRSNYNLTVEVTDGSRTIATQVHIFMIANINHHRPQFLETRYEVRVPQDTVPGVELLRVQAIDQDKG---KSLIYTIHGSQDPGSASLFQLDPSSGVLVTVGKLDLGSGPSQHTLTVMVRDQEIPIKRNFVWVTIHVEDGNLHPPRFT-QLHYEASVPDTIAPGTELLQVRAMDADRGVNAEVHYSLLKGNSEGFFNINALLGIITLAQKLDQANHAPHTLTVKAEDQG--SPQWHDLATVIIHVYPSDRSAPIFSKSEYFVEIPESIPVGSPILLVSAMSP-----SEVTYELREGNKDGVFSMNSYSGLISTQKKLDHEKISSYQL----KIRGSNMA-GAFTDVMVVVDIIDENDNAPMFLKSTFVGQISEAAPLYSMIMDKNNNPFVIHASDSDKEANSLLVYKILEPEALKFFKIDPSMGTLTIVSEMDYESMPSFQFCVYVHDQGSPVLFAPRPAQVIIHVRDVNDSPPRFSEQIYEVAIVGPIHPGMELLMVRASDED----SEVNYSIKTGNA 1912          

HSP 4 Score: 112.079 bits (279), Expect = 3.033e-23
Identity = 225/921 (24.43%), Postives = 385/921 (41.80%), Query Frame = 3
Query: 1497 DFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLF----DQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAP--IARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFI--AEDLDRDGRDNIQISIASVSFQQP-CFSIHPESGTLSL--LCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVN----FRRVFKIHSRTGWLRLR---VNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDA-DLDDNSQLRYAIHGIHSD-CFHCDTSTGAVHLLCKLS-PLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGT---LVTSIRPETSDKEPQSFVYTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKT-ELKYKIISGDTWGYFXXXXXXXX--XXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPP 4163
            D+ S  +++    A + +L +    T+ + V+DVN+ PP         ++ E       V+ + A D D  R + +SY +     D +K  F++      +  V+E LD E  Q+ F ++V   D G P     +++    + ++D+N+  PEF     +  +S  A      GH +   + +D D RD  ++    +S  Q   F I+  SG +S+  LC  KH  L    N  +G  A+D G+  + + +  +  +AN  S                                              P F  ++     + E +  GT V  I +   DKD  PY +   + + ++     FSI    + +  I    +LDRE   +  + I V  +       F   +I + D NDNPP+F  S +  +++  N      ++Q+ A DAD   + D+ Y  VN     + V +I+  TG ++++   V L+ +  D++   I A D    + +      L ++   +  + P F++  Y+ + PEDLP GS +  + A  A D    S +R      + D  F  D  TG + +   +    T+   I V+    +   + S     I    V+ NR  P  +     A + EN   GT    VT+I  +T      S+  +    SN   LF I++E G I T+  +D E  ++Y  ++   D    I     A V + +TDENDN P      Y+ SV EN +    + T+K  DAD++++  ++   I  GD  G F IS  G+    +S +++DRE        T  Y L+V  SD      +      ++           +NDN    ++ L T  ++        IL  +V+A D+D D NA + Y++  P
Sbjct: 2232 DYESKTKHVFTVRATDTALGSFSEATVEVLVEDVNDNPPTFSQLVYTTSISEGLPAQTPVIQLLASDQDSGRNRDVSYQIVEDGSDVSKF-FQINGSTGEMSTVQE-LDYEA-QQHFHVKVRAMDKGDPPLTGETLVV---VNVSDINDNPPEFRQPQYEANVSELA----TCGHLVLKVQAIDPDSRDTSRLEYLILSGNQDRHFFINSSSGIISMFNLCK-KH--LDSSYNLRVG--ASD-GVFRATVPVYINTTNANKYS----------------------------------------------PEFQQHLYEA-ELAENAMVGTKV--IDLLAIDKDSGPYGT-IDYTIINKLASEKFSI----NPNGQIATLQKLDRENSTERVIAIKVMARDGGGRVAFCTVKIILTDENDNPPQFKAS-EYTVSIQSNVSKDSPVIQVLAYDADEGQNADVTYS-VNPEDLVKDVIEINPVTGVVKVKDSLVGLENQTLDFF---IKAQDGGPPHWNSLVPVRLQVVPKKV--SLPKFSEPLYTFSAPEDLPEGSEIGIVKAVAAQDPVIYSLVRGTTPESNKDGVFSLDPDTGVIKVRKPMDHESTKLYQIDVMAHCLQNTDVVSLVSVNIQVGDVNDNR--PVFEADPYKAVLTENMPVGTSVIQVTAIDKDTGRDGQVSYRLSADPGSNVHELFAIDSESGWITTLQELDCETCQTYHFHVVAYDHGQTIQLSSQALVQVSITDENDNAPRFASEEYRGSVVENSEPGELVATLKTLDADISEQNRQVTCYITEGDPLGQFGISQVGDEWRISSRKTLDRE-------HTAKYLLRVTASDGKFQASVTVEIFVLD-----------VNDNSPQCSQLLYTGKVHEDVFPGHFIL--KVSATDLDTDTNAQITYSLHGP 3053          

HSP 5 Score: 105.531 bits (262), Expect = 3.706e-21
Identity = 73/217 (33.64%), Postives = 113/217 (52.07%), Query Frame = 3
Query:  162 NLAMLLLVVVSCVE-LWKCIESLSISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTKY--TASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKL 803
              A+ LL   +C + L   + S +  FT   YN  IY++   + YV  ++ +MGI   E +  + Y+I  S ++ N F+ E  +VG+F +LRIRTK   TA LNRE    Y L IQ   ++      E    T+VV+ +LD+ND  P+F   ++     E+  + + I  VTATDAD G N+E +Y  +  +         F+I+P SG++    KL
Sbjct:    7 GFAIFLLHCATCEKPLEGILSSSAWHFTHSHYNATIYENSSPKTYVESFE-KMGIYLAEPQWAVRYRII-SGDVANVFKTEEYVVGNFCFLRIRTKSSNTALLNREVRDSYTLIIQATEKT-----LELEALTRVVVHILDQNDLKPLFSPPSYRVTISEDMPLKSPICKVTATDADLGQNAEFYYAFNTRSEM-------FAIHPTSGVVTVAGKL 209          

HSP 6 Score: 102.449 bits (254), Expect = 2.458e-20
Identity = 175/779 (22.46%), Postives = 309/779 (39.67%), Query Frame = 3
Query: 1575 LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRT-KISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNE--YKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLV--SSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRF---LDSFQIPMTL-PENYDIKKRIVQIKATDADSKDIQYRLVNF-RRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPI-FTKNSYSLALPEDLPI-------------GSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSP--LTEYRLIAVVKDNGKPQALSSQAD-FQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSN--GISLFRIN-NEGEIRTVSSIDREKEES-YWLYIYIEDRNDEI-INKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYF 3815
            L I+++DVN+  P  +   + + V E+   G  +  + A DPD+    ++ Y L D     FR+ +     +I++  LD E  +  + + +  +D G P+AR  + H E+ + DVNE  + P F     Q  +   +P   ++    A+D D  G D               FSI+ ++G +  L        S    + + + A D G V  SS   +   V DAN                                 +N  + ++ +F            PS   I+E++  GT V ++     D      + +  F + S      F I      +  +  A +LDRE  D++ + + V D G+P      R  + + D+NDNPP F   L + ++P  L P +     R+V     +  +  + Y + +     F I   TG +           +Y  + I A+D      S +    +  I      + P+ F +  YS  + E  P+             G F   +   D D+D                F  + +TG++ +   L     + Y L   V D  +   +++Q   F I     + N + P   E      + ++ +PG  +  ++    DK  +S +YTI G  +    SLF+++ + G + TV  +D     S + L + + D+  EI I +    V I V D N + P   +  Y+ASV + +     L+ V+A DAD     E+ Y ++ G++ G+F
Sbjct:  911 LIITLEDVNDNSPQCITEHNRLKVPEDLPPGTVLTFLDASDPDLGPAGEVRYVLMDGAHGTFRV-DLMTGALILERELDFE-RRAGYNLSLWASDGGRPLARRTLCHVEVIVLDVNENLHPPHFASFVHQGQVQENSPSGTQVIVVAAQD-DDSGLDGELQYFLRAGTGLAAFSINQDTGMIQTLAPLDREFASY---YWLTVLAVDRGSVPLSSVTEVYIEVTDAN---------------------------------DNPPQMSQAVF-----------YPS---IQEDAPVGTSVLQLDAWDPDSSS---KGKLTFNITSGNYMGFFMIHPV---TGLLSTAQQLDRENKDEHILEVTVLDNGEPSLKSTSRVVVGILDVNDNPPIFSHKLFNVRLPERLSPVSPGPVYRLVASDLDEGLNGRVTYSIEDSDEEAFSIDLVTGVVSSSSTF--TAGEYNILTIKATDSGQPPLSASVRLHIEWIPWPRPSSIPLAFDETYYSFTVMETDPVNHMVGVISVEGRPGLFWFNISGGDKDMD----------------FDIEKTTGSIVIARPLDTRRRSNYNLTVEVTDGSR--TIATQVHIFMI----ANINHHRPQFLETRYEVRVPQDTVPGVELLRVQAIDQDKG-KSLIYTIHGSQDPGSASLFQLDPSSGVLVTVGKLDLGSGPSQHTLTVMVRDQ--EIPIKRNFVWVTIHVEDGNLHPPRFTQLHYEASVPDTIAPGTELLQVRAMDADRGVNAEVHYSLLKGNSEGFF 1603          

HSP 7 Score: 79.337 bits (194), Expect = 2.599e-13
Identity = 41/136 (30.15%), Postives = 64/136 (47.06%), Query Frame = 3
Query: 12996 LDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQW-GKSCS 13400
            + +   GC+  V++N + L    L AP  + +  + ++ L   C   L    C+   C NGG C        +   YVC+C   F+G++CE     C  +PC+ GG C+ +  G  C CP   TG RC+   + CS
Sbjct: 3905 VSQGFEGCLDAVVVNEEAL---DLLAPGKTVAGLLETQALTQCC---LHSDYCSQNTCLNGGKC-----SWTHGAGYVCKCPPQFSGKHCEQGRENCTFAPCLEGGTCILSPKGASCNCPHPYTGDRCEMEARGCS 4029          

HSP 8 Score: 75.485 bits (184), Expect = 3.915e-12
Identity = 77/294 (26.19%), Postives = 129/294 (43.88%), Query Frame = 3
Query: 5685 QYVVLSIKPSTGKL-FGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFP-SAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGK---FETSCNITI 6551
            QYV   +KPS+  + F +   TG I T   +D     D     + +++  G  S       V I I D N++AP F      +G + E+  PG+ V               L + A D D G+NG + Y I    A  F ID Y G++S +  +D E++       +R  D GSP    ++ + I + + + ND  P FE +      I   +P    ++ +   D D    + + I++G E  +F ++  +G + +    I ++   P+   + I A DGK     T+ NIT+
Sbjct:  394 QYV---LKPSSENVGFKLNARTGLITTTKLMD---FHDRAHYQLHIRTSPGQASTV-----VVIDIVDCNNHAPLF-NRSSYDGTLDENIPPGTSV---------------LAVTATDRDHGENGYVTYSIAGPKALPFSIDPYLGIISTSKPMDYELMKRIYTFRVRASDWGSP-FRREKEVSIFLQLRNLNDNQPMFE-EVNCTGSIRQDWPVGKSIMTMSAIDVDELQNLKYEIVSGNELEYFDLNHFSGVISLKRPFINLTAGQPTSYSLKITASDGKNYASPTTLNITV 658          

HSP 9 Score: 67.3958 bits (163), Expect = 1.024e-9
Identity = 135/567 (23.81%), Postives = 209/567 (36.86%), Query Frame = 3
Query:  411 VGDFFYLRIRTKYTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKL-------FDFV-----GGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVKYLS-KYFDPDFNDYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNVFLTPTGELNRYVLKLRAIFSPISTPAISVTIEAKDLSLNPKTSSTHLTIPLGNLRNINLLSV------PEFV----SVSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLEGT----YSVNDXXXXXXXXXXXXKDLNAE-DF-GSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDIS-RTKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLD 2021
            VGD +  RI ++ T  L+RE    Y L +     + S GKF+ S   ++   VLD NDN P      +     E+      I  V+ATD D   N++I Y L             F ++P +G +  +  L       F+ V     GG +       +H  D+                    N +AP+    + +   FD      P A +   D D+  N        ++   P S    F   + +    V++L           + +T+ A DL            IPL  L  + +  V      P F+    SV +PE+A   + V  L T                  P  E T     S N+   F          +NA  DF  SP+  L+I  +   S       T+ +++ DVNE  P    +     V EN  +G+ +L + A D D    + I+Y L   N+L       K+  + V + LD E     + +++  TDSG P          I++ADVN+  P F       T+   +P   K+   I  D D
Sbjct: 2960 VGDEW--RISSRKT--LDREHTAKYLLRV-----TASDGKFQASVTVEIF--VLDVNDNSPQCSQLLYTGKVHEDVFPGHFILKVSATDLDTDTNAQITYSLHGPG------AHEFKLDPHTGELTTLTALDRERKDVFNLVAKATDGGGRSCQADITLHVEDV--------------------NDNAPRFFPSHCAVAVFDNTTVKTPVAVVFARDPDQGANAQ------VVYSLPDSAEGHF---SIDATTGVIRLEKPLQVRPQAPLELTVRASDLGT---------PIPLSTLGTVTVSVVGLEDYLPVFLNTEHSVQVPEDAPPGTEVLQLATLTR---------------PGAEKTGYRVVSGNEQGRFRLDARTGILYVNASLDFETSPKYFLSIECSRKSSSSLSDVTTVMVNITDVNEHRPQFPQDPYSTRVLENALVGDVILTVSATDEDGPLNSDITYSLIGGNQLGHFTIHPKKGELQVAKALDRE-QASSYSLKLRATDSGQPPLHE-DTDIAIQVADVNDNPPRFFQLNYSTTVQENSPIGSKVLQLILSDPD 3454          

HSP 10 Score: 60.077 bits (144), Expect = 1.648e-7
Identity = 51/176 (28.98%), Postives = 94/176 (53.41%), Query Frame = 3
Query: 2712 NDNPPRFLDSFQ---IPMTLPENYDIKKRIVQIKATDADSKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLS 3230
            N +P  +++SF+   I +  P+ + ++ RI+     +   K  +Y + NF    +I +++    L   L+RE RD Y ++I A++       L A   + + + D ND KP+F+  SY + + ED+P+ S + ++ ATDADL  N++  YA +   S+ F    ++G V +  KL+
Sbjct:   45 NSSPKTYVESFEKMGIYLAEPQ-WAVRYRIISGDVANV-FKTEEYVVGNFC-FLRIRTKSSNTAL---LNREVRDSYTLIIQATEKTL---ELEALTRVVVHILDQNDLKPLFSPPSYRVTISEDMPLKSPICKVTATDADLGQNAEFYYAFN-TRSEMFAIHPTSGVVTVAGKLN 210          

HSP 11 Score: 56.225 bits (134), Expect = 2.566e-6
Identity = 49/209 (23.44%), Postives = 93/209 (44.50%), Query Frame = 3
Query: 7188 IVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKA----ISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGK------LDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILV 7784
            I+S  +  F  S Y+  + E++     V + +     ++     + Y I +G+   +F    T  Y+    C +R+  K      L+ E +  +TLII AT+ +  L   T V++ +LD ND  P+F   SY  ++SE+MP+   I  ++     +  +    ++           S+ F I+ T+G +++   L+      HE  +L 
Sbjct:   25 ILSSSAWHFTHSHYNATIYENSSPKTYVESFEKMGIYLAEPQWAVRYRIISGDVANVFK---TEEYVVGNFCFLRIRTKSSNTALLNREVRDSYTLIIQATEKTLELEALTRVVVHILDQNDLKPLFSPPSYRVTISEDMPLKSPICKVTATDADLGQNAEFYYAFN-------TRSEMFAIHPTSGVVTVAGKLNVTWRGKHELQVLA 223          
BLAST of Ft-2 vs. Ensembl Human
Match: FAT3 (FAT atypical cadherin 3 [Source:HGNC Symbol;Acc:HGNC:23112])

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 758/2899 (26.15%), Postives = 1277/2899 (44.05%), Query Frame = 3
Query: 4935 YSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPS-TGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFAS-YFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPD--LNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSA-LDREERPFVQLLVLAKGWDGSYDYINVTV-----SVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVLN-EYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVS--DYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLG-LNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCS--IMTIQENNPLNHIVAMCRISSTEMKGKW-SLVPSSSPFDVQND-FEIDSNYGYIRAKKIMDFETQSQYRINVEYRV--DNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGV-SFRID-DQGWVYSVSAVDYEETKLINLVVSASD--KAGHVTNTTL-TISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFV--HTSIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPK-SNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKPNIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQ-LAPDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPC-GSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSI---LGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGARNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQI 13517
            Y++ +S D I+++K F I+ + G L        Y+ +  D   EA++K         HIL+        ++ R+Q   Y    RNLA+    ++N  D      +  N L  +  +    +++G+ +  ++A D+D G N +L++ I+  +   N F+++   G I + +           L+I V+D G PP    ++V + +     SH  P+         V+EN  + + +             +   ++  +K      +F +   +G I T  +LD E+      + IQ  +  G+ S      +V I I D NDNAP FL   + +G +SE+A   S+V        L  S   LVI A D D  +N  + Y I+   A  +F +D  TG +     +D E +  F    + ++D GSP+L ++  +E+ I + D ND PP F +  +  +L+LPT+    +L++   DPD  + P + +S++ G    F  ID  +G L I  N++          ++ ++  DGKF ++  +TI       +  L   +S     I EN  ++  + +  A    +  +  +KY +L+   K +I   +G ++      DREE+   +L+V A       D++ V       ++ D ND  P+F+   Y   V  +        +V AID D G NG V Y +     + +   F I+ NSG + ++   + +L   ++ + I A D G+P+LS+  ++ + IV+   P+FDK  Y+  V ED   +  + ++ A S  G  I+Y I +G+  + F++DF          V+++V  LDYE    + L I A+D  +      TV + V D+ND  PIF + +Y+ ++SE   I   ++ +  +     N+K+V +  ++++D+   S+ +F I+ ++G I     LD E        +     G  S ++   + ++I D NDNPP F Q  + + +S  + +G  V    A+D D++   +L Y +L+      F +D  SG I  +     +++ P   +    V V D   +  A V +  +    + P+F  + +   V EN    +++  + A+D D   +G++ Y +I  F  + F +DS  G ++  + LDRE     ++ + V   D G +  F TV + V D NDN P      Y  +V    ++       + Q+ A D D     R+ Y L S     S++  D +   +     W+    N   L NT     V  +   +         +  ++I   I+V      L       P  T S    TI E+  +   V   RI  ++    W S V    P + +   F I+   G I+  K +D ET   +   V   +  D   ++ T  + I ++D ND  P+F+ S Y   I E +P+G+K+ Q +A D D+     + YSL+     E  + +F ID + GW+ ++  +D+E        V ASD  +A  +++T L ++ V D+ND       N PV   E+       S+    VV  LS  D D+      + + IT  N    +A   V    +V +  PLD E+      L   A+D L  ++   ++ + V DVND++PVC Q+    ++ E I    +I  + A D D  +    + Y+L    +     ++P +G +   A LDRE     + +  A D   + C   I + + D+NDN P F   H +   + EN    +++ ++ AVD D GINRK+VY + D +   FSID  +GI+ +   LDRE+Q  +++ + A+D       S++T V I +LD+ND+PP F      + V EDT  G  ++ + A S DIG NAE++Y + +  EQ  F++   +G +++ + LD+EL + ++L V A D G P+LS    V I + DVNDN P+F    Y   I E+ LV    I  + A D DS  N  + +S +         N    N     F ++P  G + +    DRE    Y   V   D GIPA SS   V I+I D NDN P F   ++  +I          QE K  G    + +L + D+D   N  PF   +L+      F++    +    ++         V  L VQ  D+G+P       + V VI  S   P   PL +  V    +   G    I ++   D+   +D+LTF       LKS    + FK++S  G I     LDSG Y LNV V++        + + +  L  +M+++   I+  ++ P  F      L +  F +++  + L                           + S R I  Q +A  + +D+L AV   +   F+K + L+ ++      L  I + S++   N    D   C E  C+  + ++     + +    ++F+   F     C C     G  C    + C  KPC G  +    + ++ P F+C+CP  K G+ C       G++S              + F G  +I + L E       ++    R LQ    +M  + N    I++ I  DGK+    D  + P I L  S   + DG WH+V L +      +++ D ++      L  + LS  S I   +F    L+ A N  S  +  + + +       GC+  VILNN +LP Q   +   S +  V    L  GC   L    C    C++GG C            Y C C   FTGRNCE   + C  +PC +GG C    + F C C  GLTG  C+   +       C    +C+     +++ S +C+C+    G  C +
Sbjct: 1495 YTVHSSIDSISMRK-FRIDPSTGVL--------YTAERLDH--EAQDK---------HILN--------IMVRDQEFPYR---RNLARV---IVNVEDANDHSPYFTNPLYEASVF--ESAALGSAVLQVTALDKDKGENAELIYTIEAGNTG-NMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSH--PKFIHKDYQAEVNENVDIGTSV-------ILISAISQSTLIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSY-QLIIQATNMAGMASN----ATVNIQIVDENDNAPVFLFS-QYSGSLSEAAPINSIV------RSLDNS--PLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHF-HFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEGSLDHFL-IDSNSGVLTIKNNNLS-----KDHYMLIVKVSDGKFYSTSMVTI-MVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNA--VGNRLNEPLKYSILNPGNKFKIKSTSGVIQTTGVPFDREEQELYELVVEASR---ELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTYVLQ--DDYGH---FEINPNSGNVILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPITIVNKAMPVFDKPFYTASVNEDIRMNTPILSINATSPEGQGIIYIIIDGDPFKQFNIDFDTG-------VLKVVSPLDYEVTSAYKLTIRASDALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHY--QIVQDTY-NSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSN-HRKQRMEP---LYSLNVSVSDGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAIINDFAKDRFLIDS-NGQVITTERLDRENPLEGDVSIFVRALDGGGRTTFCTVRVIVVDENDNAPQFMTVEYRASV----RADVGRGHLVTQVQAIDPDDGANSRITYSLYS---EASVSVADLL--EIDPDNGWMVTKGNFNQLKNTVLSFFVKAVDGGI--------PVKHSLIPVYIHVLPPETFL-------PSFTQSQYSFTIAEDTAIGSTVDTLRILPSQ--NVWFSTVNGERPENNKGGIFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDIND-------NAPVFAQEVYRGNVKESDPPGEVVAVLSTWDRDTSDVNRQVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREE-QDIYFLNITATDGLFVTQA--MVEVSVSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIGSN-GYIRYSLYGSGNSEFF-LDPESGELKTLALLDRERIPVYSLMAKATDGGGRFCQSNIHLILEDVNDNPPVFSSDHYNTCVY-ENTATKALLTRVQAVDPDIGINRKVVYSLADSAGGVFSIDSSSGIIILEQPLDREQQSSYNISVRATDQSPGQSLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNEQGKFKINPKTGGISVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVI-LLIAEDVDSQPNGQIHFSIV---------NGDRDNE----FTVDPVLGLVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVI----------QENKPVGT--SILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLDPHGILRSAVVFQHTESLEYV--LCVQAKDSGKPQQVSHTYIRVRVIEESTHKPTAIPLEIFIVTMEDDFPGGV---IGKIHATDQD-MYDVLTF------ALKSE-QKSLFKVNSHDGKIIALGGLDSGKYVLNVSVSDGRFQVPIDVVVHVEQLVHEMLQNTVTIRFENVSPEDFVG----LHMHGFRRTLRNAVLTQ------------------------KQDSLRIISIQPVAGTNQLDMLFAV-EMHSSEFYKPAYLIQKLSNARRHLENIMRISAILEKNCSGLD---CQEQHCEQGLSLDSH-ALMTYSTARISFVCPRFYRNVRCTCN----GGLCPGSNDPCVEKPCPGDMQCVSYEASRRP-FLCQCPPGKLGE-C------SGHTS--------------LSFAGNSYIKYRLSENSKEEDFKLALRLRTLQSNGIIMYTRANPC--IILKI-VDGKLWFQLDCGSGPGI-LGISGRAVNDGSWHSVFLELNRNFTSLSLDDSYVERRRAPLYFQTLSTESSI---YFGA--LVQADNIRSLTDTRVTQVL---SGFQGCLDSVILNNNELPLQNKRS---SFAEVVGLTELKLGC--VLYPDACKRSPCQHGGSCT-----GLPSGGYQCTCLSQFTGRNCESEITACFPNPCRNGGSCDPIGNTFICNCKAGLTGVTCEEDINECEREE-CENGGSCV-----NVFGSFLCNCTPGYVGQYCGL 4135          

HSP 2 Score: 388.652 bits (997), Expect = 8.467e-107
Identity = 540/2004 (26.95%), Postives = 885/2004 (44.16%), Query Frame = 3
Query: 5295 SSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVN-SILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVS-SLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVIL-SRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEI-MIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLS-----EQPKVEINEITGSLKLKSALDRE--ERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDI-VSDKS-PLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISI--SVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHI--VDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVLNEYYNIFKIDQSSGF--IRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGR-LRYHVIGGFDSEIFGLDSLTGALLLKKT-LDRERKSMHELRVVVSDYGNK--HDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSI-MTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLI--DQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVY--DVNDEIPYWTKNPPVDGIEITETCDGCSETFPR--VVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPL-QLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIPDLM-IFEGITPGSVITTLQAYDRDSSAKYNTLTYTLME--CSDPYLLVVEPLTGRVIVNAPLDRE--FSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSI-APFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFS----IDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAI-SDDI---GVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRAS---DKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLV-SKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIP-AFSSKTNVTIEIEDKNDNPPEFAQPSFR 11147
            S IGT +  ++A D+D GR+G++ ++I+ D   L  F +D  +G I     L        +LT+  +D G  P  +   V +E+ D  ++ + P   E     VV EN+  + S++        +       Y + S  P     F +   TG I T S  LDREQ  +     ++V   DG  S   S I V + + D NDN P+F  P K+  I     +       +  GE + ++       A D DEG N +I Y I+       F ID  TG++S   +      GS+  L+I+  D G P+  S  RL I  I     +  P  F++ FY    ++ +     ++ +    P  N  + F I+ G     F  +   G + I+    P+  +  S+  +++   DG       + I   DN  N     E SQ  +++  + + +PD  + + +     +   + Y + S        K  I+  TG L     LD E  ++  + ++V  + +    +   V V+V D ND+ P F +  YE  V  + +  +  ++V A+D D GEN  +IY+I   +       F I+   G+ITI   P    +G +F + IK  D+G P +S+   V + + +SD S P F    Y   V E+      V  + AIS +  T++Y + +G+   +F ++       P   VI     LDYE    + LII AT+  + ++ + TV I ++D ND  P+FL S YS S+SE  PIN  + S+  S L+ + +++     +L + +     + + F ++ +TG I    NLD E      F + V+  G    T  + ++V+I   D NDNPP F Q  F   + L +  G  V+   ATD D+    +L Y ++    + F ID +SG   I+ N +     +L         V V D      + V++      +    F  + +  S+SEN   N+ I ++   ++  N+    L+Y ++   +   F + S +G +       DRE + ++EL V  S   +        V +++ DINDN PV     Y   V +  +  GT    I Q+ A D+D  P   + Y L           ++  +G V LK ++ +  SN+    T        I  +   +P  S     T +   I +  K   ++DK    P  T S+   I+ N P+  I A    +S E +G   ++    PF     F ID + G ++    +D+E  S Y++ +  R  ++   A   + +DL+  D ND PPIFD   Y   +SE   +G+ V+Q  + D D E   ++ Y + Q D+  +   F ID   G + +   +D+E  +   L V + D      ++ + + +Y  DVND       NPPV    I E+    SE  PR   V  + A D DS S  + L + I + N     ++   S+SG + L +    ++ ++PL  L    SD L  S  +  ++IRV+  N ++P   Q   +  + E +  G+ +  ++A D D    Y  ++Y ++     D +L+      G+VI    LDRE      V+  V ALD   +     + + V+D NDNAP+F+     A    +   G ++ ++ A+D D G N +I Y +  E+  S +    ID D G M      ++ +       ++A D G P K ++  V I +L      P F        +AEDT IG  + T++ + S ++    VN E       +   F +E  +G + L K+LD E S  +   V A+   DK    +  T  V I+V+D+NDN P F    Y   I E   V +KLT  +V A D D G N  +TYS          ++ S    +   F I+  TG I      D E  PT+ F V  +D G   + SS   V++ + D NDN P FAQ  +R
Sbjct: 1056 SRIGTSVLQVTARDEDSGRDGEIQYSIR-DGSGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVED--VNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQ--NFFAINIKTGLITTTSRKLDREQQAEHF---LEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQF--PEKVYQIKLPERD------RKKRGEPIYRAF------AFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQF---TAGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFY-NFTVMESDRVTEIVGVVSVQP-ANTPLWFDIVGGNFDSAFDAEKGVGTIVIAK---PLDAEQRSIYNMSVEVTDGTNVAVTQVFIKVLDNNDNGP---EFSQPNYDVTISEDVLPDTEILQIEATDRDEKHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTI---EAGNTGNMFKIEPVLGIITICKEPDMTTMG-QFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQS--TLIYEVKDGDINGIFTIN-------PYSGVITTQKALDYERTSSYQLIIQATN-MAGMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEGSLDHFLIDSNSGVLTIKNNNLSKDHYML--------IVKVSDGKFYSTSMVTIMVKEAMDSGLHFTQSFYSTSISEN---NTNITKVAIVNAVGNRLNEPLKYSILNPGNK--FKIKSTSGVIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEP-GTL---IYQVTAIDKDKGPNGEVTYVLQD---DYGHFEINPNSGNVILKEAFNSDLSNIEYGVT--------ILAKDGGKPSLS-----TSVELPITIVNKAMPVFDK----PFYTASVNEDIRMNTPILSINA----TSPEGQGIIYIIIDGDPF---KQFNIDFDTGVLKVVSPLDYEVTSAYKLTI--RASDALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQ-DTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVND-------NPPVFNQLIYESY--VSELAPRGHFVTCVQASDADS-SDFDRLEYSILSGNDRT--SFLMDSKSGVITLSN--HRKQRMEPLYSLNVSVSDGLFTSTAQ--VHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGD-PGTYGQISYAIINDFAKDRFLI---DSNGQVITTERLDRENPLEGDVSIFVRALDGGGRTTFCTVRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQAIDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKGNFNQLKNTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAEDTAIGSTVDTLRILPSQNVWFSTVNGERPEN--NKGGIFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDK--VDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLT--QVRAIDMDWGANGQVTYSL---------HSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYR 2930          

HSP 3 Score: 317.005 bits (811), Expect = 4.205e-85
Identity = 338/1225 (27.59%), Postives = 554/1225 (45.22%), Query Frame = 3
Query:  225 LSISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTKY--TASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAH----NVHAPKISVKYLSKYFDPDFNDYP-FAEITVTDEDERLNRNRNPYPILIRHHPKSPVN-VFLTPTGE-LNRYVLKLRAIFSPISTP-AISVTIEAKDLSLNPKTSSTHLTIPLGN--LRNINLLSVPEFVSVSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLEGTY-SVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDA--NSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGM-RNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSI--RPETSDKEPQSFVYTISGHSNGISLFRINNEGEIRTVSSI-DREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYF 3815
            L   FT  +YN  +Y++   R YV +   +MGI   +    I Y+I    E    F+AE  ++ DF +LRIRTK   +A LNRE    Y L ++G    +     +    T+V I+VLD ND  P+F    +     E+  + T +  VTATDAD G N E +YY              FS++P SG+I    +L ++   ++   +I A+ RG    +K    +    +  +  H    N HAP I V     +        P +A +TV D D+  N       I+       P++  FL   G+ LN Y +K R      S P   ++T++AKD   +P+  S    + +GN     + +    E   VSI E +     V ++K           + + ++  P  +  Y  +N  S            + A    + ++ +      N   + K   T  IS++D N+  P          V E+  +G +VL + A D D      I+Y +   N LPF + +F   V+   E LD E+    +   V  +D G+P       +  I I +VN+  P F    CQ  IS    YD  +G  I     +D D  + ++  I S + +   F ++P+SG L L  +  +  + K  NF + + A D   ++  M++N SV+    +S+S S R  ++        +  +    +  N   N E+     + + R  P F  + PS + ++E+   G  + KI    AD     +  + +F +        F+I   D  +  + V   +DRE  D Y + I + D G P+   ++   I VED NDN P F+ DS+ +   + E+  I   I+Q++A D D   + ++ Y ++   + F I+S TG + +   LDRE +  Y + I A D     + L +  TL + + D+ND  P F  +SYS+ + EDLP+G+ +  L   D DL    Q+RY++   ++  F  D ++GA+ L  +L    +  Y L    KD G+P +LSS +  ++    V+ N + P   +  +  +++EN   GT V  +  R E S ++ +   Y+I   S G+  F I++E  + T + I DRE   SYWL +Y  DR    +   + EVYI+V D NDN P+     Y   V EN      +I ++A D D +   +L Y+I SG+   +F
Sbjct:   39 LGFHFTHSIYNATVYENSAARTYV-NSQSRMGITLIDLSWDIKYRIVSGDE-EGFFKAEEVIIADFCFLRIRTKGGNSAILNREIQDNYLLIVKGSVRGE-----DLEAWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNGEFYYYFKNKVDL-------FSVHPTSGVISLSGRL-NYDEKNRYDLEILAVDRG----MKLYGNNGVSSTAKLYVHIERINEHAPTIHVVTHVPF---SLEKEPTYAVVTVDDLDDGANGEIESVSIV----AGDPLDQFFLAKEGKWLNEYKIKERKQIDWESFPYGYNLTLQAKDKG-SPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVK------LSPEPIDVEYKLSPGEDAVYFKINPRSGLI---------VTARPLNTVKKEVYKLEVTNKEGDLKAQVT--ISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDKGENGYITYSIASLNLLPFVINQFT-GVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVIS----YDFPVGGHITAVSAIDIDELELVKYKIISGN-ELGFFYLNPDSGVLQLKKSLTNSGI-KNGNFALRITATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQ-----KLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSG---FNGKVLFTISDGNTDSCFNI---DMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSV--NILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGE-IQYSIRDGS-GLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTI-EVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFF 1196          

HSP 4 Score: 303.908 bits (777), Expect = 4.200e-81
Identity = 527/2217 (23.77%), Postives = 919/2217 (41.45%), Query Frame = 3
Query: 5301 IGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNS-ILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILP-TFPSAPLLQLRVHDPD--LNPTILFSILNGKESRFFSIDPTTGWLKIS-TNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEI-PENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPK--VEINEITGSLKLKS-ALDREERP--FVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEF-LVHTNLSKEAQSI-RVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIG------IKANDKGQPALSSFTDVFVDIVSDKSPL-----FDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFS-PTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLV--VIAMATDLDTNSKLIYKV-LNEYYNIFKIDQSSGFIRFNQVPNIEKL----------------LPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILST--KSTGTTLE-SILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIA---FQVCEEPLYSYRI-ATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQ----NDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSAV--DYEETKLINLVVSASDKAGHVTNTTLTI--SVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVS-ESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQ-IPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPY-LLVVEPLTGRVIVNAPLDREFSSTVNFVVHALD-VESKKCSFKILINVLDINDNAPRFVHTSIAPFLENAPH-GSVIGKIHAVDADSGINRKIVYRILDESKSS---FSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKW--NNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIK------DKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGS---LYLGVRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNN---FFKIDSFTGAITTTEMLD 11702
            +G  +  I A D D G NG+++F I +D    + F +D   G ++V   +      L  L I + DLG P + +  ++ + + D   + + P   +    + + E++ + + I+                Y VL+      + F +  STG +     LDRE   +  S+ I+ +       +  S++++K+ + DVND +P F+ P   +  + E    G+++                 +   DPD G  GQ+ Y +++ +   F+ID+ +G + L+ ++D E    F +L++R +DKG P  LS      + +++   +    +  DF +   +   +     +LQ+   D D   +  I +SI +G     FSID  +G +  +   D    G +   V    R     + T   + I   D   N   PL    + + +  EN      ++  +A+   S  +  + Y + S  P+    IN  TG +   S  LDRE++   F+++ V   G       I V V V DEND KP F  + Y+  L   +  K  + I R  A D D G N  + YSI        D KF ID  +G+++ +         K+FT G      IKA D G+P  SS   + ++ +    P      FD+  Y+  V E      IV  V ++      + + I  GN +  FD        + G   I +   LD E +  + + +  TD ++     T V I VLD ND  P F + +Y  ++SE++  + EI+ I    +     +  + S  +       S + FRI+ +TG +   E LD EA   H   I+V+ D  F    N A + V++ D ND+ P F  P + A++   ++ GS V  V A+  D   N++LIY +      N+FKI+   G I   + P++  +                + ++ +V   V + D +H                 P F+  ++   V+EN  + + +  I A          L Y V  G  + IF ++  +G +  +K LD ER S ++L +  ++       ATV I + D NDN PV   + Y  ++  +    S   +L+ S L + A D D +    + Y++V    ++    VDS TGA+                 T + L+   IA   F V      S ++ A + +  +I VT       D     P+ T ++       P    V + ++S+T+     S VP    + +     + F IDSN G +  K   +  ++  Y + V  +V +    +T  + I + +  D    F  S Y+  ISE+    +KV    A        + + YS+     +  G  F+I     V   + V  D EE +L  LVV AS +  H+    + +  ++ D+ND  P +   P    +++    D    T   ++Y+++A D D     E  + L  +      Y +F ++  SG V+L    +++       +  LA D    S    +  + +  VN   PV  +      + E I   + I ++ A   +           ++   DP+    ++  TG + V +PLD E +S     + A D +   +    + + V D+NDN P F   +    L  A   G+ + ++ ++DADS  N+ + Y+I+ ++ +S   F ID  +G++  A +LD E      L + + D G P  S+   V I + DVND+PP F  +  +  V+E    G  +  ++A   D      + Y +++  ++  F ++S SG +TL       +   Y L V  SD  +   ++T  V I+V+  N   P F    YV  + EN       I  V A D D G    ++Y+ +    + ++  ++   +   E   R NP  G++ +             F  ++   G   F +   V + + D+NDN P+F    +R  ++ D                  VGR H+       D D   NS         A      L++ D   D   ++  G+   L   V + +V+  D G P  +  + V ++V+      P       ++     +T IG  ++  R+L     P+ ++  F  V  E    R  NN    F I+  TG I   + LD
Sbjct:  741 VGANILKIKAYDADSGFNGKVLFTI-SDGNTDSCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDA--NDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLT----DTQQFAINSSTGIVYVADQLDRESKANY-SLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFI-PSSYSVKVLEDLPVGTVIAW---------------LETHDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDYEK-QQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYST-IEVYIEVEDVNDNA--PLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGND---DGKFFIDPKTGMVSSR---------KQFTAGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVV-SVQPANTPLWFDIVGGNFDSAFDA-------EKGVGTIVIAKPLDAEQRSIYNMSVEVTDGTNVAV--TQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQI----EATDRDEKHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVR-DQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSH-----------------PKFIHKDYQAEVNENVDIGTSVILISAISQST-----LIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSYQLIIQATNMAGMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVES-TAKKFFTVDSSTGAI----------------RTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVT-------DVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPD---SEVPPELTYSLMEGSLDHFLIDSNSGVLTIKN--NNLSKDHYMLIV--KVSDGKFYSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNAVGNRL--NEPLKYSI-----LNPGNKFKIKSTSGVIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQV----DAEPGT---LIYQVTAIDKDKGPNGEVTYVLQDD------YGHFEINPNSGNVILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSV-ELPITIVNKAMPVFDKPFYTASVNEDIRMNTPILSINATSPEGQG-----IIYIIIDGDPFKQFNIDFDTGVLKVVSPLDYEVTSAYKLTIRASDALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSNHRKQRMEPLYSLNVSVSDGLF---TSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVI-HVRATDGDPGTYGQISYAIINDFAKDRFLIDSNGQVITTERLDRENPLEGDVSI-------------FVRALDGGGRTTFCT---VRVIVVDENDNAPQFMTVEYRASVRAD------------------VGRGHLVTQVQAIDPDDGANSRITYSLYSEASVSVADLLEIDP--DNGWMVTKGNFNQLKNTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFT-IAEDTAIGSTVDTLRIL-----PSQNVW-FSTVNGE----RPENNKGGIFVIEQETGTIKLDKRLD 2772          

HSP 5 Score: 247.284 bits (630), Expect = 5.570e-64
Identity = 380/1574 (24.14%), Postives = 658/1574 (41.80%), Query Frame = 3
Query: 6708 LSEQPKVEINEITGSLKLKSALDREERPFVQL----LVLAKG------WDGSYDYINVTVSVTDENDYKPMF-LSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDI--VSDKSPLFDKSKYSVIVPEDALKDFIVTTVKA----ISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSS---LSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGR---FSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLN-EYYNIFKIDQSSGFIRFNQVPNIEKL--------------LPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGAL-LLKKTLDRERKSMHELRVVVSDYG--NKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSP--FDV-----QNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLY-QLDSVETGVSFRID-DQGWVYSVSAVDYE--ETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDV-------------------NDHAPVCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPFL-ENAPHGSVIGK-------IHAVDADSGINRKIVYRILDE-SKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKP--PKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQ-NFFRLESLSGNLTLIKKLDFELSRE-YFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPE-NTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVP-DREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVD 11165
            L++   + I+ + G +  KS   RE R   +L    L+ AK        DG  D+ ++       N   P F  S   +  V  +L   A  +++KA D D+G NG V+++I        D  F ID  +G + +     +E     + + I   D G P  SS+  + +++   +D SP+F +  YSV + E +     +  V+A    + S G      +T   D + F ++ +         ++ +  +LD E+K  ++L I A D + S   L    T+ + + D+ND  P F+ SSYS  V E++P+   I  +      +     V +S  L+ D     +  F I+  +G I + + LD+E    +   +  K  GR    S  +   ++V  V+EN + P F   A   ++   S  G+ V+   A D D+  + ++ Y + +      F ID  SG I    + + E +              +P    +E  + V D               + ++ P      ++  V EN   +  + +I A D D +   +L Y +  G     F ++  TG +    + LDRE+++ H L V V+D G   K     V++ V D NDN P   +  Y++   L  +      E I +  A DRD  P   + Y +V         F+D  TG VS +  +           T    ++  I       P  S              T +++I + KK      +   +T  E  P  +   M     TE+ G  S+ P+++P  FD+      + F+ +   G I   K +D E +S Y ++VE  V +   +A   + I ++D ND  P F    Y + ISED+   ++++Q +A D+D + K  + Y+++  +DS+     FRID   G +Y+   +D+E  +  ++N++V   +         + ++V D ND  PY+T NP      + E     S      V +++A D D     E ++ +                 +G +  + P+        L +  +  +    +  +F+L+I+V D                    N H     +     + E +  G+ +  + A  +      +TL Y + +     +  + P +G +     LD E +S+   ++ A ++     +  + I ++D NDNAP F+ +  +  L E AP  S++         I A DADS  N  +VY+I++  +K  F++D  TG +R  + LD E     H  +   D G P     +   V I + DVND+PP F     +  +   T +G  ++ + A   D  V  E++Y ++    + F ++S SG LT+       LS++ Y L V+ SD  + S S  T ++++    +       F  Y  +I E NT ++K+ I         + LN  L YS L   P  K             F+I   +G I    VP DREEQ  Y+  V  +        ++  V + IED NDN P F    +   +QVD
Sbjct:  661 LADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSI-------NRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTI---SDGNTDSCFNIDMETGQLKVLMPMDREHT-DLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLT---DTQQFAINSSTG-------IVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYS--LVND----YNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVED---------------VNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIK--LPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKF-FIDPKTGMVSSRKQF-----------TAGSYDILTIKAVDNGRPQKSS-------------TARLHIEWIKKPP---PSPIPLTFDE--PFYNFTVMESDRVTEIVGVVSVQPANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVE--VTDGTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRDEKHK--LSYTVHSSIDSISMR-KFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFT-NP------LYEASVFESAALGSAVLQVTALDKDKGENAELIYTI-------------EAGNTGNMFKIEPV--------LGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQ------STLIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSYQLIIQATNMAGMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEGSLDHFLIDSNSGVLTIKNN---NLSKDHYMLIVKVSDGKFYSTSMVT-IMVKEAMDSGLHFTQSF--YSTSISENNTNITKVAIVNAVG----NRLNEPLKYSILN--PGNK-------------FKIKSTSGVIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVD 2096          

HSP 6 Score: 241.506 bits (615), Expect = 2.626e-62
Identity = 450/1875 (24.00%), Postives = 771/1875 (41.12%), Query Frame = 3
Query: 5865 VKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERL----EIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTI-LFSILNGKESRFFSIDPTTGWL---KISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSF-DNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKV--EINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPAL-SSFTDVFVDI--VSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS-STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYE--TKPFHTLIISATDPSSSLSHSTTVLITVL--------------------------------------------DINDELPIFLKSSYS-ASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLV--VIAMATDLDTNSKLIYKVLNEYYNIFKIDQSSGFI----------RFNQVPNIE-KLLPSSG-----VVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYY-EVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVN--PIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYI-RAKKIMDFETQSQYRINVEYRVDN-SPLMATRTILIDLIDQNDCPPIFDNSRYAIFISE--DIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQ----------KESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP--DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSST--VNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSI-APFLENAPHGSVIGKIHAVDADSGINRKIVYRI-LDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPE----NTLVSKLTIGK--VTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKT--NVTIEIEDKNDNPPEFAQPSFRFLI 11156
            V I + D+ND  P F  P   +  I+ES               L  S+    + A D D G NG+  Y   ++    F +   +GV+SL+ +++ +    + DL I   D+G  KL     +    ++ + IE  N+  P      ++    L   P+  ++ +   D   N  I   SI+ G     F +     WL   KI          FP    + ++A D      C+     +  N     +P+   + V+++  +    P +V+   K   S +   ++Y L   +  V  +IN  +G +     L+  ++   +L V  K  D       VT+S+ D ND+ P F    Y+  V+ ++      + V A D D GENG + YSI  +      L F I+  +GVI+       E   + +   ++A+D G P    S  +V + I  V+D SPLF+K     ++  D      +T V AI       + Y I +GN+   F       YL P   V++L   L           L I+ATD   +L+   ++ I+VL                                             IN + P F KS  S  +V E++P+   I+ I         +  V F++     S   +   F I+  TG + +   +D E   ++   I +   G    ++   + +++ D NDN P FIQ +++  I   S  G+ +  V A   DL +N ++ Y VL +    F I+ S+G +          + N    IE +    SG     VV  +V + D               + +  P+F+ + + + V E+  V + I  +   D D    G++RY ++  ++   F +D  +GA+ L K LD E++  + L V   D G     ++V     ++ D    +   Y+ +  V+ S K       S+LQ+ A+D D      + Y +         + +D  +G ++   + I     +G       L VY     V   PLYS          +I V +++  + D   +   PI    +M   EN+P +  V   +    +      L    +  + QN F I+   G I    + +D E Q+++ + V       SP  +T  +++ ++D+ND  P F    Y I + E      G  + +  A+D+D      I YS+  +D  + G  F ID +  + S S   +       L + A D      ++T  + +         W K PP   I +         TF    Y  +  ++D  ++             L F I   N +   A+      G +++  PLDAE+      +    +D  + +  +    I+V+D ND+ P   Q P  D+ I E + P + I  ++A DRD   K +   ++ ++        ++P TG +     LD E      +N +V   +   ++   ++++NV D ND++P F +    A   E+A  GS + ++ A+D D G N +++Y I    + + F I+   GI+ +    D     +  L I+ +D G PP S    V+I +   ++S P+FI+   +  V E+ +IG  +I I AIS    +  EV    I     F +   SG +T  K LD+E +  Y L ++A++     +++   V IQ+VD NDN P F F  Y  ++ E    N++V  L      + A D+DS  N++L Y  +           ST    + FF ++  TG I      D E    + F V V D G P  ++++   V IE+ D NDNPP F Q  F  ++
Sbjct:  144 VNIQVLDMNDLRPLF-SPTTYSVTIAEST-------------PLRTSVAQ--VTATDADIGSNGEFYYYFKNK-VDLFSVHPTSGVISLSGRLNYDEKNRY-DLEILAVDRGM-KLYGNNGVSSTAKLYVHIERINEHAPTIHVVTHVP-FSLEKEPTYAVVTVDDLDDGANGEIESVSIVAGDPLDQFFLAKEGKWLNEYKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVKL--SPEPIDVEYKLSPGEDAVYFKINPRSGLIVTARPLNTVKKEVYKLEVTNKEGDLK---AQVTISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDKGENGYITYSIASLNL----LPFVINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAVSAIDIDELELVKYKIISGNELGFF-------YLNPDSGVLQLKKSLTNSGIKNGNFALRITATD-GENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTI-----SDGNTDSCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQ-FAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDD---------------VNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLVNDYNGR-FEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFS-IDDESGVIT--AADILDRETMG----SYWLTVYATDRGVV--PLYS----------TIEVYIEVEDVNDNAPLTSEPIYYPVVM---ENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSI--VDGNDDG-KFFIDPKTGMVS-SRKQFTAGSYDILTIKAVDNGRPQKSSTARLHI--------EWIKKPPPSPIPL---------TFDEPFYNFTVMESDRVTEIVGVVSVQPANTPLWFDIVGGNFDS--AFDAEKGVGTIVIAKPLDAEQ-RSIYNMSVEVTDGTNVAVTQVF--IKVLDNNDNGPEFSQ-PNYDVTISEDVLPDTEILQIEATDRDEKHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQSTLI-YEVKDGDI--NGIFTINPYSGVITTQKALDYERTSSYQLIIQATNMA--GMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIV----------ESTA---KKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETIL 1892          

HSP 7 Score: 142.124 bits (357), Expect = 2.566e-32
Identity = 243/955 (25.45%), Postives = 394/955 (41.26%), Query Frame = 3
Query: 9042 IRAKKIMDFET-QSQYRINVEYRVDNSP--LMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWS-----KEEFILNIRVIDVNDHAPVCPQIPDLMIFEGITP-GSVITTLQAYDRDSS--AKY-----NTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSST----------VNFVVHALDVESK-----------KCSFKILINV------------LD---INDNAPRFVHT--SIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILD-ESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAY----DSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPA---FSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLY----LGVRTLWVQVTDNGQPSLYCRVQVAVNVIRLS-NIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNN----NFFKIDSFTGAITTT 11690
            I+ +K +D+E+    Y + ++ +   SP    A + + I    ++  P  F+   Y + ISE  P G  V   K   +  + +       Y+L   E  V F+I+ + G + +   ++  + ++  L V+  +K G +    +TIS+ D ND  P + + P  D         G S      V  +SA D D + +   + + I + NL PF        +G +     LD E   +  +    ASD   W      + E  + IR+ +VND++P+  ++    +     P G  IT + A D D     KY     N L +  +      L + + LT   I N       ++T          +N  V    V SK           K + K+LI              LD   IN   P F  +  S     E+ P G+ I KI A DADSG N K+++ I D  + S F+ID +TG ++V   +DRE    + L I   D G P KS+   + I + D ND+ P FI     + + E + IG  +I ++A   D+G N EV+Y ++T+   F + S +G + +  +LD E    Y L + A DK        + V ++V   + N     F+P  +++    ++  L +G V A+    D D GL   + YS +       +N R         F I+  +G I L+   D E+Q  Y   V   D G P      S   V +   ++N + P F  P F  +  V  +  I    L+      + GR      DG       Q  + +   +  F      + DE  ++ A  +     +G   L V  TD G   LY  ++V + V  ++ N P   EP+    V  +S     K++ + ++   D   +          NE L  R+ +    NFF I+  TG ITTT
Sbjct:  326 IKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVKLSPEPIDVE-------YKLSPGEDAVYFKINPRSGLIVTARPLNTVKKEVYKLEVT--NKEGDL-KAQVTISIEDANDHTPEF-QQPLYDAYVNESVPVGTS------VLTVSASDKD-KGENGYITYSIASLNLLPFVIN---QFTGVISTTEELDFESSPEIYRFIVRASD---WGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAVSAIDIDELELVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSV---KVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLV-----NDYNGR---------FEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYF--PDFAVVGSVKENSRIGTSVLQVTARDEDSGR------DG-----EIQYSIRDGSGLGRF-----SIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSP----KDVSVIQIQAEDPDSS---------SNEKLTYRITSGNPQNFFAINIKTGLITTT 1208          

HSP 8 Score: 129.413 bits (324), Expect = 1.789e-28
Identity = 234/936 (25.00%), Postives = 386/936 (41.24%), Query Frame = 3
Query: 5400 YFEMDQNNGDIRVQRSLTAIRNRLLFLTIV--VSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQS--DGEKLSKSLKALVINAE------DPDEG-------------KNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDE-------NDCPPKFEKDFYLQVLILPTFP-SAPLLQLRVHDPD--LNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFD-GKFETSCN--ITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDGS----YDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKK---FTIGIKANDKGQPA-----LSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAI---SSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHST-TVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTI-SIKENLDFEACMIHEFWILVKYDGRFSPTNRA-HMQVHIVDENDNPPKFIQPAFNATISL--ESSQGSLVVIAMATDLDT--NSKLIYKVLNEYYN-IFKIDQSSGFI 8030
            YF+++  +G I   R L  ++  +  L +     DL       ++ V + I D    H+ P+ ++   D  V+E+  V +    L + +S K      Y+  SI       F + + TG I T   LD E   +I    ++   + G   R+ S ++V I I +VNDN+P F   +   G+IS     G  +   S  D ++L      ++   E      +PD G             KNG     I +             +  L  K+  +   SF     R+  K + KLL + +    + +ED        N   P F+K F   V +    P  A +L+++ +D D   N  +LF+I +G     F+ID  TG LK+    +P+  +   + L+NI  +D G  + S    +TIN  D   N  + ++ S  V  I E+     +++   A+      +  + Y +L++  +  IN  TG + +   LDRE +    L + A+    S    +  + + V + D ND  P F+   Y   V  +L        ++  D D G  G V YS+       Y+ +F ID  SG I +    SKEL  +K   + + ++A DKG+P           +V     +  +P F        V E++     V  V A    S     I Y+I +G+    F +D  +        VI     LD ET   + L + ATD      +ST  V I V D+ND  P+  +  Y   V EN P +  +I I       S+++ + + +     +S      F IN  TG I +    LD E    H   + V  DG  SP      + V ++DENDN P+F +  +   +       +G  +  A A D D   N+++ Y +++   +  F ID  +G +
Sbjct:  419 YFKINPRSGLIVTARPLNTVKKEVYKLEVTNKEGDL-------KAQVTISIEDAN-DHT-PEFQQPLYDAYVNESVPVGT--SVLTVSASDKDKGENGYITYSIASLNLLPFVINQFTGVISTTEELDFESSPEIYRFIVRASDW-GSPYRHESEVNVTIRIGNVNDNSPLF-EKVACQGVISYDFPVGGHITAVSAIDIDELELVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSK---SFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETGQLKVL---MPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSV-NILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLVN----DYNGRFEIDKASGAIRL----SKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESG-------VITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRI-----TSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVT-DGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMV 1313          

HSP 9 Score: 123.635 bits (309), Expect = 1.091e-26
Identity = 187/758 (24.67%), Postives = 317/758 (41.82%), Query Frame = 3
Query: 1575 LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDI-SRTKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTD---SGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADS---KDIQYRLV--NFRRVFKIHSRTGWLRLRV-NLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPED--LPIGSFLVQLHATDADLDDNSQLRYAI-HGIHSDCFHCDTSTGAVHLLCKLSPLTEYRLIAVVKDNGKPQALSSQADFQI-YPQKVHPNRYIPSLKEPIITAAIRENCLPGTLV--TSIRPETSDKEPQSFVYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIIS 3794
            L I+V+D N+  PV + +   + + E++ IG  ++ ++A D D+ S  +++Y +    +  F +      +V V + LD E+ +  + +++   D   SG  +   V    ++ + DVN+  P F+  +  + +      DL +G  IA  E  D D     Q+  + V+     F I   SG + L     +    K   + + ++A D G                      RP+ L  V            +            + P F     P FA     V  ++E S  GT V ++T +  D  RD    E  + +        FSI   D  S  I  AD LDRET+  Y +T+   D+G           I+VED+NDN P   +    P+ + EN      ++QI+A D DS   + + YR+   N +  F I+ +TG +      LDRE++  + + +  +D     +  T    +   V D NDNKP F +  Y + LPE      G  + +  A D D   N+++ Y+I  G     F  D  TG V    + +  +   L     DNG+PQ  SS A   I + +K  P+    +  EP     + E+     +V   S++P  +        + I G +   +       G I     +D E+   Y + + + D      N  + +V+IKV D NDN P   +  Y  +++E++     ++ ++ATD D  +K +L Y + S
Sbjct:  817 LTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQ-QFAINS-STGIVYVADQLDRES-KANYSLKIEARDKAESGQQLFSVVT--LKVFLDDVNDCSPAFIPSSYSVKVLE----DLPVGTVIAWLETHDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDY---EKQQFYNLTVRAKDKG----------------------RPVSLSSVSFVEVEVVDVNENL-----------HTPYF-----PDFAV----VGSVKENSRIGTSVLQVTARDEDSGRD---GEIQYSIRDGSGLGRFSI---DDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVM-ENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQ--VLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFTAGSYDILTIKAVDNGRPQK-SSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVSVQPANT-----PLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTDGT----NVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRD--EKHKLSYTVHS 1499          

HSP 10 Score: 120.553 bits (301), Expect = 8.845e-26
Identity = 200/885 (22.60%), Postives = 341/885 (38.53%), Query Frame = 3
Query: 1575 LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISR-TKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSF---QIPMTLPENYDIKKRIVQIKATDADSKDIQYRLVNFRR-------VFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHS-----DCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRP---ETSDKEPQSFVYTISGHSNG-ISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKII-SGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKN--TNILIGRVTAVDIDYDLNATVRYTM 4154
            + I + DVN+ PPV         V E    G  V  +QA D D S   ++ Y +   N     L + K  V+ +  N   + M+  + + V V+D       +  A   I +   N Y P F   T    +        K+ H  A D D      I  +I +  F +  F I      ++     +   L    + +I ++A D G  ++   +   VVD N                                               N P F T +     +R +  +G +V ++  +  D D D   S   + ++SE    V  +   D  +  +V     ++         +   D G P         I V      P  FL SF   Q   T+ E+  I   +  ++     S+++ +  VN  R       +F I   TG ++L   LDRE    +   + A+ +      +  T  + I V D+NDNKP+F  +SY   + E +P+G+ L Q+ A D D   N Q+ Y++H         + F+ D++TG +  L  L   T+  +    V  D G+  +LSS A   +    ++ N   P   + +    ++E+  PG +V  +     +TSD   Q   +   G+  G  +L  + +E ++     +DRE+++ Y+L I   D     +    A V + V+D NDN P+ ++  Y A + E++     ++ V A DAD+     ++Y +  SG++  +    S    + +    +R P+         Y L    +D G                        +NDN  VF    S++  N    +N  T  L+ RV AVD D  +N  V Y++
Sbjct: 2380 VHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLS-NHRKQRMEPLYSLNVSVSDG----LFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAIIN-DFAKDRFLIDSNGQVITTERLDRENPLEG--DVSIFVRALDGGGRTTFCTVRVIVVDEND----------------------------------------------NAPQFMT-VEYRASVRADVGRGHLVTQV--QAIDPD-DGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKGNFNQLKNTVLSFFVKAVDGGIPVKHSLIPVYIHVLP----PETFLPSFTQSQYSFTIAEDTAIGSTVDTLRILP--SQNVWFSTVNGERPENNKGGIFVIEQETGTIKLDKRLDRETSPAFHFKVAAT-IPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNA--PVFAQEVYRGNVKESDPPGEVVAVLSTWDRDTSDVNRQVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDIYFLNITATDG----LFVTQAMVEVSVSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIGSNGYIRYSLYGSGNSEFFLDPESGELKTLALLDRERIPV---------YSLMAKATDGG----------GRFCQSNIHLILEDVNDNPPVF----SSDHYNTCVYENTATKALLTRVQAVDPDIGINRKVVYSL 3170          

HSP 11 Score: 116.316 bits (290), Expect = 1.942e-24
Identity = 148/605 (24.46%), Postives = 270/605 (44.63%), Query Frame = 3
Query: 2382 NIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEE-QMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRF-EIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKAT-DADSKDIQYRLV------NFRRVFKIH-SRTGW-LRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSD-KEPQSFVYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTM 4154
            N P+F T+    I I E    GT + ++  +  D D      +  + + S+ + + V      DS++  I     LD ET   +  ++   D G+  +        ++V DINDN P F    ++     +  D    +V + +T D D+ D+  ++       N R  F +   ++ W + ++  LDRE++D Y + I A+D  F  +++   +     V+D+NDN P+  + +Y+  LPED+P    ++++ A DAD+  N  +RY+++G  +  F  D  +G +  L  L    +  Y L+A   D G       Q++  +  + V+ N   P          + EN     L+T ++    D    +  VY+++  + G+     ++ G I     +DRE++ SY + +   D++       L  V I V D NDN P+ ER  Y  +V E+      ++ V AT  D+    E+ Y I SG+  G F I+      +    +D E  K       FY L V   D G P       +++N+ D        +NDN   F++ + + +I+   L   ++++  + A D+D   N  + +++
Sbjct: 2810 NKPVFETSSYDTI-IMEGMPVGTKLTQV--RAIDMDWGA-NGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQ--EVYRGNVKESDPPGEVVAVLSTWDRDTSDVNRQVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDIYFLNITATDGLFVTQAMVEVS-----VSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIGSNGYIRYSLYGSGNSEFFLDPESGELKTLALLDRERIPVYSLMAKATDGG---GRFCQSNIHLILEDVNDNP--PVFSSDHYNTCVYENTATKALLTRVQAVDPDIGINRKVVYSLADSAGGV-FSIDSSSGIIILEQPLDREQQSSYNISVRATDQSPGQSLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNEQGKFKINPKTGGISVSEVLDYELCKR------FY-LVVEAKDGGTPALSAVATVNINLTD--------VNDNPPKFSQDVYSAVISEDALVGDSVIL--LIAEDVDSQPNGQIHFSI 3380          

HSP 12 Score: 115.931 bits (289), Expect = 2.077e-24
Identity = 121/420 (28.81%), Postives = 190/420 (45.24%), Query Frame = 3
Query: 2592 VADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVE----DINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKD---IQYRLV----NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI-HGIHSDCFHCDTSTGAV----HLLCKLSPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGIS--LFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLIT-VKATDADMNKKTELKYKIIS 3794
            V   LD E    Y +TI   D          R E+ V+    D+NDNPP F D      TL E   I   ++Q+ + DADS++   + Y++V    N    F I S +G +     LD E   +  + + + D  F   SL++   + I ++D+NDN P+F +  Y   + E  P G F+  + A+DAD  D  +L Y+I  G     F  D+ +G +    H   ++ PL  Y L   V D       +S A  Q++ + +  N Y P+  +    A +REN   GT V  +R   +D +P ++        N  +   F I++ G++ T   +DRE      + I++    D         V + V DENDN P      Y+ASV  ++ G  HL+T V+A D D    + + Y + S
Sbjct: 2242 VVSPLDYEVTSAYKLTIRASDA-----LTGARAEVTVDLLVNDVNDNPPIF-DQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGF--PSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSNHRKQRMEPL--YSLNVSVSDG----LFTSTA--QVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVR--ATDGDPGTYGQISYAIINDFAKDRFLIDSNGQVITTERLDRENPLEGDVSIFVRAL-DGGGRTTFCTVRVIVVDENDNAPQFMTVEYRASVRADV-GRGHLVTQVQAIDPDDGANSRITYSLYS 2641          

HSP 13 Score: 104.375 bits (259), Expect = 7.219e-21
Identity = 110/432 (25.46%), Postives = 199/432 (46.06%), Query Frame = 3
Query: 2358 NKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSK---DIQYRLVNFRR--VFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDAD------------LDDNSQLRYAI--HGIHSDCFHCDTSTGAVHLLCKLSPLTEYRLIAVVKDNGKPQALS-SQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRIN-NEGEIRTVSSIDREKEESYWLYIYIED 3590
            N P+F  R+          ++ + E+++ GT V  +   + D   +   +E  + + S  EQ  F I   +  +  I V++ LD E   ++++ +   D G P         I + D+NDNPP+F         + E+  +   ++ + A D DS+    I + +VN  R   F +    G ++++  LDRE+   Y +++ A  VD    ++++TAT+ I ++D+NDN P+FT  +Y+  + E+ P+G+ ++QL  TD D            L  N +  + +  HGI               ++ + +   EY L    KD+GKPQ +S +    ++  +  H    IP L+  I+T    E+  PG ++  I     D      V T +  S   SLF++N ++G+I  +  +D  K   Y L + + D
Sbjct: 3232 NPPVFERRDY---------LVTVPEDTSPGTQVLAVFATSKDIGTN---AEITYLIRSGNEQGKFKI---NPKTGGISVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDV-YSAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVLGLVKVKKKLDRERVSGYSLLVQA--VDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLDPHGILRSA-----------VVFQHTESLEYVLCVQAKDSGKPQQVSHTYIRVRVIEESTHKPTAIP-LEIFIVTM---EDDFPGGVIGKIHATDQDMYD---VLTFALKSEQKSLFKVNSHDGKIIALGGLDSGK---YVLNVSVSD 3624          

HSP 14 Score: 97.8265 bits (242), Expect = 7.033e-19
Identity = 128/484 (26.45%), Postives = 222/484 (45.87%), Query Frame = 3
Query: 2382 NIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPY-ESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVD-KYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKR--IVQIKATDADSKDIQYRLVN---FRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGI---HSDCFHCDTSTGAVHLLCKLS-PLTEYRLIAVVK-DNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEP-QSFVYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIIS 3794
            N P+F   +P    ++ ++  GT++ ++T    DKD+ P  E  +V     +++   F I   + +S ++++ +  + +  + +Y +TI   D G+P   +    E+ +  +N   P F   F    T   N DI+    I+ I AT  + + I Y +++   F++ F I   TG L++   LD E    Y + I ASD     R+      L   V D+NDN PIF + +Y+  L E   IG+ ++Q+ + DAD ++N  + Y I       +D FH D+S+G +     L   L ++  + V   D+G P +LSS+    IY   V+ N   P   + I  + + E    G  VT ++   +D        Y+I   ++  S    +  G I   +   +  E  Y L + + D     +    A+V+I+V   N   P   ++ Y A V EN+     +I V+ATD D     ++ Y II+
Sbjct: 2080 NSPVFV-GLPYYAAVQVDAEPGTLIYQVT--AIDKDKGPNGEVTYVL----QDDYGHFEI---NPNSGNVILKEAFNSDLSNIEYGVTILAKDGGKPS--LSTSVELPITIVNKAMPVFDKPF---YTASVNEDIRMNTPILSINATSPEGQGIIYIIIDGDPFKQ-FNIDFDTGVLKVVSPLDYEVTSAYKLTIRASDALTGARAEVTVDLL---VNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFP-SLSSEVLVHIYISDVNDNP--PVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSNHRKQRMEPLYSLNVSVSDG----LFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAIIN 2537          

HSP 15 Score: 93.2041 bits (230), Expect = 1.596e-17
Identity = 214/938 (22.81%), Postives = 364/938 (38.81%), Query Frame = 3
Query: 1527 IAVAMNDSLETKKT-FTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTKISYYLFDQ---NKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAP-IARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFI----AEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRL-----VNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSD-----CFHCDTSTGAVHLLCKL----SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNG-----ISLFRIN-NEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAEN---LQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXX--DREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHL 4229
            + +  +D+L   +   T+ + V DVN+ PP+        T+ E + IG  VL + + D D    K+ +Y   Q   N   +   +    +++    LD E +Q    ++V   DSG P ++  V+ H  I I+DVN+  P F     +  +S  AP     GHF+    A D D    D ++ SI S +  +  F +  +SG ++L    K  M      +++ +  +D GL +S   ++  V+ AN  S                                              P F+ +   V  +RE  A GT V  I ++  D D   Y  +  + + ++  +  F I   DS+   ++  +RLDRE   +  ++I V          F    + V D NDN P+F+ + +   ++  +      + Q++A D D   +  I Y L     V+   + +I    GW+  + N ++ K       + A  VD       +   + I V       P FT++ YS  + ED  IGS +  L      L   +     ++G   +      F  +  TG + L  +L    SP   +++ A +  +      +   D ++    +  N   P  +       I E    GT +T +R    D      V T S HS+      +  F I+ N G I T+  +D E + ++   +   D  +       A V ++VTD NDN P+  +  Y+ +V E+    + +  L T     +D+N+  ++ Y I  G+  G F++               DRE         D Y L +  +D     Q                  S +NDN  V ++   T L+      N  IL  +V+A D D   N  +RY+        L  S    F +D +SG L
Sbjct: 2256 LTIRASDALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQ-HCTLKVRSIDSGFPSLSSEVLVH--IYISDVNDNPPVFNQLIYESYVSELAPR----GHFVTCVQASDADSSDFDRLEYSILSGN-DRTSFLMDSKSGVITLSNHRKQRMEPL---YSLNVSVSD-GLFTSTAQVHIRVLGANLYS----------------------------------------------PAFSQST-YVAEVRENVAAGTKV--IHVRATDGDPGTY-GQISYAIINDFAKDRFLI---DSN-GQVITTERLDRENPLEGDVSIFVRALDGGGRTTFCTVRVIVVDENDNAPQFM-TVEYRASVRADVGRGHLVTQVQAIDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKGNFNQLKNTVLSFFVKA--VDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAEDTAIGSTVDTLRI----LPSQNVWFSTVNGERPENNKGGIFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDVDIKV----LDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQV-TYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESDPPGEVVAVLSTWDRDTSDVNR--QVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREE-------QDIYFLNITATDGLFVTQAMVEVSV-----------SDVNDNSPVCDQVAYTALLPEDIPSNKIIL--KVSAKDADIGSNGYIRYS--------LYGSGNSEFFLDPESGEL 3085          

HSP 16 Score: 88.9669 bits (219), Expect = 2.891e-16
Identity = 139/568 (24.47%), Postives = 241/568 (42.43%), Query Frame = 3
Query: 6840 YINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQP-----ALSSFTDVFVDI--VSDKSPL----------FDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPF-HTLIISATDPSSSLSHSTTVLITVLD-INDELPI-FLKSSYSASVSENMPINHEIISISVLLQKVSNSKI-VEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHD----FTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRE--RKSMHELRVVVSDYGNKHDFATVLIHV 8456
            +  V + V D ND +P+F    Y   +  +        +V A D D G NG      YY      DL F++   SGVI++ SG        ++ + I A D+G        +SS   ++V I  +++ +P            +K     +V  D L D     ++++S         I  G+  + F L     +L      I+   ++D+E+ P+ + L + A D  S    S    + + +   D +PI F K  Y  S+SE  P       + V + K+S   I VE+ L   ED+      +F+IN  +G I     L+     +++  +  K +G      +A + + I D ND+ P+F QP ++A ++     G+ V+   A+D D   N  + Y + +     F I+Q +G I   +  + E    S  +  F V   D    + H    NV++   ++ ++ P F        +S +F V   I  + A D D+ +   ++Y +I G +   F L+  +G L LKK+L     +     LR+  +D  N  D  ++ I V
Sbjct:  141 WTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNG----EFYYYFKNKVDL-FSVHPTSGVISL-SGRLNYDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIHVVTHVPFSLEKEPTYAVVTVDDLDDGANGEIESVS---------IVAGDPLDQFFLAKEGKWLN--EYKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSP-----PGVVVAIVKLSPEPIDVEYKLSPGEDAV-----YFKINPRSGLIVTARPLNTVKKEVYKLEVTNK-EGDL----KAQVTISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDKGENGYITYSIASLNLLPFVINQFTGVISTTEELDFES---SPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAVSAIDIDELEL--VKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGENLADPMSINISV 671          

HSP 17 Score: 82.8037 bits (203), Expect = 2.504e-14
Identity = 103/457 (22.54%), Postives = 200/457 (43.76%), Query Frame = 3
Query: 5112 LDTNNMYPEFLVSREQSNMYME--TLRNLAKSQSSVLNEMDKLSIQRHLDNSLIF---SFTW-IDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFA-SYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPD--LNPTILFSILNGKESRFFSIDPTTGWLKIST 6455
            ++T  +     + RE +++Y+   T+ +L   Q S    +  ++++   DNS +F   S++  I   S IGT +  + A D+D G NG++ +++  D+     F ++ + G + V   L         L I   D  +  +   SVV +++    ++   P    S   + V E+  V +++    L +    L     V  S+       F + +++G I     LD E+ Q   ++ ++ +     VS  +        +    +    +     + G + E++  G+ V               L + A D D G++G+I+Y I        F ID  +GV++ A  +DRE +GS+  L++   D+G   L S   +E+ I +ED ND  P   +  Y  V++  +     ++Q++  DPD   N  + + I +G    FF+I+  TG +  ++
Sbjct:  778 METGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLL-TINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDT---QQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAW--LETHDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDYEK-QQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSV---------------LQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETMGSYW-LTVYATDRGVVPLYST--IEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTS 1209          

HSP 18 Score: 78.9518 bits (193), Expect = 3.867e-13
Identity = 72/233 (30.90%), Postives = 112/233 (48.07%), Query Frame = 3
Query: 1572 TLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDI-SRTKISYYLFDQNKLPFRLGEFKRN----VVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGL--VSSKMALNFSVVDANSRS 2249
            T+ I+V D+N+ PPV      ++TV E+T  G  VL + A   DI +  +I+Y +   N+     G+FK N     + V E LD E + +RF++ V   D G P A S +A   I + DVN+  P+F        IS  A     +   IAED+D      I  SI +       F++ P    L L+   K     +++ +++ +QA DSG+  +SS   +N  + D N  S
Sbjct: 3221 TVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNE----QGKFKINPKTGGISVSEVLDYE-LCKRFYLVVEAKDGGTP-ALSAVATVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNE-FTVDP---VLGLVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNS 3443          

HSP 19 Score: 75.8702 bits (185), Expect = 3.380e-12
Identity = 144/603 (23.88%), Postives = 250/603 (41.46%), Query Frame = 3
Query: 2634 MTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPM---TLPENYDIKKRIVQIKATDADSKDIQYRLV--NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHG----IHSDCFHCDTSTGAVHLLCKLSPLTEYRLIA--VVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDK-EPQSFVYTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDN--VFVFNRYLST----ELIN--YHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHL--FANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRL 4373
            +TI   D G+P+     R  I+        P  L +F  P    T+ E+ D    IV + +    +  + + +V  NF   F      G + +   LD E+R  Y + +  +D      +  A   + I V D NDN P F++ +Y + + ED+   + ++Q+ ATD D  +  +L Y +H     I    F  D STG ++   +L    + + I   +V+D   P   +     ++       N + P    P+  A++ E+   G+ V  +     DK E    +YTI   + G ++F+I    G I      D      + L I + D+    ++   A V I VT  +++ P      Y+A V EN+     +I + A       ++ L Y++  GD  G F+I+    + T+++++D E   S        ++  M S++ V  QI                    NDN  VF+F++Y  +      IN     L N+ ++I    A D D + NA + Y +       + ++  + F+VD  +G +   AN+              I  F  +V   D G+P +   SP EV I +
Sbjct: 1327 LTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPL-TFDEPFYNFTVMES-DRVTEIVGVVSVQPANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTD-----GTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRD--EKHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLA---RVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTG-NMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSAT-AIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAI-----SQSTLIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSYQLIIQATNMAGMASNATVNIQIVDE-----------------NDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVI---RATDADSNRNALLVYQI-------VESTAKKFFTVDSSTGAIRTIANLDHET----------IAHFHFHVHVRDSGSPQLTAESPVEVNIEV 1873          

HSP 20 Score: 75.0998 bits (183), Expect = 5.179e-12
Identity = 114/453 (25.17%), Postives = 191/453 (42.16%), Query Frame = 3
Query: 2502 ESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQ-GQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRI-------VQIKATDADSKD---IQYRLV--NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRI-NNEGEIRTVS-SIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYF 3815
            +S  ++ V   +   +F+I   + +S  I     LD E    Y + I   +  G   N       IQ+ D NDN P FL S Q   +L E   I   +       + I+ATDADS     + Y++V    ++ F + S TG +R   NLD E   ++   +   D      +  +   + I V D+NDN P+FT+  +   L     +G  ++++ ATD D +   +L Y++     D F  D+++G + +         Y LI  V D GK     S +   I  ++   +       +   + +I EN    T V +I     ++  +   Y+I    N    F+I +  G I+T     DRE++E Y L +      D +    +    + + D NDN P+     Y A+V  + +    +  V A D D     E+ Y  +  D +G+F
Sbjct: 1698 QSTLIYEVKDGDINGIFTI---NPYSGVITTQKALDYERTSSYQLIIQATNMAGMASNATVN---IQIVDENDNAPVFLFS-QYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEGSLDHFLIDSNSGVLTIKNNNLSKDHYMLIVKVSD-GK---FYSTSMVTIMVKEAMDSGL--HFTQSFYSTSISENNTNITKV-AIVNAVGNRLNEPLKYSILNPGNK---FKIKSTSGVIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVR-VNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTY--VLQDDYGHF 2130          

HSP 21 Score: 72.0182 bits (175), Expect = 4.681e-11
Identity = 106/451 (23.50%), Postives = 196/451 (43.46%), Query Frame = 3
Query: 2487 DRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRL--VNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIH-GIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTS---IRPETSDKEPQS-FVYTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRND-EIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISG 3797
            DRD  + +  + V S  + +     R D  +  +  A+RLD E  DK+ + I V DQ  P      R  + VED ND+ P F +      ++ E+  +   ++Q+ A D D   + ++ Y +   N   +FKI    G + +    D      + + I  +D      S TA   +++ ++D  ++ P F    Y   + E++ IG+ ++ + A        S L Y +  G  +  F  +  +G +     L     + Y+LI +   N    A ++  + QI  +  +   ++ S     ++ A   N +  +L  S   IR   +D    +  VY I   S     F +++  G IRT++++D E    +  ++++ D    ++  +   EV I+VTD NDN P+  +A ++  +         ++ V ATD D     EL Y ++ G
Sbjct: 1486 DRDE-KHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPL-YEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSD--NSHPKFIHKDYQAEVNENVDIGTSVILISAI-----SQSTLIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSYQLI-IQATNMAGMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIV-ESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEG 1925          

HSP 22 Score: 69.3218 bits (168), Expect = 2.807e-10
Identity = 122/561 (21.75%), Postives = 217/561 (38.68%), Query Frame = 3
Query: 1575 LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDIS-RTKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSG--LVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADS----KDIQYRLV--NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTK-NSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL 3227
            + + ++DVN+ PPV  ++     V ENT     +  +QA DPDI    K+ Y L D     F +      +++ ++ LD E  Q  + I V  TD     + S +    I + D+N+  P F  +   +T+        ++    A   D      I   I S + +Q  F I+P++G +S+     + +  +   F + ++A D G   +S+   +N ++ D N                                               N P F+ ++ S + I E++  G  V  I +   D D  P   +  F + + +    F++   D     + V  +LDRE V  Y + +   D G P         I + D+NDN P F  +      + EN  +   I+Q+  TD DS        + ++  N    F +    G LR  V     +   Y + + A D         +   + + V + + +KP       + + + +D P G  + ++HATD D+ D   L +A+       F  ++  G +  L  L
Sbjct: 3117 IHLILEDVNDNPPVFSSDHYNTCVYENTATKALLTRVQAVDPDIGINRKVVYSLADSAGGVFSIDSSSGIIIL-EQPLDRE-QQSSYNISVRATDQSPGQSLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGN-EQGKFKINPKTGGISVSEVLDYELCKR---FYLVVEAKDGGTPALSAVATVNINLTDVND----------------------------------------------NPPKFSQDVYSAV-ISEDALVGDSV--ILLIAEDVDSQP-NGQIHFSIVNGDRDNEFTV---DPVLGLVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFTPA-NYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLDPH-GILRSAVVFQHTESLEYVLCVQAKDSG--KPQQVSHTYIRVRVIEESTHKPTAIPLEIFIVTMEDDFP-GGVIGKIHATDQDMYD--VLTFALKSEQKSLFKVNSHDGKIIALGGL 3611          

HSP 23 Score: 65.4698 bits (158), Expect = 3.823e-9
Identity = 92/411 (22.38%), Postives = 174/411 (42.34%), Query Frame = 3
Query: 2604 LDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKR--IVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDY-YPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVY--TISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIY-IEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGD 3800
             DRE  + Y + +    +            + +EDINDN P F+    +P       D +    I Q+ A D D   + ++ Y L +    F+I+  +G + L+   + +  +  Y + I+A D        + + ++ + +  +N   P+F K  Y+ ++ ED+ + + ++ ++AT  +      +   I G     F+ D  TG + ++  L     + Y+L     D           D  +     +P    P   +P     + E  L GT V  +    +D E    V+   +    N    F I++  G I T   +D E  +   L +  I+     + +++L  +YI  +D NDN P+  +  Y++ V+E     H +  V+A+DAD +    L+Y I+SG+
Sbjct: 2042 FDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVG---LPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTYVLQDDYGHFEINPNSGNVILKEAFNSDLSNIEYGVTILAKD----GGKPSLSTSVELPITIVNKAMPVFDKPFYTASVNEDIRMNTPILSINATSPE--GQGIIYIIIDGDPFKQFNIDFDTGVLKVVSPLDYEVTSAYKLTIRASDALTGARAEVTVDLLVNDVNDNP----PIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYI--SDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGN 2437          

HSP 24 Score: 56.9954 bits (136), Expect = 1.665e-6
Identity = 63/212 (29.72%), Postives = 93/212 (43.87%), Query Frame = 3
Query: 1566 TFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRT-KISYYLFDQNKLPFRLGEFKRNVV-IVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPC-FSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSG 2192
            T  + I V+DVN+  P+         V EN+    +V+ IQA DPD S   K++Y +   N   F     K  ++      LD E  Q   F+ V VTD G    +S I    +++ D N+ KP+F  K  QI +  +         + A   DRD   N +IS + V       F I P++G +S    F  G    LT     ++A D+G
Sbjct: 1131 TIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDRE-QQAEHFLEVTVTDGGPSPKQSTI-WVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFTAGSYDILT-----IKAVDNG 1335          

HSP 25 Score: 56.6102 bits (135), Expect = 1.826e-6
Identity = 36/125 (28.80%), Postives = 65/125 (52.00%), Query Frame = 3
Query: 10326 ASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKG 10700
            +++L+RE Q  + L+++ S  G+  ++  T V I +LD+ND  P F      + +AE T +   +  + A   DIG N E  Y    + + F +   SG ++L  +L+++    Y L + A D+G
Sbjct:  114 SAILNREIQDNYLLIVKGSVRGEDLEA-WTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNGEFYYYFKNKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRG 237          

HSP 26 Score: 55.8398 bits (133), Expect = 3.507e-6
Identity = 124/524 (23.66%), Postives = 219/524 (41.79%), Query Frame = 3
Query: 9666 YAYFRV-SESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPV-CPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESK-------KCSFKILINVLDINDNAPRFVHTSIAPF-LENAPHGSVIGKIHAVDADSGINRKI--VYRILDESKSSFSIDRDTGIMRVASL-----LDRERQP-EHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPP-QFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQN--FFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYV-FNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPT-YKFQVSVTDHGIP-AFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVD 11165
            + + R+ ++ G   +L+    +  L  ++      D   W+K    +NI+V+D+ND  P+  P    + I E     + +  + A D D  +      Y      D  L  V P +G + ++  L+ +  +  +  + A+D   K         + K+ +++  IN++AP     +  PF LE  P  +V   +   D D G N +I  V  +  +    F + ++   +    +     +D E  P  ++L ++A D G P K +      +     D+ P +F      + ++E +  G V+  +K   + I    +V Y++   ++  +F++   SG +   + L+      Y L V   +    +  T +  I    D      Q  +  YV  ++P  T V  LT   V+A D D G N  +TYS             ++LN +   F IN  TG I      D E  P  Y+F V  +D G P    S+ NVTI I + NDN P F + + + +I  D
Sbjct:  102 FCFLRIRTKGGNSAILNREIQDNYLLIVKGSVRGEDLEAWTK----VNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSN-GEFYYYFKNKVD--LFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIHVVTHVPFSLEKEPTYAV---VTVDDLDDGANGEIESVSIVAGDPLDQFFLAKEGKWLNEYKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVKLSPEPI----DVEYKLSPGEDAVYFKINPRSGLIVTARPLNTVKKEVYKLEVTNKEGDLKAQVTIS--IEDANDHTPEFQQPLYDAYVNESVPVGTSV--LT---VSASDKDKGENGYITYSI------------ASLNLLP--FVINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYD 590          

HSP 27 Score: 55.0694 bits (131), Expect = 5.604e-6
Identity = 41/118 (34.75%), Postives = 60/118 (50.85%), Query Frame = 3
Query:  459 LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDF 812
            L+RE+   YN++++   +S        S  T V I VLD NDN P+F   ++     E+ S  TQ+  V AT  D G N+EI Y      I S + +  F INP +G I  V ++ D+
Sbjct: 3193 LDREQQSSYNISVRATDQSPGQ---SLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYL-----IRSGNEQGKFKINPKTGGI-SVSEVLDY 3301          
BLAST of Ft-2 vs. Ensembl Human
Match: FAT3 (FAT atypical cadherin 3 [Source:HGNC Symbol;Acc:HGNC:23112])

HSP 1 Score: 669.078 bits (1725), Expect = 0.000e+0
Identity = 758/2899 (26.15%), Postives = 1277/2899 (44.05%), Query Frame = 3
Query: 4935 YSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPS-TGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFAS-YFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPD--LNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSA-LDREERPFVQLLVLAKGWDGSYDYINVTV-----SVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVLN-EYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVS--DYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLG-LNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCS--IMTIQENNPLNHIVAMCRISSTEMKGKW-SLVPSSSPFDVQND-FEIDSNYGYIRAKKIMDFETQSQYRINVEYRV--DNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGV-SFRID-DQGWVYSVSAVDYEETKLINLVVSASD--KAGHVTNTTL-TISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFV--HTSIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPK-SNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKPNIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQ-LAPDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPC-GSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSI---LGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGARNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQI 13517
            Y++ +S D I+++K F I+ + G L        Y+ +  D   EA++K         HIL+        ++ R+Q   Y    RNLA+    ++N  D      +  N L  +  +    +++G+ +  ++A D+D G N +L++ I+  +   N F+++   G I + +           L+I V+D G PP    ++V + +     SH  P+         V+EN  + + +             +   ++  +K      +F +   +G I T  +LD E+      + IQ  +  G+ S      +V I I D NDNAP FL   + +G +SE+A   S+V        L  S   LVI A D D  +N  + Y I+   A  +F +D  TG +     +D E +  F    + ++D GSP+L ++  +E+ I + D ND PP F +  +  +L+LPT+    +L++   DPD  + P + +S++ G    F  ID  +G L I  N++          ++ ++  DGKF ++  +TI       +  L   +S     I EN  ++  + +  A    +  +  +KY +L+   K +I   +G ++      DREE+   +L+V A       D++ V       ++ D ND  P+F+   Y   V  +        +V AID D G NG V Y +     + +   F I+ NSG + ++   + +L   ++ + I A D G+P+LS+  ++ + IV+   P+FDK  Y+  V ED   +  + ++ A S  G  I+Y I +G+  + F++DF          V+++V  LDYE    + L I A+D  +      TV + V D+ND  PIF + +Y+ ++SE   I   ++ +  +     N+K+V +  ++++D+   S+ +F I+ ++G I     LD E        +     G  S ++   + ++I D NDNPP F Q  + + +S  + +G  V    A+D D++   +L Y +L+      F +D  SG I  +     +++ P   +    V V D   +  A V +  +    + P+F  + +   V EN    +++  + A+D D   +G++ Y +I  F  + F +DS  G ++  + LDRE     ++ + V   D G +  F TV + V D NDN P      Y  +V    ++       + Q+ A D D     R+ Y L S     S++  D +   +     W+    N   L NT     V  +   +         +  ++I   I+V      L       P  T S    TI E+  +   V   RI  ++    W S V    P + +   F I+   G I+  K +D ET   +   V   +  D   ++ T  + I ++D ND  P+F+ S Y   I E +P+G+K+ Q +A D D+     + YSL+     E  + +F ID + GW+ ++  +D+E        V ASD  +A  +++T L ++ V D+ND       N PV   E+       S+    VV  LS  D D+      + + IT  N    +A   V    +V +  PLD E+      L   A+D L  ++   ++ + V DVND++PVC Q+    ++ E I    +I  + A D D  +    + Y+L    +     ++P +G +   A LDRE     + +  A D   + C   I + + D+NDN P F   H +   + EN    +++ ++ AVD D GINRK+VY + D +   FSID  +GI+ +   LDRE+Q  +++ + A+D       S++T V I +LD+ND+PP F      + V EDT  G  ++ + A S DIG NAE++Y + +  EQ  F++   +G +++ + LD+EL + ++L V A D G P+LS    V I + DVNDN P+F    Y   I E+ LV    I  + A D DS  N  + +S +         N    N     F ++P  G + +    DRE    Y   V   D GIPA SS   V I+I D NDN P F   ++  +I          QE K  G    + +L + D+D   N  PF   +L+      F++    +    ++         V  L VQ  D+G+P       + V VI  S   P   PL +  V    +   G    I ++   D+   +D+LTF       LKS    + FK++S  G I     LDSG Y LNV V++        + + +  L  +M+++   I+  ++ P  F      L +  F +++  + L                           + S R I  Q +A  + +D+L AV   +   F+K + L+ ++      L  I + S++   N    D   C E  C+  + ++     + +    ++F+   F     C C     G  C    + C  KPC G  +    + ++ P F+C+CP  K G+ C       G++S              + F G  +I + L E       ++    R LQ    +M  + N    I++ I  DGK+    D  + P I L  S   + DG WH+V L +      +++ D ++      L  + LS  S I   +F    L+ A N  S  +  + + +       GC+  VILNN +LP Q   +   S +  V    L  GC   L    C    C++GG C            Y C C   FTGRNCE   + C  +PC +GG C    + F C C  GLTG  C+   +       C    +C+     +++ S +C+C+    G  C +
Sbjct: 1345 YTVHSSIDSISMRK-FRIDPSTGVL--------YTAERLDH--EAQDK---------HILN--------IMVRDQEFPYR---RNLARV---IVNVEDANDHSPYFTNPLYEASVF--ESAALGSAVLQVTALDKDKGENAELIYTIEAGNTG-NMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSH--PKFIHKDYQAEVNENVDIGTSV-------ILISAISQSTLIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSY-QLIIQATNMAGMASN----ATVNIQIVDENDNAPVFLFS-QYSGSLSEAAPINSIV------RSLDNS--PLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHF-HFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEGSLDHFL-IDSNSGVLTIKNNNLS-----KDHYMLIVKVSDGKFYSTSMVTI-MVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNA--VGNRLNEPLKYSILNPGNKFKIKSTSGVIQTTGVPFDREEQELYELVVEASR---ELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTYVLQ--DDYGH---FEINPNSGNVILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSVELPITIVNKAMPVFDKPFYTASVNEDIRMNTPILSINATSPEGQGIIYIIIDGDPFKQFNIDFDTG-------VLKVVSPLDYEVTSAYKLTIRASDALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHY--QIVQDTY-NSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSN-HRKQRMEP---LYSLNVSVSDGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAIINDFAKDRFLIDS-NGQVITTERLDRENPLEGDVSIFVRALDGGGRTTFCTVRVIVVDENDNAPQFMTVEYRASV----RADVGRGHLVTQVQAIDPDDGANSRITYSLYS---EASVSVADLL--EIDPDNGWMVTKGNFNQLKNTVLSFFVKAVDGGI--------PVKHSLIPVYIHVLPPETFL-------PSFTQSQYSFTIAEDTAIGSTVDTLRILPSQ--NVWFSTVNGERPENNKGGIFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDIND-------NAPVFAQEVYRGNVKESDPPGEVVAVLSTWDRDTSDVNRQVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREE-QDIYFLNITATDGLFVTQA--MVEVSVSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIGSN-GYIRYSLYGSGNSEFF-LDPESGELKTLALLDRERIPVYSLMAKATDGGGRFCQSNIHLILEDVNDNPPVFSSDHYNTCVY-ENTATKALLTRVQAVDPDIGINRKVVYSLADSAGGVFSIDSSSGIIILEQPLDREQQSSYNISVRATDQSPGQSLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNEQGKFKINPKTGGISVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVI-LLIAEDVDSQPNGQIHFSIV---------NGDRDNE----FTVDPVLGLVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVI----------QENKPVGT--SILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLDPHGILRSAVVFQHTESLEYV--LCVQAKDSGKPQQVSHTYIRVRVIEESTHKPTAIPLEIFIVTMEDDFPGGV---IGKIHATDQD-MYDVLTF------ALKSE-QKSLFKVNSHDGKIIALGGLDSGKYVLNVSVSDGRFQVPIDVVVHVEQLVHEMLQNTVTIRFENVSPEDFVG----LHMHGFRRTLRNAVLTQ------------------------KQDSLRIISIQPVAGTNQLDMLFAV-EMHSSEFYKPAYLIQKLSNARRHLENIMRISAILEKNCSGLD---CQEQHCEQGLSLDSH-ALMTYSTARISFVCPRFYRNVRCTCN----GGLCPGSNDPCVEKPCPGDMQCVSYEASRRP-FLCQCPPGKLGE-C------SGHTS--------------LSFAGNSYIKYRLSENSKEEDFKLALRLRTLQSNGIIMYTRANPC--IILKI-VDGKLWFQLDCGSGPGI-LGISGRAVNDGSWHSVFLELNRNFTSLSLDDSYVERRRAPLYFQTLSTESSI---YFGA--LVQADNIRSLTDTRVTQVL---SGFQGCLDSVILNNNELPLQNKRS---SFAEVVGLTELKLGC--VLYPDACKRSPCQHGGSCT-----GLPSGGYQCTCLSQFTGRNCESEITACFPNPCRNGGSCDPIGNTFICNCKAGLTGVTCEEDINECEREE-CENGGSCV-----NVFGSFLCNCTPGYVGQYCGL 3985          

HSP 2 Score: 387.882 bits (995), Expect = 1.483e-106
Identity = 540/2004 (26.95%), Postives = 885/2004 (44.16%), Query Frame = 3
Query: 5295 SSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVN-SILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVS-SLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVIL-SRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEI-MIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLS-----EQPKVEINEITGSLKLKSALDRE--ERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDI-VSDKS-PLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISI--SVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHI--VDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVLNEYYNIFKIDQSSGF--IRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGR-LRYHVIGGFDSEIFGLDSLTGALLLKKT-LDRERKSMHELRVVVSDYGNK--HDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSI-MTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLI--DQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVY--DVNDEIPYWTKNPPVDGIEITETCDGCSETFPR--VVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPL-QLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIPDLM-IFEGITPGSVITTLQAYDRDSSAKYNTLTYTLME--CSDPYLLVVEPLTGRVIVNAPLDRE--FSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSI-APFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFS----IDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAI-SDDI---GVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRAS---DKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLV-SKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIP-AFSSKTNVTIEIEDKNDNPPEFAQPSFR 11147
            S IGT +  ++A D+D GR+G++ ++I+ D   L  F +D  +G I     L        +LT+  +D G  P  +   V +E+ D  ++ + P   E     VV EN+  + S++        +       Y + S  P     F +   TG I T S  LDREQ  +     ++V   DG  S   S I V + + D NDN P+F  P K+  I     +       +  GE + ++       A D DEG N +I Y I+       F ID  TG++S   +      GS+  L+I+  D G P+  S  RL I  I     +  P  F++ FY    ++ +     ++ +    P  N  + F I+ G     F  +   G + I+    P+  +  S+  +++   DG       + I   DN  N     E SQ  +++  + + +PD  + + +     +   + Y + S        K  I+  TG L     LD E  ++  + ++V  + +    +   V V+V D ND+ P F +  YE  V  + +  +  ++V A+D D GEN  +IY+I   +       F I+   G+ITI   P    +G +F + IK  D+G P +S+   V + + +SD S P F    Y   V E+      V  + AIS +  T++Y + +G+   +F ++       P   VI     LDYE    + LII AT+  + ++ + TV I ++D ND  P+FL S YS S+SE  PIN  + S+  S L+ + +++     +L + +     + + F ++ +TG I    NLD E      F + V+  G    T  + ++V+I   D NDNPP F Q  F   + L +  G  V+   ATD D+    +L Y ++    + F ID +SG   I+ N +     +L         V V D      + V++      +    F  + +  S+SEN   N+ I ++   ++  N+    L+Y ++   +   F + S +G +       DRE + ++EL V  S   +        V +++ DINDN PV     Y   V +  +  GT    I Q+ A D+D  P   + Y L           ++  +G V LK ++ +  SN+    T        I  +   +P  S     T +   I +  K   ++DK    P  T S+   I+ N P+  I A    +S E +G   ++    PF     F ID + G ++    +D+E  S Y++ +  R  ++   A   + +DL+  D ND PPIFD   Y   +SE   +G+ V+Q  + D D E   ++ Y + Q D+  +   F ID   G + +   +D+E  +   L V + D      ++ + + +Y  DVND       NPPV    I E+    SE  PR   V  + A D DS S  + L + I + N     ++   S+SG + L +    ++ ++PL  L    SD L  S  +  ++IRV+  N ++P   Q   +  + E +  G+ +  ++A D D    Y  ++Y ++     D +L+      G+VI    LDRE      V+  V ALD   +     + + V+D NDNAP+F+     A    +   G ++ ++ A+D D G N +I Y +  E+  S +    ID D G M      ++ +       ++A D G P K ++  V I +L      P F        +AEDT IG  + T++ + S ++    VN E       +   F +E  +G + L K+LD E S  +   V A+   DK    +  T  V I+V+D+NDN P F    Y   I E   V +KLT  +V A D D G N  +TYS          ++ S    +   F I+  TG I      D E  PT+ F V  +D G   + SS   V++ + D NDN P FAQ  +R
Sbjct:  906 SRIGTSVLQVTARDEDSGRDGEIQYSIR-DGSGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVED--VNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQ--NFFAINIKTGLITTTSRKLDREQQAEHF---LEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQF--PEKVYQIKLPERD------RKKRGEPIYRAF------AFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQF---TAGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFY-NFTVMESDRVTEIVGVVSVQP-ANTPLWFDIVGGNFDSAFDAEKGVGTIVIAK---PLDAEQRSIYNMSVEVTDGTNVAVTQVFIKVLDNNDNGP---EFSQPNYDVTISEDVLPDTEILQIEATDRDEKHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTI---EAGNTGNMFKIEPVLGIITICKEPDMTTMG-QFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQS--TLIYEVKDGDINGIFTIN-------PYSGVITTQKALDYERTSSYQLIIQATN-MAGMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEGSLDHFLIDSNSGVLTIKNNNLSKDHYML--------IVKVSDGKFYSTSMVTIMVKEAMDSGLHFTQSFYSTSISEN---NTNITKVAIVNAVGNRLNEPLKYSILNPGNK--FKIKSTSGVIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVDAEP-GTL---IYQVTAIDKDKGPNGEVTYVLQD---DYGHFEINPNSGNVILKEAFNSDLSNIEYGVT--------ILAKDGGKPSLS-----TSVELPITIVNKAMPVFDK----PFYTASVNEDIRMNTPILSINA----TSPEGQGIIYIIIDGDPF---KQFNIDFDTGVLKVVSPLDYEVTSAYKLTI--RASDALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQ-DTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVND-------NPPVFNQLIYESY--VSELAPRGHFVTCVQASDADS-SDFDRLEYSILSGNDRT--SFLMDSKSGVITLSN--HRKQRMEPLYSLNVSVSDGLFTSTAQ--VHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGD-PGTYGQISYAIINDFAKDRFLI---DSNGQVITTERLDRENPLEGDVSIFVRALDGGGRTTFCTVRVIVVDENDNAPQFMTVEYRASVRADVGRGHLVTQVQAIDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKGNFNQLKNTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAEDTAIGSTVDTLRILPSQNVWFSTVNGERPEN--NKGGIFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDK--VDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLT--QVRAIDMDWGANGQVTYSL---------HSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYR 2780          

HSP 3 Score: 302.753 bits (774), Expect = 7.274e-81
Identity = 527/2219 (23.75%), Postives = 920/2219 (41.46%), Query Frame = 3
Query: 5301 IGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNS-ILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILP-TFPSAPLLQLRVHDPD--LNPTILFSILNGKESRFFSIDPTTGWLKIS-TNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEI-PENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPK--VEINEITGSLKLKS-ALDREERP--FVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEF-LVHTNLSKEAQSI-RVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIG------IKANDKGQPALSSFTDVFVDIVSDKSPL-----FDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFS-PTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLV--VIAMATDLDTNSKLIYKV-LNEYYNIFKIDQSSGFIRFNQVPNIEKL----------------LPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILST--KSTGTTLE-SILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIA---FQVCEEPLYSYRI-ATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGK------WSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSAV--DYEETKLINLVVSASDKAGHVTNTTLTI--SVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVS-ESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQ-IPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPY-LLVVEPLTGRVIVNAPLDREFSSTVNFVVHALD-VESKKCSFKILINVLDINDNAPRFVHTSIAPFLENAPH-GSVIGKIHAVDADSGINRKIVYRILDESKSS---FSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKW--NNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIK------DKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGS---LYLGVRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNN---FFKIDSFTGAITTTEMLD 11702
            +G  +  I A D D G NG+++F I +D    + F +D   G ++V   +      L  L I + DLG P + +  ++ + + D   + + P   +    + + E++ + + I+                Y VL+      + F +  STG +     LDRE   +  S+ I+ +       +  S++++K+ + DVND +P F+ P   +  + E    G+++                 +   DPD G  GQ+ Y +++ +   F+ID+ +G + L+ ++D E    F +L++R +DKG P  LS      + +++   +    +  DF +   +   +     +LQ+   D D   +  I +SI +G     FSID  +G +  +   D    G +   V    R     + T   + I   D   N   PL    + + +  EN      ++  +A+   S  +  + Y + S  P+    IN  TG +   S  LDRE++   F+++ V   G       I V V V DEND KP F  + Y+  L   +  K  + I R  A D D G N  + YSI        D KF ID  +G+++ +         K+FT G      IKA D G+P  SS   + ++ +    P      FD+  Y+  V E      IV  V ++      + + I  GN +  FD        + G   I +   LD E +  + + +  TD ++     T V I VLD ND  P F + +Y  ++SE++  + EI+ I    +     +  + S  +       S + FRI+ +TG +   E LD EA   H   I+V+ D  F    N A + V++ D ND+ P F  P + A++   ++ GS V  V A+  D   N++LIY +      N+FKI+   G I   + P++  +                + ++ +V   V + D +H                 P F+  ++   V+EN  + + +  I A          L Y V  G  + IF ++  +G +  +K LD ER S ++L +  ++       ATV I + D NDN PV   + Y  ++  +    S   +L+ S L + A D D +    + Y++V    ++    VDS TGA+                 T + L+   IA   F V      S ++ A + +  +I VT       D     P+ T ++       P    V + ++S+T+   +      +SL+  S      + F IDSN G +  K   +  ++  Y + V  +V +    +T  + I + +  D    F  S Y+  ISE+    +KV    A        + + YS+     +  G  F+I     V   + V  D EE +L  LVV AS +  H+    + +  ++ D+ND  P +   P    +++    D    T   ++Y+++A D D     E  + L  +      Y +F ++  SG V+L    +++       +  LA D    S    +  + +  VN   PV  +      + E I   + I ++ A   +           ++   DP+    ++  TG + V +PLD E +S     + A D +   +    + + V D+NDN P F   +    L  A   G+ + ++ ++DADS  N+ + Y+I+ ++ +S   F ID  +G++  A +LD E      L + + D G P  S+   V I + DVND+PP F  +  +  V+E    G  +  ++A   D      + Y +++  ++  F ++S SG +TL       +   Y L V  SD  +   ++T  V I+V+  N   P F    YV  + EN       I  V A D D G    ++Y+ +    + ++  ++   +   E   R NP  G++ +             F  ++   G   F +   V + + D+NDN P+F    +R  ++ D                  VGR H+       D D   NS         A      L++ D   D   ++  G+   L   V + +V+  D G P  +  + V ++V+      P       ++     +T IG  ++  R+L     P+ ++  F  V  E    R  NN    F I+  TG I   + LD
Sbjct:  591 VGANILKIKAYDADSGFNGKVLFTI-SDGNTDSCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDA--NDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLT----DTQQFAINSSTGIVYVADQLDRESKANY-SLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFI-PSSYSVKVLEDLPVGTVIAW---------------LETHDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDYEK-QQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYST-IEVYIEVEDVNDNA--PLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGND---DGKFFIDPKTGMVSSR---------KQFTAGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVV-SVQPANTPLWFDIVGGNFDSAFDA-------EKGVGTIVIAKPLDAEQRSIYNMSVEVTDGTNVAV--TQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQI----EATDRDEKHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVR-DQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSH-----------------PKFIHKDYQAEVNENVDIGTSVILISAISQST-----LIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSYQLIIQATNMAGMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVES-TAKKFFTVDSSTGAI----------------RTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVT-------DVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEGS-----LDHFLIDSNSGVLTIKN--NNLSKDHYMLIV--KVSDGKFYSTSMVTIMVKEAMDSGLHFTQSFYSTSISENNTNITKVAIVNAVGNRL--NEPLKYSI-----LNPGNKFKIKSTSGVIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQV----DAEPGT---LIYQVTAIDKDKGPNGEVTYVLQDD------YGHFEINPNSGNVILKEAFNSDLSNIEYGVTILAKDGGKPSLSTSV-ELPITIVNKAMPVFDKPFYTASVNEDIRMNTPILSINATSPEGQG-----IIYIIIDGDPFKQFNIDFDTGVLKVVSPLDYEVTSAYKLTIRASDALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSNHRKQRMEPLYSLNVSVSDGLF---TSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVI-HVRATDGDPGTYGQISYAIINDFAKDRFLIDSNGQVITTERLDRENPLEGDVSI-------------FVRALDGGGRTTFCT---VRVIVVDENDNAPQFMTVEYRASVRAD------------------VGRGHLVTQVQAIDPDDGANSRITYSLYSEASVSVADLLEID--PDNGWMVTKGNFNQLKNTVLSFFVKAVDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFT-IAEDTAIGSTVDTLRIL-----PSQNVW-FSTVNGE----RPENNKGGIFVIEQETGTIKLDKRLD 2622          

HSP 4 Score: 268.855 bits (686), Expect = 1.546e-70
Identity = 297/1105 (26.88%), Postives = 494/1105 (44.71%), Query Frame = 3
Query:  579 NDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAH----NVHAPKISVKYLSKYFDPDFNDYP-FAEITVTDEDERLNRNRNPYPILIRHHPKSPVN-VFLTPTGE-LNRYVLKLRAIFSPISTP-AISVTIEAKDLSLNPKTSSTHLTIPLGN--LRNINLLSVPEFVSVSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLEGTY-SVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDA--NSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGM-RNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSI--RPETSDKEPQSFVYTISGHSNGISLFRINNEGEIRTVSSI-DREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYF 3815
            ND  P+F    +     E+  + T +  VTATDAD G N E +YY              FS++P SG+I    +L ++   ++   +I A+ RG    +K    +    +  +  H    N HAP I V     +        P +A +TV D D+  N       I+       P++  FL   G+ LN Y +K R      S P   ++T++AKD   +P+  S    + +GN     + +    E   VSI E +     V ++K           + + ++  P  +  Y  +N  S            + A    + ++ +      N   + K   T  IS++D N+  P          V E+  +G +VL + A D D      I+Y +   N LPF + +F   V+   E LD E+    +   V  +D G+P       +  I I +VN+  P F    CQ  IS    YD  +G  I     +D D  + ++  I S + +   F ++P+SG L L  +  +  + K  NF + + A D   ++  M++N SV+    +S+S S R  ++        +  +    +  N   N E+     + + R  P F  + PS + ++E+   G  + KI    AD     +  + +F +        F+I   D  +  + V   +DRE  D Y + I + D G P+   ++   I VED NDN P F+ DS+ +   + E+  I   I+Q++A D D   + ++ Y ++   + F I+S TG + +   LDRE +  Y + I A D     + L +  TL + + D+ND  P F  +SYS+ + EDLP+G+ +  L   D DL    Q+RY++   ++  F  D ++GA+ L  +L    +  Y L    KD G+P +LSS +  ++    V+ N + P   +  +  +++EN   GT V  +  R E S ++ +   Y+I   S G+  F I++E  + T + I DRE   SYWL +Y  DR    +   + EVYI+V D NDN P+     Y   V EN      +I ++A D D +   +L Y+I SG+   +F
Sbjct:    2 NDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNGEFYYYFKNKVDL-------FSVHPTSGVISLSGRL-NYDEKNRYDLEILAVDRG----MKLYGNNGVSSTAKLYVHIERINEHAPTIHVVTHVPF---SLEKEPTYAVVTVDDLDDGANGEIESVSIV----AGDPLDQFFLAKEGKWLNEYKIKERKQIDWESFPYGYNLTLQAKDKG-SPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVK------LSPEPIDVEYKLSPGEDAVYFKINPRSGLI---------VTARPLNTVKKEVYKLEVTNKEGDLKAQVT--ISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDKGENGYITYSIASLNLLPFVINQFT-GVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVIS----YDFPVGGHITAVSAIDIDELELVKYKIISGN-ELGFFYLNPDSGVLQLKKSLTNSGI-KNGNFALRITATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQ-----KLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSG---FNGKVLFTISDGNTDSCFNI---DMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSV--NILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGE-IQYSIRDGS-GLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTI-EVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFF 1046          

HSP 5 Score: 246.514 bits (628), Expect = 8.677e-64
Identity = 380/1574 (24.14%), Postives = 658/1574 (41.80%), Query Frame = 3
Query: 6708 LSEQPKVEINEITGSLKLKSALDREERPFVQL----LVLAKG------WDGSYDYINVTVSVTDENDYKPMF-LSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDI--VSDKSPLFDKSKYSVIVPEDALKDFIVTTVKA----ISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSS---LSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGR---FSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLN-EYYNIFKIDQSSGFIRFNQVPNIEKL--------------LPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGAL-LLKKTLDRERKSMHELRVVVSDYG--NKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSP--FDV-----QNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLY-QLDSVETGVSFRID-DQGWVYSVSAVDYE--ETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDV-------------------NDHAPVCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPFL-ENAPHGSVIGK-------IHAVDADSGINRKIVYRILDE-SKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKP--PKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQ-NFFRLESLSGNLTLIKKLDFELSRE-YFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPE-NTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVP-DREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVD 11165
            L++   + I+ + G +  KS   RE R   +L    L+ AK        DG  D+ ++       N   P F  S   +  V  +L   A  +++KA D D+G NG V+++I        D  F ID  +G + +     +E     + + I   D G P  SS+  + +++   +D SP+F +  YSV + E +     +  V+A    + S G      +T   D + F ++ +         ++ +  +LD E+K  ++L I A D + S   L    T+ + + D+ND  P F+ SSYS  V E++P+   I  +      +     V +S  L+ D     +  F I+  +G I + + LD+E    +   +  K  GR    S  +   ++V  V+EN + P F   A   ++   S  G+ V+   A D D+  + ++ Y + +      F ID  SG I    + + E +              +P    +E  + V D               + ++ P      ++  V EN   +  + +I A D D +   +L Y +  G     F ++  TG +    + LDRE+++ H L V V+D G   K     V++ V D NDN P   +  Y++   L  +      E I +  A DRD  P   + Y +V         F+D  TG VS +  +           T    ++  I       P  S              T +++I + KK      +   +T  E  P  +   M     TE+ G  S+ P+++P  FD+      + F+ +   G I   K +D E +S Y ++VE  V +   +A   + I ++D ND  P F    Y + ISED+   ++++Q +A D+D + K  + Y+++  +DS+     FRID   G +Y+   +D+E  +  ++N++V   +         + ++V D ND  PY+T NP      + E     S      V +++A D D     E ++ +                 +G +  + P+        L +  +  +    +  +F+L+I+V D                    N H     +     + E +  G+ +  + A  +      +TL Y + +     +  + P +G +     LD E +S+   ++ A ++     +  + I ++D NDNAP F+ +  +  L E AP  S++         I A DADS  N  +VY+I++  +K  F++D  TG +R  + LD E     H  +   D G P     +   V I + DVND+PP F     +  +   T +G  ++ + A   D  V  E++Y ++    + F ++S SG LT+       LS++ Y L V+ SD  + S S  T ++++    +       F  Y  +I E NT ++K+ I         + LN  L YS L   P  K             F+I   +G I    VP DREEQ  Y+  V  +        ++  V + IED NDN P F    +   +QVD
Sbjct:  511 LADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSI-------NRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTI---SDGNTDSCFNIDMETGQLKVLMPMDREHT-DLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLT---DTQQFAINSSTG-------IVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYS--LVND----YNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVED---------------VNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIK--LPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKF-FIDPKTGMVSSRKQF-----------TAGSYDILTIKAVDNGRPQKSS-------------TARLHIEWIKKPP---PSPIPLTFDE--PFYNFTVMESDRVTEIVGVVSVQPANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVE--VTDGTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRDEKHK--LSYTVHSSIDSISMR-KFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFT-NP------LYEASVFESAALGSAVLQVTALDKDKGENAELIYTI-------------EAGNTGNMFKIEPV--------LGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQ------STLIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSYQLIIQATNMAGMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEGSLDHFLIDSNSGVLTIKNN---NLSKDHYMLIVKVSDGKFYSTSMVT-IMVKEAMDSGLHFTQSF--YSTSISENNTNITKVAIVNAVG----NRLNEPLKYSILN--PGNK-------------FKIKSTSGVIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVGLPYYAAVQVD 1946          

HSP 6 Score: 238.81 bits (608), Expect = 1.714e-61
Identity = 437/1823 (23.97%), Postives = 753/1823 (41.31%), Query Frame = 3
Query: 6021 INAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERL----EIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTI-LFSILNGKESRFFSIDPTTGWL---KISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSF-DNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKV--EINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPAL-SSFTDVFVDI--VSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS-STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYE--TKPFHTLIISATDPSSSLSHSTTVLITVL--------------------------------------------DINDELPIFLKSSYS-ASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLV--VIAMATDLDTNSKLIYKVLNEYYNIFKIDQSSGFI----------RFNQVPNIE-KLLPSSG-----VVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYY-EVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVN--PIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYI-RAKKIMDFETQSQYRINVEYRVDN-SPLMATRTILIDLIDQNDCPPIFDNSRYAIFISE--DIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQ----------KESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP--DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSST--VNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSI-APFLENAPHGSVIGKIHAVDADSGINRKIVYRI-LDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPE----NTLVSKLTIGK--VTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKT--NVTIEIEDKNDNPPEFAQPSFRFLI 11156
            + A D D G NG+  Y   ++    F +   +GV+SL+ +++ +    + DL I   D+G  KL     +    ++ + IE  N+  P      ++    L   P+  ++ +   D   N  I   SI+ G     F +     WL   KI          FP    + ++A D      C+     +  N     +P+   + V+++  +    P +V+   K   S +   ++Y L   +  V  +IN  +G +     L+  ++   +L V  K  D       VT+S+ D ND+ P F    Y+  V+ ++      + V A D D GENG + YSI  +      L F I+  +GVI+       E   + +   ++A+D G P    S  +V + I  V+D SPLF+K     ++  D      +T V AI       + Y I +GN+   F       YL P   V++L   L           L I+ATD   +L+   ++ I+VL                                             IN + P F KS  S  +V E++P+   I+ I         +  V F++     S   +   F I+  TG + +   +D E   ++   I +   G    ++   + +++ D NDN P FIQ +++  I   S  G+ +  V A   DL +N ++ Y VL +    F I+ S+G +          + N    IE +    SG     VV  +V + D               + +  P+F+ + + + V E+  V + I  +   D D    G++RY ++  ++   F +D  +GA+ L K LD E++  + L V   D G     ++V     ++ D    +   Y+ +  V+ S K       S+LQ+ A+D D      + Y +         + +D  +G ++   + I     +G       L VY     V   PLYS          +I V +++  + D   +   PI    +M   EN+P +  V   +    +      L    +  + QN F I+   G I    + +D E Q+++ + V       SP  +T  +++ ++D+ND  P F    Y I + E      G  + +  A+D+D      I YS+  +D  + G  F ID +  + S S   +       L + A D      ++T  + +         W K PP   I +         TF    Y  +  ++D  ++             L F I   N +   A+      G +++  PLDAE+      +    +D  + +  +    I+V+D ND+ P   Q P  D+ I E + P + I  ++A DRD   K +   ++ ++        ++P TG +     LD E      +N +V   +   ++   ++++NV D ND++P F +    A   E+A  GS + ++ A+D D G N +++Y I    + + F I+   GI+ +    D     +  L I+ +D G PP S    V+I +   ++S P+FI+   +  V E+ +IG  +I I AIS    +  EV    I     F +   SG +T  K LD+E +  Y L ++A++     +++   V IQ+VD NDN P F F  Y  ++ E    N++V  L      + A D+DS  N++L Y  +           ST    + FF ++  TG I      D E    + F V V D G P  ++++   V IE+ D NDNPP F Q  F  ++
Sbjct:   30 VTATDADIGSNGEFYYYFKNK-VDLFSVHPTSGVISLSGRLNYDEKNRY-DLEILAVDRGM-KLYGNNGVSSTAKLYVHIERINEHAPTIHVVTHVP-FSLEKEPTYAVVTVDDLDDGANGEIESVSIVAGDPLDQFFLAKEGKWLNEYKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVKL--SPEPIDVEYKLSPGEDAVYFKINPRSGLIVTARPLNTVKKEVYKLEVTNKEGDLK---AQVTISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDKGENGYITYSIASLNL----LPFVINQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAVSAIDIDELELVKYKIISGNELGFF-------YLNPDSGVLQLKKSLTNSGIKNGNFALRITATD-GENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTI-----SDGNTDSCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQ-FAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDD---------------VNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLVNDYNGR-FEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFS-IDDESGVIT--AADILDRETMG----SYWLTVYATDRGVV--PLYS----------TIEVYIEVEDVNDNAPLTSEPIYYPVVM---ENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSI--VDGNDDG-KFFIDPKTGMVS-SRKQFTAGSYDILTIKAVDNGRPQKSSTARLHI--------EWIKKPPPSPIPL---------TFDEPFYNFTVMESDRVTEIVGVVSVQPANTPLWFDIVGGNFDS--AFDAEKGVGTIVIAKPLDAEQ-RSIYNMSVEVTDGTNVAVTQVF--IKVLDNNDNGPEFSQ-PNYDVTISEDVLPDTEILQIEATDRDEKHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAISQSTLI-YEVKDGDI--NGIFTINPYSGVITTQKALDYERTSSYQLIIQATNMA--GMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIV----------ESTA---KKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETIL 1742          

HSP 7 Score: 169.088 bits (427), Expect = 2.053e-40
Identity = 236/964 (24.48%), Postives = 408/964 (42.32%), Query Frame = 3
Query: 5994 LSKSLKALVINAEDPDEGKNGQIEYVIL--------------SRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPT-ILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITI-NSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQ--PKVEINEITGSLKLKSALDREERPFV-QLLVLAKGWDGSYDY---INVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSI--------YYVKPFAYDLKFAID-SNSGV--------ITIQSGPS----------------------------KELLGKKFTIGIKANDKGQPALSSFTDVFVDI--VSDKSPLFDKSKYS-VIVPEDALKDFIVTTVKAI---SSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVL-ITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPT--NRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMAT---DLDTNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHD------FTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFAT--VLIHVTDINDNIPVI-EQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVS 8621
            L K     V+  +D D+G NG+IE V +               ++ + +KI +         +ID E      +L+++ +DKGSP+  S  +  + I     +  P +FEK+ Y  V I    P   ++ +    P+  P  + + +  G+++ +F I+P +G +  +    P++     V  + +   +G  +    I+I ++ D+T     PL  + V   +P   +    ++   A      ++  I Y + S    P V IN+ TG +     LD E  P + + +V A  W   Y +   +NVT+ + + ND  P+F     + ++  +         V AID+D  E   V Y I        +Y+ P +  L+     +NSG+        IT   G +                             + L +K  I  KAN K      +  D F+D   ++ + P FDKS  S V V ED      +  +KA    S     +L+TI++GN +  F++D     L       +++  +D E    + L I+  D  +    S  +L I V D ND  P+F++ SYS ++ E+  I  EII +    + + ++  V +S+          +Q F IN +TG + + + LD E+   +   I  +          +   ++V + D ND  P FI  +++  + LE      V+  + T   DL    ++ Y ++N+Y   F+ID++SG IR ++  + EK           V   D       +      V V  V+   H P F       SV EN  + + + ++ A D D  + G ++Y +  G     F +D  +G +     LDRE    + L V  +D G    ++T  V I V D+NDN P+  E  YY V +  S K       S++Q+ A+D D S   ++ YR+ S
Sbjct:  126 LEKEPTYAVVTVDDLDDGANGEIESVSIVAGDPLDQFFLAKEGKWLNEYKIKERK-------QIDWESFPYGYNLTLQAKDKGSPQKCSALK-AVYIGNPTRDTVPIRFEKEVY-DVSISEFSPPGVVVAIVKLSPE--PIDVEYKLSPGEDAVYFKINPRSGLIVTAR---PLNTVKKEVYKLEVTNKEGDLKAQVTISIEDANDHTPEFQQPLYDAYVNESVPVGTS----VLTVSASDKDKGENGYITYSIASLNLLPFV-INQFTGVISTTEELDFESSPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAVSAIDIDELE--LVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGK-----LNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETGQL-------KVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVL-------TDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKV-LEDLPVGTVIAWLETHDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDYEK----QQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDV-----SVIQIQAEDPDSSSNEKLTYRITS 1039          

HSP 8 Score: 141.739 bits (356), Expect = 3.424e-32
Identity = 243/955 (25.45%), Postives = 394/955 (41.26%), Query Frame = 3
Query: 9042 IRAKKIMDFET-QSQYRINVEYRVDNSP--LMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWS-----KEEFILNIRVIDVNDHAPVCPQIPDLMIFEGITP-GSVITTLQAYDRDSS--AKY-----NTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSST----------VNFVVHALDVESK-----------KCSFKILINV------------LD---INDNAPRFVHT--SIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILD-ESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAY----DSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPA---FSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLY----LGVRTLWVQVTDNGQPSLYCRVQVAVNVIRLS-NIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNN----NFFKIDSFTGAITTT 11690
            I+ +K +D+E+    Y + ++ +   SP    A + + I    ++  P  F+   Y + ISE  P G  V   K   +  + +       Y+L   E  V F+I+ + G + +   ++  + ++  L V+  +K G +    +TIS+ D ND  P + + P  D         G S      V  +SA D D + +   + + I + NL PF        +G +     LD E   +  +    ASD   W      + E  + IR+ +VND++P+  ++    +     P G  IT + A D D     KY     N L +  +      L + + LT   I N       ++T          +N  V    V SK           K + K+LI              LD   IN   P F  +  S     E+ P G+ I KI A DADSG N K+++ I D  + S F+ID +TG ++V   +DRE    + L I   D G P KS+   + I + D ND+ P FI     + + E + IG  +I ++A   D+G N EV+Y ++T+   F + S +G + +  +LD E    Y L + A DK        + V ++V   + N     F+P  +++    ++  L +G V A+    D D GL   + YS +       +N R         F I+  +G I L+   D E+Q  Y   V   D G P      S   V +   ++N + P F  P F  +  V  +  I    L+      + GR      DG       Q  + +   +  F      + DE  ++ A  +     +G   L V  TD G   LY  ++V + V  ++ N P   EP+    V  +S     K++ + ++   D   +          NE L  R+ +    NFF I+  TG ITTT
Sbjct:  176 IKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVKLSPEPIDVE-------YKLSPGEDAVYFKINPRSGLIVTARPLNTVKKEVYKLEVT--NKEGDL-KAQVTISIEDANDHTPEF-QQPLYDAYVNESVPVGTS------VLTVSASDKD-KGENGYITYSIASLNLLPFVIN---QFTGVISTTEELDFESSPEIYRFIVRASD---WGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAVSAIDIDELELVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSV---KVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLV-----NDYNGR---------FEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYF--PDFAVVGSVKENSRIGTSVLQVTARDEDSGR------DG-----EIQYSIRDGSGLGRF-----SIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSP----KDVSVIQIQAEDPDSS---------SNEKLTYRITSGNPQNFFAINIKTGLITTT 1058          

HSP 9 Score: 129.413 bits (324), Expect = 2.054e-28
Identity = 234/936 (25.00%), Postives = 386/936 (41.24%), Query Frame = 3
Query: 5400 YFEMDQNNGDIRVQRSLTAIRNRLLFLTIV--VSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQS--DGEKLSKSLKALVINAE------DPDEG-------------KNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDE-------NDCPPKFEKDFYLQVLILPTFP-SAPLLQLRVHDPD--LNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFD-GKFETSCN--ITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDGS----YDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKK---FTIGIKANDKGQPA-----LSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAI---SSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHST-TVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTI-SIKENLDFEACMIHEFWILVKYDGRFSPTNRA-HMQVHIVDENDNPPKFIQPAFNATISL--ESSQGSLVVIAMATDLDT--NSKLIYKVLNEYYN-IFKIDQSSGFI 8030
            YF+++  +G I   R L  ++  +  L +     DL       ++ V + I D    H+ P+ ++   D  V+E+  V +    L + +S K      Y+  SI       F + + TG I T   LD E   +I    ++   + G   R+ S ++V I I +VNDN+P F   +   G+IS     G  +   S  D ++L      ++   E      +PD G             KNG     I +             +  L  K+  +   SF     R+  K + KLL + +    + +ED        N   P F+K F   V +    P  A +L+++ +D D   N  +LF+I +G     F+ID  TG LK+    +P+  +   + L+NI  +D G  + S    +TIN  D   N  + ++ S  V  I E+     +++   A+      +  + Y +L++  +  IN  TG + +   LDRE +    L + A+    S    +  + + V + D ND  P F+   Y   V  +L        ++  D D G  G V YS+       Y+ +F ID  SG I +    SKEL  +K   + + ++A DKG+P           +V     +  +P F        V E++     V  V A    S     I Y+I +G+    F +D  +        VI     LD ET   + L + ATD      +ST  V I V D+ND  P+  +  Y   V EN P +  +I I       S+++ + + +     +S      F IN  TG I +    LD E    H   + V  DG  SP      + V ++DENDN P+F +  +   +       +G  +  A A D D   N+++ Y +++   +  F ID  +G +
Sbjct:  269 YFKINPRSGLIVTARPLNTVKKEVYKLEVTNKEGDL-------KAQVTISIEDAN-DHT-PEFQQPLYDAYVNESVPVGT--SVLTVSASDKDKGENGYITYSIASLNLLPFVINQFTGVISTTEELDFESSPEIYRFIVRASDW-GSPYRHESEVNVTIRIGNVNDNSPLF-EKVACQGVISYDFPVGGHITAVSAIDIDELELVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGENLADPMSINISVLHGKVSSK---SFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINRQGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETGQLKVL---MPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSV-NILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETHDPDLGLGGQVRYSLVN----DYNGRFEIDKASGAIRL----SKELDYEKQQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESG-------VITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRI-----TSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVT-DGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMV 1163          

HSP 10 Score: 123.635 bits (309), Expect = 1.087e-26
Identity = 187/758 (24.67%), Postives = 317/758 (41.82%), Query Frame = 3
Query: 1575 LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDI-SRTKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTD---SGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADS---KDIQYRLV--NFRRVFKIHSRTGWLRLRV-NLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPED--LPIGSFLVQLHATDADLDDNSQLRYAI-HGIHSDCFHCDTSTGAVHLLCKLSPLTEYRLIAVVKDNGKPQALSSQADFQI-YPQKVHPNRYIPSLKEPIITAAIRENCLPGTLV--TSIRPETSDKEPQSFVYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIIS 3794
            L I+V+D N+  PV + +   + + E++ IG  ++ ++A D D+ S  +++Y +    +  F +      +V V + LD E+ +  + +++   D   SG  +   V    ++ + DVN+  P F+  +  + +      DL +G  IA  E  D D     Q+  + V+     F I   SG + L     +    K   + + ++A D G                      RP+ L  V            +            + P F     P FA     V  ++E S  GT V ++T +  D  RD    E  + +        FSI   D  S  I  AD LDRET+  Y +T+   D+G           I+VED+NDN P   +    P+ + EN      ++QI+A D DS   + + YR+   N +  F I+ +TG +      LDRE++  + + +  +D     +  T    +   V D NDNKP F +  Y + LPE      G  + +  A D D   N+++ Y+I  G     F  D  TG V    + +  +   L     DNG+PQ  SS A   I + +K  P+    +  EP     + E+     +V   S++P  +        + I G +   +       G I     +D E+   Y + + + D      N  + +V+IKV D NDN P   +  Y  +++E++     ++ ++ATD D  +K +L Y + S
Sbjct:  667 LTINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQ-QFAINS-STGIVYVADQLDRES-KANYSLKIEARDKAESGQQLFSVVT--LKVFLDDVNDCSPAFIPSSYSVKVLE----DLPVGTVIAWLETHDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDY---EKQQFYNLTVRAKDKG----------------------RPVSLSSVSFVEVEVVDVNENL-----------HTPYF-----PDFAV----VGSVKENSRIGTSVLQVTARDEDSGRD---GEIQYSIRDGSGLGRFSI---DDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVEDVNDNAPLTSEPIYYPVVM-ENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQ--VLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFTAGSYDILTIKAVDNGRPQK-SSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEIVGVVSVQPANT-----PLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTDGT----NVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRD--EKHKLSYTVHS 1349          

HSP 11 Score: 120.553 bits (301), Expect = 9.909e-26
Identity = 173/769 (22.50%), Postives = 300/769 (39.01%), Query Frame = 3
Query: 1575 LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISR-TKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSF---QIPMTLPENYDIKKRIVQIKATDADSKDIQYRLVNFRR-------VFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHS-----DCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRP---ETSDKEPQSFVYTISGHSNG-ISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYF 3815
            + I + DVN+ PPV         V E    G  V  +QA D D S   ++ Y +   N     L + K  V+ +  N   + M+  + + V V+D       +  A   I +   N Y P F   T    +        K+ H  A D D      I  +I +  F +  F I      ++     +   L    + +I ++A D G  ++   +   VVD N                                               N P F T +     +R +  +G +V ++  +  D D D   S   + ++SE    V  +   D  +  +V     ++         +   D G P         I V      P  FL SF   Q   T+ E+  I   +  ++     S+++ +  VN  R       +F I   TG ++L   LDRE    +   + A+ +      +  T  + I V D+NDNKP+F  +SY   + E +P+G+ L Q+ A D D   N Q+ Y++H         + F+ D++TG +  L  L   T+  +    V  D G+  +LSS A   +    ++ N   P   + +    ++E+  PG +V  +     +TSD   Q   +   G+  G  +L  + +E ++     +DRE+++ Y+L I   D     + + + EV   V+D NDN P+ ++  Y A + E++     ++ V A DAD+     ++Y +       +F
Sbjct: 2230 VHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLS-NHRKQRMEPLYSLNVSVSDG----LFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAIIN-DFAKDRFLIDSNGQVITTERLDRENPLEG--DVSIFVRALDGGGRTTFCTVRVIVVDEND----------------------------------------------NAPQFMT-VEYRASVRADVGRGHLVTQV--QAIDPD-DGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKGNFNQLKNTVLSFFVKAVDGGIPVKHSLIPVYIHVLP----PETFLPSFTQSQYSFTIAEDTAIGSTVDTLRILP--SQNVWFSTVNGERPENNKGGIFVIEQETGTIKLDKRLDRETSPAFHFKVAAT-IPLDKVDIVFTVDVDIKVLDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNA--PVFAQEVYRGNVKESDPPGEVVAVLSTWDRDTSDVNRQVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDIYFLNITATD--GLFVTQAMVEV--SVSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIGSNGYIRYSLYGSGNSEFF 2927          

HSP 12 Score: 115.931 bits (289), Expect = 2.194e-24
Identity = 121/420 (28.81%), Postives = 190/420 (45.24%), Query Frame = 3
Query: 2592 VADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVE----DINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKD---IQYRLV----NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI-HGIHSDCFHCDTSTGAV----HLLCKLSPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGIS--LFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLIT-VKATDADMNKKTELKYKIIS 3794
            V   LD E    Y +TI   D          R E+ V+    D+NDNPP F D      TL E   I   ++Q+ + DADS++   + Y++V    N    F I S +G +     LD E   +  + + + D  F   SL++   + I ++D+NDN P+F +  Y   + E  P G F+  + A+DAD  D  +L Y+I  G     F  D+ +G +    H   ++ PL  Y L   V D       +S A  Q++ + +  N Y P+  +    A +REN   GT V  +R   +D +P ++        N  +   F I++ G++ T   +DRE      + I++    D         V + V DENDN P      Y+ASV  ++ G  HL+T V+A D D    + + Y + S
Sbjct: 2092 VVSPLDYEVTSAYKLTIRASDA-----LTGARAEVTVDLLVNDVNDNPPIF-DQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGF--PSLSSEVLVHIYISDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSNHRKQRMEPL--YSLNVSVSDG----LFTSTA--QVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVR--ATDGDPGTYGQISYAIINDFAKDRFLIDSNGQVITTERLDRENPLEGDVSIFVRAL-DGGGRTTFCTVRVIVVDENDNAPQFMTVEYRASVRADV-GRGHLVTQVQAIDPDDGANSRITYSLYS 2491          

HSP 13 Score: 115.931 bits (289), Expect = 2.194e-24
Identity = 148/605 (24.46%), Postives = 270/605 (44.63%), Query Frame = 3
Query: 2382 NIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEE-QMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRF-EIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKAT-DADSKDIQYRLV------NFRRVFKIH-SRTGW-LRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSD-KEPQSFVYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTM 4154
            N P+F T+    I I E    GT + ++  +  D D      +  + + S+ + + V      DS++  I     LD ET   +  ++   D G+  +        ++V DINDN P F    ++     +  D    +V + +T D D+ D+  ++       N R  F +   ++ W + ++  LDRE++D Y + I A+D  F  +++   +     V+D+NDN P+  + +Y+  LPED+P    ++++ A DAD+  N  +RY+++G  +  F  D  +G +  L  L    +  Y L+A   D G       Q++  +  + V+ N   P          + EN     L+T ++    D    +  VY+++  + G+     ++ G I     +DRE++ SY + +   D++       L  V I V D NDN P+ ER  Y  +V E+      ++ V AT  D+    E+ Y I SG+  G F I+      +    +D E  K       FY L V   D G P       +++N+ D        +NDN   F++ + + +I+   L   ++++  + A D+D   N  + +++
Sbjct: 2660 NKPVFETSSYDTI-IMEGMPVGTKLTQV--RAIDMDWGA-NGQVTYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQ--EVYRGNVKESDPPGEVVAVLSTWDRDTSDVNRQVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREEQDIYFLNITATDGLFVTQAMVEVS-----VSDVNDNSPVCDQVAYTALLPEDIPSNKIILKVSAKDADIGSNGYIRYSLYGSGNSEFFLDPESGELKTLALLDRERIPVYSLMAKATDGG---GRFCQSNIHLILEDVNDNP--PVFSSDHYNTCVYENTATKALLTRVQAVDPDIGINRKVVYSLADSAGGV-FSIDSSSGIIILEQPLDREQQSSYNISVRATDQSPGQSLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNEQGKFKINPKTGGISVSEVLDYELCKR------FY-LVVEAKDGGTPALSAVATVNINLTD--------VNDNPPKFSQDVYSAVISEDALVGDSVIL--LIAEDVDSQPNGQIHFSI 3230          

HSP 14 Score: 104.375 bits (259), Expect = 7.632e-21
Identity = 110/432 (25.46%), Postives = 199/432 (46.06%), Query Frame = 3
Query: 2358 NKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSK---DIQYRLVNFRR--VFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDAD------------LDDNSQLRYAI--HGIHSDCFHCDTSTGAVHLLCKLSPLTEYRLIAVVKDNGKPQALS-SQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRIN-NEGEIRTVSSIDREKEESYWLYIYIED 3590
            N P+F  R+          ++ + E+++ GT V  +   + D   +   +E  + + S  EQ  F I   +  +  I V++ LD E   ++++ +   D G P         I + D+NDNPP+F         + E+  +   ++ + A D DS+    I + +VN  R   F +    G ++++  LDRE+   Y +++ A  VD    ++++TAT+ I ++D+NDN P+FT  +Y+  + E+ P+G+ ++QL  TD D            L  N +  + +  HGI               ++ + +   EY L    KD+GKPQ +S +    ++  +  H    IP L+  I+T    E+  PG ++  I     D      V T +  S   SLF++N ++G+I  +  +D  K   Y L + + D
Sbjct: 3082 NPPVFERRDY---------LVTVPEDTSPGTQVLAVFATSKDIGTN---AEITYLIRSGNEQGKFKI---NPKTGGISVSEVLDYELCKRFYLVVEAKDGGTPALSAVATVNINLTDVNDNPPKFSQDV-YSAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNEFTVDPVLGLVKVKKKLDRERVSGYSLLVQA--VDSGIPAMSSTATVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLDPHGILRSA-----------VVFQHTESLEYVLCVQAKDSGKPQQVSHTYIRVRVIEESTHKPTAIP-LEIFIVTM---EDDFPGGVIGKIHATDQDMYD---VLTFALKSEQKSLFKVNSHDGKIIALGGLDSGK---YVLNVSVSD 3474          

HSP 15 Score: 97.8265 bits (242), Expect = 7.690e-19
Identity = 128/484 (26.45%), Postives = 222/484 (45.87%), Query Frame = 3
Query: 2382 NIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPY-ESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVD-KYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKR--IVQIKATDADSKDIQYRLVN---FRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGI---HSDCFHCDTSTGAVHLLCKLS-PLTEYRLIAVVK-DNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEP-QSFVYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIIS 3794
            N P+F   +P    ++ ++  GT++ ++T    DKD+ P  E  +V     +++   F I   + +S ++++ +  + +  + +Y +TI   D G+P   +    E+ +  +N   P F   F    T   N DI+    I+ I AT  + + I Y +++   F++ F I   TG L++   LD E    Y + I ASD     R+      L   V D+NDN PIF + +Y+  L E   IG+ ++Q+ + DAD ++N  + Y I       +D FH D+S+G +     L   L ++  + V   D+G P +LSS+    IY   V+ N   P   + I  + + E    G  VT ++   +D        Y+I   ++  S    +  G I   +   +  E  Y L + + D     +    A+V+I+V   N   P   ++ Y A V EN+     +I V+ATD D     ++ Y II+
Sbjct: 1930 NSPVFV-GLPYYAAVQVDAEPGTLIYQVT--AIDKDKGPNGEVTYVL----QDDYGHFEI---NPNSGNVILKEAFNSDLSNIEYGVTILAKDGGKPS--LSTSVELPITIVNKAMPVFDKPF---YTASVNEDIRMNTPILSINATSPEGQGIIYIIIDGDPFKQ-FNIDFDTGVLKVVSPLDYEVTSAYKLTIRASDALTGARAEVTVDLL---VNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFP-SLSSEVLVHIYISDVNDNP--PVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVITLSNHRKQRMEPLYSLNVSVSDG----LFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENVAAGTKVIHVRATDGDPGTYGQISYAIIN 2387          

HSP 16 Score: 93.2041 bits (230), Expect = 1.746e-17
Identity = 214/938 (22.81%), Postives = 364/938 (38.81%), Query Frame = 3
Query: 1527 IAVAMNDSLETKKT-FTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTKISYYLFDQ---NKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAP-IARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFI----AEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRL-----VNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSD-----CFHCDTSTGAVHLLCKL----SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNG-----ISLFRIN-NEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAEN---LQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXX--DREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHL 4229
            + +  +D+L   +   T+ + V DVN+ PP+        T+ E + IG  VL + + D D    K+ +Y   Q   N   +   +    +++    LD E +Q    ++V   DSG P ++  V+ H  I I+DVN+  P F     +  +S  AP     GHF+    A D D    D ++ SI S +  +  F +  +SG ++L    K  M      +++ +  +D GL +S   ++  V+ AN  S                                              P F+ +   V  +RE  A GT V  I ++  D D   Y  +  + + ++  +  F I   DS+   ++  +RLDRE   +  ++I V          F    + V D NDN P+F+ + +   ++  +      + Q++A D D   +  I Y L     V+   + +I    GW+  + N ++ K       + A  VD       +   + I V       P FT++ YS  + ED  IGS +  L      L   +     ++G   +      F  +  TG + L  +L    SP   +++ A +  +      +   D ++    +  N   P  +       I E    GT +T +R    D      V T S HS+      +  F I+ N G I T+  +D E + ++   +   D  +       A V ++VTD NDN P+  +  Y+ +V E+    + +  L T     +D+N+  ++ Y I  G+  G F++               DRE         D Y L +  +D     Q                  S +NDN  V ++   T L+      N  IL  +V+A D D   N  +RY+        L  S    F +D +SG L
Sbjct: 2106 LTIRASDALTGARAEVTVDLLVNDVNDNPPIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQ-HCTLKVRSIDSGFPSLSSEVLVH--IYISDVNDNPPVFNQLIYESYVSELAPR----GHFVTCVQASDADSSDFDRLEYSILSGN-DRTSFLMDSKSGVITLSNHRKQRMEPL---YSLNVSVSD-GLFTSTAQVHIRVLGANLYS----------------------------------------------PAFSQST-YVAEVRENVAAGTKV--IHVRATDGDPGTY-GQISYAIINDFAKDRFLI---DSN-GQVITTERLDRENPLEGDVSIFVRALDGGGRTTFCTVRVIVVDENDNAPQFM-TVEYRASVRADVGRGHLVTQVQAIDPDDGANSRITYSLYSEASVSVADLLEIDPDNGWMVTKGNFNQLKNTVLSFFVKA--VDGGIPVKHSLIPVYIHVLPPETFLPSFTQSQYSFTIAEDTAIGSTVDTLRI----LPSQNVWFSTVNGERPENNKGGIFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDVDIKV----LDLNDNKPVFETSSYDTIIMEGMPVGTKLTQVRAIDMDWGANGQV-TYSLHSDSQPEKVMEAFNIDSNTGWISTLKDLDHETDPTFTFSVVASDLGEAFSLSSTALVSVRVTDINDNAPVFAQEVYRGNVKESDPPGEVVAVLSTWDRDTSDVNR--QVSYHITGGNPRGRFALGLVQSEWKVYVKRPLDREE-------QDIYFLNITATDGLFVTQAMVEVSV-----------SDVNDNSPVCDQVAYTALLPEDIPSNKIIL--KVSAKDADIGSNGYIRYS--------LYGSGNSEFFLDPESGEL 2935          

HSP 17 Score: 83.9593 bits (206), Expect = 1.118e-14
Identity = 136/557 (24.42%), Postives = 236/557 (42.37%), Query Frame = 3
Query: 6873 NDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQP-----ALSSFTDVFVDI--VSDKSPL----------FDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPF-HTLIISATDPSSSLSHSTTVLITVLD-INDELPI-FLKSSYSASVSENMPINHEIISISVLLQKVSNSKI-VEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHD----FTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRE--RKSMHELRVVVSDYGNKHDFATVLIHV 8456
            ND +P+F    Y   +  +        +V A D D G NG      YY      DL F++   SGVI++ SG        ++ + I A D+G        +SS   ++V I  +++ +P            +K     +V  D L D     ++++S         I  G+  + F L     +L      I+   ++D+E+ P+ + L + A D  S    S    + + +   D +PI F K  Y  S+SE  P       + V + K+S   I VE+ L   ED+      +F+IN  +G I     L+     +++  +  K +G      +A + + I D ND+ P+F QP ++A ++     G+ V+   A+D D   N  + Y + +     F I+Q +G I   +  + E    S  +  F V   D    + H    NV++   ++ ++ P F        +S +F V   I  + A D D+ +   ++Y +I G +   F L+  +G L LKK+L     +     LR+  +D  N  D  ++ I V
Sbjct:    2 NDLRPLFSPTTYSVTIAESTPLRTSVAQVTATDADIGSNG----EFYYYFKNKVDL-FSVHPTSGVISL-SGRLNYDEKNRYDLEILAVDRGMKLYGNNGVSSTAKLYVHIERINEHAPTIHVVTHVPFSLEKEPTYAVVTVDDLDDGANGEIESVS---------IVAGDPLDQFFLAKEGKWLNE--YKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALKAVYIGNPTRDTVPIRFEKEVYDVSISEFSPP-----GVVVAIVKLSPEPIDVEYKLSPGEDAV-----YFKINPRSGLIVTARPLNTVKKEVYKLEVTNK-EGDL----KAQVTISIEDANDHTPEFQQPLYDAYVNESVPVGTSVLTVSASDKDKGENGYITYSIASLNLLPFVINQFTGVISTTEELDFES---SPEIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAVSAIDIDELEL--VKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGENLADPMSINISV 521          

HSP 18 Score: 82.4185 bits (202), Expect = 2.832e-14
Identity = 103/457 (22.54%), Postives = 200/457 (43.76%), Query Frame = 3
Query: 5112 LDTNNMYPEFLVSREQSNMYME--TLRNLAKSQSSVLNEMDKLSIQRHLDNSLIF---SFTW-IDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFA-SYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPD--LNPTILFSILNGKESRFFSIDPTTGWLKIST 6455
            ++T  +     + RE +++Y+   T+ +L   Q S    +  ++++   DNS +F   S++  I   S IGT +  + A D+D G NG++ +++  D+     F ++ + G + V   L         L I   D  +  +   SVV +++    ++   P    S   + V E+  V +++    L +    L     V  S+       F + +++G I     LD E+ Q   ++ ++ +     VS  +        +    +    +     + G + E++  G+ V               L + A D D G++G+I+Y I        F ID  +GV++ A  +DRE +GS+  L++   D+G   L S   +E+ I +ED ND  P   +  Y  V++  +     ++Q++  DPD   N  + + I +G    FF+I+  TG +  ++
Sbjct:  628 METGQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLL-TINVEDANDNSPVFIQDSYSVNILESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDT---QQFAINSSTGIVYVADQLDRESKANYSLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAW--LETHDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDYEK-QQFYNLTVRAKDKGRPVSLSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSV---------------LQVTARDEDSGRDGEIQYSIRDGSGLGRFSIDDESGVITAADILDRETMGSYW-LTVYATDRGVVPLYST--IEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTS 1059          

HSP 19 Score: 78.5666 bits (192), Expect = 4.231e-13
Identity = 72/233 (30.90%), Postives = 112/233 (48.07%), Query Frame = 3
Query: 1572 TLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDI-SRTKISYYLFDQNKLPFRLGEFKRN----VVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGL--VSSKMALNFSVVDANSRS 2249
            T+ I+V D+N+ PPV      ++TV E+T  G  VL + A   DI +  +I+Y +   N+     G+FK N     + V E LD E + +RF++ V   D G P A S +A   I + DVN+  P+F        IS  A     +   IAED+D      I  SI +       F++ P    L L+   K     +++ +++ +QA DSG+  +SS   +N  + D N  S
Sbjct: 3071 TVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGNE----QGKFKINPKTGGISVSEVLDYE-LCKRFYLVVEAKDGGTP-ALSAVATVNINLTDVNDNPPKFSQDVYSAVISEDALVGDSVILLIAEDVDSQPNGQIHFSIVNGDRDNE-FTVDP---VLGLVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNS 3293          

HSP 20 Score: 75.485 bits (184), Expect = 3.667e-12
Identity = 144/603 (23.88%), Postives = 250/603 (41.46%), Query Frame = 3
Query: 2634 MTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPM---TLPENYDIKKRIVQIKATDADSKDIQYRLV--NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHG----IHSDCFHCDTSTGAVHLLCKLSPLTEYRLIA--VVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDK-EPQSFVYTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDN--VFVFNRYLST----ELIN--YHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHL--FANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRL 4373
            +TI   D G+P+     R  I+        P  L +F  P    T+ E+ D    IV + +    +  + + +V  NF   F      G + +   LD E+R  Y + +  +D      +  A   + I V D NDN P F++ +Y + + ED+   + ++Q+ ATD D  +  +L Y +H     I    F  D STG ++   +L    + + I   +V+D   P   +     ++       N + P    P+  A++ E+   G+ V  +     DK E    +YTI   + G ++F+I    G I      D      + L I + D+    ++   A V I VT  +++ P      Y+A V EN+     +I + A       ++ L Y++  GD  G F+I+    + T+++++D E   S        ++  M S++ V  QI                    NDN  VF+F++Y  +      IN     L N+ ++I    A D D + NA + Y +       + ++  + F+VD  +G +   AN+              I  F  +V   D G+P +   SP EV I +
Sbjct: 1177 LTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPL-TFDEPFYNFTVMES-DRVTEIVGVVSVQPANTPLWFDIVGGNFDSAFDAEKGVGTIVIAKPLDAEQRSIYNMSVEVTD-----GTNVAVTQVFIKVLDNNDNGPEFSQPNYDVTISEDVLPDTEILQIEATDRD--EKHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLA---RVIVNVEDANDHSPYFTNPLYEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTG-NMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSAT-AIVRISVTMSDNSHPKFIHKDYQAEVNENVDIGTSVILISAI-----SQSTLIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSYQLIIQATNMAGMASNATVNIQIVDE-----------------NDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVI---RATDADSNRNALLVYQI-------VESTAKKFFTVDSSTGAIRTIANLDHET----------IAHFHFHVHVRDSGSPQLTAESPVEVNIEV 1723          

HSP 21 Score: 75.0998 bits (183), Expect = 4.597e-12
Identity = 114/453 (25.17%), Postives = 191/453 (42.16%), Query Frame = 3
Query: 2502 ESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQ-GQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRI-------VQIKATDADSKD---IQYRLV--NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRI-NNEGEIRTVS-SIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYF 3815
            +S  ++ V   +   +F+I   + +S  I     LD E    Y + I   +  G   N       IQ+ D NDN P FL S Q   +L E   I   +       + I+ATDADS     + Y++V    ++ F + S TG +R   NLD E   ++   +   D      +  +   + I V D+NDN P+FT+  +   L     +G  ++++ ATD D +   +L Y++     D F  D+++G + +         Y LI  V D GK     S +   I  ++   +       +   + +I EN    T V +I     ++  +   Y+I    N    F+I +  G I+T     DRE++E Y L +      D +    +    + + D NDN P+     Y A+V  + +    +  V A D D     E+ Y  +  D +G+F
Sbjct: 1548 QSTLIYEVKDGDINGIFTI---NPYSGVITTQKALDYERTSSYQLIIQATNMAGMASNATVN---IQIVDENDNAPVFLFS-QYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEGSLDHFLIDSNSGVLTIKNNNLSKDHYMLIVKVSD-GK---FYSTSMVTIMVKEAMDSGL--HFTQSFYSTSISENNTNITKV-AIVNAVGNRLNEPLKYSILNPGNK---FKIKSTSGVIQTTGVPFDREEQELYELVVEASRELDHLRVARVVVR-VNIEDINDNSPVFVGLPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTY--VLQDDYGHF 1980          

HSP 22 Score: 71.633 bits (174), Expect = 5.209e-11
Identity = 106/451 (23.50%), Postives = 196/451 (43.46%), Query Frame = 3
Query: 2487 DRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRL--VNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIH-GIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTS---IRPETSDKEPQS-FVYTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRND-EIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISG 3797
            DRD  + +  + V S  + +     R D  +  +  A+RLD E  DK+ + I V DQ  P      R  + VED ND+ P F +      ++ E+  +   ++Q+ A D D   + ++ Y +   N   +FKI    G + +    D      + + I  +D      S TA   +++ ++D  ++ P F    Y   + E++ IG+ ++ + A        S L Y +  G  +  F  +  +G +     L     + Y+LI +   N    A ++  + QI  +  +   ++ S     ++ A   N +  +L  S   IR   +D    +  VY I   S     F +++  G IRT++++D E    +  ++++ D    ++  +   EV I+VTD NDN P+  +A ++  +         ++ V ATD D     EL Y ++ G
Sbjct: 1336 DRDE-KHKLSYTVHSSIDSISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDANDHSPYFTNPL-YEASVFESAALGSAVLQVTALDKDKGENAELIYTIEAGNTGNMFKIEPVLGIITICKEPDMTTMGQFVLSIKVTDQGSPPMSATAIVRISVTMSD--NSHPKFIHKDYQAEVNENVDIGTSVILISAI-----SQSTLIYEVKDGDINGIFTINPYSGVITTQKALDYERTSSYQLI-IQATNMAGMASNATVNIQIVDENDNAPVFLFSQYSGSLSEAAPINSIVRSLDNSPLVIRATDADSNRNALLVYQIV-ESTAKKFFTVDSSTGAIRTIANLDHETIAHFHFHVHVRDSGSPQLTAESPVEVNIEVTDVNDNPPVFTQAVFETILLLPTYVGVEVLKVSATDPDSEVPPELTYSLMEG 1775          

HSP 23 Score: 68.9366 bits (167), Expect = 3.285e-10
Identity = 122/561 (21.75%), Postives = 217/561 (38.68%), Query Frame = 3
Query: 1575 LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDIS-RTKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSG--LVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADS----KDIQYRLV--NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTK-NSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL 3227
            + + ++DVN+ PPV  ++     V ENT     +  +QA DPDI    K+ Y L D     F +      +++ ++ LD E  Q  + I V  TD     + S +    I + D+N+  P F  +   +T+        ++    A   D      I   I S + +Q  F I+P++G +S+     + +  +   F + ++A D G   +S+   +N ++ D N                                               N P F+ ++ S + I E++  G  V  I +   D D  P   +  F + + +    F++   D     + V  +LDRE V  Y + +   D G P         I + D+NDN P F  +      + EN  +   I+Q+  TD DS        + ++  N    F +    G LR  V     +   Y + + A D         +   + + V + + +KP       + + + +D P G  + ++HATD D+ D   L +A+       F  ++  G +  L  L
Sbjct: 2967 IHLILEDVNDNPPVFSSDHYNTCVYENTATKALLTRVQAVDPDIGINRKVVYSLADSAGGVFSIDSSSGIIIL-EQPLDRE-QQSSYNISVRATDQSPGQSLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYLIRSGN-EQGKFKINPKTGGISVSEVLDYELCKR---FYLVVEAKDGGTPALSAVATVNINLTDVND----------------------------------------------NPPKFSQDVYSAV-ISEDALVGDSV--ILLIAEDVDSQP-NGQIHFSIVNGDRDNEFTV---DPVLGLVKVKKKLDRERVSGYSLLVQAVDSGIPAMSSTATVNIDISDVNDNSPVFTPA-NYTAVIQENKPVGTSILQLVVTDRDSFHNGPPFSFSILSGNEEEEFVLDPH-GILRSAVVFQHTESLEYVLCVQAKDSG--KPQQVSHTYIRVRVIEESTHKPTAIPLEIFIVTMEDDFP-GGVIGKIHATDQDMYD--VLTFALKSEQKSLFKVNSHDGKIIALGGL 3461          

HSP 24 Score: 65.4698 bits (158), Expect = 3.753e-9
Identity = 92/411 (22.38%), Postives = 174/411 (42.34%), Query Frame = 3
Query: 2604 LDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKR--IVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDY-YPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVY--TISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIY-IEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGD 3800
             DRE  + Y + +    +            + +EDINDN P F+    +P       D +    I Q+ A D D   + ++ Y L +    F+I+  +G + L+   + +  +  Y + I+A D        + + ++ + +  +N   P+F K  Y+ ++ ED+ + + ++ ++AT  +      +   I G     F+ D  TG + ++  L     + Y+L     D           D  +     +P    P   +P     + E  L GT V  +    +D E    V+   +    N    F I++  G I T   +D E  +   L +  I+     + +++L  +YI  +D NDN P+  +  Y++ V+E     H +  V+A+DAD +    L+Y I+SG+
Sbjct: 1892 FDREEQELYELVVEASRELDHLRVARVVVRVNIEDINDNSPVFVG---LPYYAAVQVDAEPGTLIYQVTAIDKDKGPNGEVTYVLQDDYGHFEINPNSGNVILKEAFNSDLSNIEYGVTILAKD----GGKPSLSTSVELPITIVNKAMPVFDKPFYTASVNEDIRMNTPILSINATSPE--GQGIIYIIIDGDPFKQFNIDFDTGVLKVVSPLDYEVTSAYKLTIRASDALTGARAEVTVDLLVNDVNDNP----PIFDQPTYNTTLSEASLIGTPVLQVVSIDADSENNKMVHYQIVQDTYNSTDYFHIDSSSGLILTARMLDHELVQHCTLKVRSIDSGFPSLSSEVLVHIYI--SDVNDNPPVFNQLIYESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGN 2287          

HSP 25 Score: 56.6102 bits (135), Expect = 1.734e-6
Identity = 63/212 (29.72%), Postives = 93/212 (43.87%), Query Frame = 3
Query: 1566 TFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRT-KISYYLFDQNKLPFRLGEFKRNVV-IVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPC-FSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSG 2192
            T  + I V+DVN+  P+         V EN+    +V+ IQA DPD S   K++Y +   N   F     K  ++      LD E  Q   F+ V VTD G    +S I    +++ D N+ KP+F  K  QI +  +         + A   DRD   N +IS + V       F I P++G +S    F  G    LT     ++A D+G
Sbjct:  981 TIEVYIEVEDVNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINIKTGLITTTSRKLDRE-QQAEHFLEVTVTDGGPSPKQSTI-WVVVQVLDENDNKPQFPEKVYQIKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFTAGSYDILT-----IKAVDNG 1185          

HSP 26 Score: 55.0694 bits (131), Expect = 5.412e-6
Identity = 41/118 (34.75%), Postives = 60/118 (50.85%), Query Frame = 3
Query:  459 LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDF 812
            L+RE+   YN++++   +S        S  T V I VLD NDN P+F   ++     E+ S  TQ+  V AT  D G N+EI Y      I S + +  F INP +G I  V ++ D+
Sbjct: 3043 LDREQQSSYNISVRATDQSPGQ---SLSSLTTVTITVLDINDNPPVFERRDYLVTVPEDTSPGTQVLAVFATSKDIGTNAEITYL-----IRSGNEQGKFKINPKTGGI-SVSEVLDY 3151          
BLAST of Ft-2 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 569.696 bits (1467), Expect = 4.504e-162
Identity = 946/4023 (23.51%), Postives = 1668/4023 (41.46%), Query Frame = 3
Query: 1749 LPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSG--APIARSVIAHYEIEIADVNEYKPEFVYKTC-QITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKM-ALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKY-----HMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKD---IQYRLVNFRR---VFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTEYR-----LIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRP-ETSDKE---PQSFVYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIIN----KILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTE---LKYKIISGDTWGYFXXXXXXX--XXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNI-LIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSENDK-SKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPS------YKTEAILLVAD-SLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKR-ATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILS-RFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAF--DGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVP-DLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKS-ALDREERPFVQLLVLAKGWDGS--YDYINVTVSVTDENDYKPMFLSEKYEFLV-HTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKY-SVIVPEDALKDFIVTTVKAISS----TGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT-------NSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHD--FTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGF--------DSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCS--IMTIQENNPLNHIVAMCRISSTEMKG-KWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSP-LMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIPDLMIF-EGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVE--SKKCSFKILINVLDINDNAPRFVHTSIAPFL-ENAPHG----SVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLV--KTDELTDECILLVAGSLYLGVRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHS---ETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRV------NNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKPNIFFARRL-DLKLI--HFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTI-IVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDH-FNQTILIGARNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQW-------GKSCSSLLNPCPTFATCIEKTINSLYSSA-VCDCS 13487
            LPF +G  K  ++ V   ++    +R +  +V+ +  G    +A   ++   IEI D N++ P F  K   Q  I    P D+ +     +  D+D  +N +I +   + + P   I+  +G ++L+   K G     T + I L     GL  S+M ALN                 L   KN   +P +         P   +ES       ++ P+F++  P ++ + E++  GT+V K+       D D   + F+  V  +       +   D  S +I VA  L +   +K       + ++  D G P     K  +++++D+N++ P+F D     + + EN    K I ++ A D D  +   I++ L N +    V  I ++TG ++L  +LDRE +D +   I+ASD  F  R   +   LTI V D+NDN P          +PEDLP G+F+  + A D D+  NS+L++ ++      F  D  +G + +     PL  ++     L   V D+G P  LS+     +    +  N       +    A++ EN   GT V  I   ET D++    ++  Y I G  +G   F I+ +G +RT   +DRE + +YW+ +   D   ++      + +  V+I++ D ND+ P+ ++  Y ASVAEN      ++ V+ATDAD         L +KI  GD   +F I  T     ++  R +DRE           ++L V I D G P+  + V + VN++D NDN+P+F             T+ I+++ +++     + R+ AVD D   NA + Y +               FS+D  +G++ A  S +I  +         ++ + V A D G P            R+ L+ N+   K    K S   ++   SD +              IP+ D      T  +++  DADG   + W+  SG P         T  +LL     L+ +GE + L I++ + + +    V I +       P F   S+   Q ++ +       IY +KA                          +P+++++ + +D +A++    +  ++G++ ++ P +  + +    +V+ +     ++    ++I D N+  P F+                                          +F ++D   ++  +L +++A D+D G NG + ++I + +   + F++D  +G++R+ + L      +  + + +  +       +  +++ IR+   S+  P  E ++ D  V++ T  +S      +     L      V   ++P+    F V   +G +   + L + + +  V     V+S +G       I  V   I   N ++P F   +   G I E+   GS V        LSKSL  LV++A D D G NG + Y +LS +    F +DQY+G +   +  D E +  +    ++  D G P   S     I++ + DEND PP+F  +     +ILPT     +      D D   ++ + I +  +S  FS+D  TG + +  ++    G      L ++  F  DGK   S  + I++  +T N      +++    + EN    P  ++L  A       H SI    ++      I+  TG +     ALDRE+   ++L+V AK  + +       V V + + ND  P+F+   Y+  + H+++      +  K ID D G+    + +I       Y   F I     V+  +  PS E    +F   + A D G         V + +V    P+F ++ Y +VI  E   K  ++  V A SS    +   I Y I +   +  F +DF    ++     ++++ + +Y    F       T P   ++ +   +I    I    P+F K  Y+AS  E+  I   +++I       +++  +E+SL          S+   I+  TG ++I   LD+E    ++  ++    G+   ++ A   V I D ND  P+FI+   +A IS  +  G  + I  ATD+DT       + KL+YK+++    +F I  ++G +   +    + L+         V V D  FT      V +        PP F  + +  +  EN  VN      VA    K     L++ +            ++    +D  TG + + + L+  R   +++ +VV D   +  F+T+ + V DIND  P     +Y  ++  S K   T    ++ + A D D      ++Y L+    SQ  + V    G +++    +   + + L+ T         A      P +    ATT        TV++NI  +  KV P  + S  + ++ E+  + +++   +   TE+   ++++VP S   D    F ++ + G I  K  +D E ++Q+++ +  R D +  + A  T+ +D+ D ND  P F        ISED  +G+ V    A D+D      I +SL     VE    F +++  GW+   S +D E+     L+  A+D+ G  T+   TI V DVND  P + K      + +  T           +   S KD+D      S  F+        F+    +  + ++LL  P   E  ++  QLK  A D +  +  +  +N++     D    CP+    +I  E    G+V+        +SS     +T+ L + +D  + VV    G V V      ++        H L ++  S+ C   I + + ++NDN P+ +   +   + EN P        I +I A DAD     +I +R++D+    F ID   G++ V   LD E     +L + ASD     K+ I    + ++D ND+ P F      ++V E   IG  L   +A   D     E   +     +F  L + +G LTL K LDFE      LTV A D G P L T   V I V+D NDN P+F    YV  + EN+   +  +  V A D DS     ++Y       E +  + +T +     F IN   G++ ++   D E+   Y  +V   D G P   S+  + I +ED+ND+ P F   +   L+Q   +  I  + LK            + D DGP N  PF  + +  +    F V  K + LT + +       YL    L V   D    +  C + + +   + S   P ++P+ +      +   E IIG+     +    D      +L F  V       R       + + F++D  TG I +   +  G+++ NV VT+   +T   + + + ++  D+I  A  I++ SM  + F  + + + + I  H L     S +  I                       S  S RR RR    D  V++L+         + K   +  R+K    ++    Q    ++   +C    +C+ G+C+  I ++      ++      +F+S   S  + CLC   F G RCE+  N+CA  PC  +++C P    S  + C CP    G  C  PS  + +  CL+E    A++S      G G+    L  +    RME+    +       +M  +      +L  +N   +   +A   T     +  S   + DG+WH + +S           + V  + LQ     + S +   H ++Q +++GA+  +   E        L + ++ C + + ++  K         V  +  G+       GCS +L  S C    C++ G C+     +  K  + C+C   ++G  CEI    C  SPC  G +C+   + + C CP+G TG  C+          SCS   N C T   CI    +SL SS  +C+C+
Sbjct:  434 LPFAIGS-KNGILRVSAKINRS--ERVYNFKVIASLHGINEKLAEKDVS---IEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVK---VDATDQDEGENGKI-VYKFTSELP-LEINANTGEITLVEVPKKGNSWPATVWAIDL-----GLPLSRMSALN-----------------LMFYKNGTKIPAKP-------KPIIIQESEN-----KHSPVFSS-FPEIVEVTEDAPIGTVVAKLQAN----DEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQF-DEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMR--VSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNS-EKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDP-ILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIG-GDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSE-------HELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTF-------------TQAIHHYSVRSKFAGKLCRIFAVDADEGENARLTYNITEGDAR---------FSID-NNGNIIA--SEAIHGDE--------SYALTVQATDHGTPGQQF-----AATRVVLTANSAGQKPRKSKNSPPEISGKKSDYV--------------IPISDADQVGLTVGKLEASDADGD-ELWWSISSGDPDSVFDVRQDTGQLLLAKKVELLKRGE-LRLNISVTDGQAWDHSTVIIQVSRQISQRPKF---SASHYQTDVSERVAVGTQIYTLKASGESLGT-------------------KPLVFNLFSVDD-VAMEDKIRVEPSSGNVIVMEPLDYEAARRIRAVVQVQQANMKSFATFSVNINDENDNSPYFVGHT---------------------------------------AFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEE-SLFKIDAKSGEVRLAKPLDPELQHVESI-LRIRAIDSAANSLKDEMSLHIRN---SNEAP--ETAKFDRKVYQTTLYDSTRPGTPVLVLNALHHGT--VSYKLEPNC-TFFEVHTLSGAVHLATWLTKLKHRKSVECTAIVESTEG----QQDIAKVIAKIIRTNQHSPIFRRQV-YRGTIRENMPTGSSV--------LSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSVDQYSGAIRTQMSFDFEKMKEY-SFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRFPSNSLDISMILPTANGVSVGGQTAQDMDSVGSLRYFIKD--QSVPFSVDSKTGDVLVKDSN----GISDMTKLFDLEVFVTDGKQSASYVMKISTI-STENSKFKFTRNEYHTSLIENTTLPPGSIILSVATIGDKLDHFSI----VNPHEAFFIHPGTGVISSSGIALDREKSAIIRLVVQAKSHEKNPVMARALVVVGIENINDETPIFMGTPYDITIGHSDIGTVV--LEPKVIDNDEGD----VVTISSENMPEY---FKI-VGGKVVLGKKLPSIEEEDLEFNFKLIAKDNGSVHRVE-EPVKIRVVDKARPVFSQNVYTAVISKESTKKSTVLVKVMAKSSLQSKSKGLIGYRILD--KKSPFSVDFLTGEVRLNN--LKMLAETNY---TFEVEAREVTRPKM-IAKAQVEIIVKSGITTHAPVFEKLKYTASTPESTSIGQRLLTIKATTSDENDT--IEYSL--------SGSKDIEIHPETGDVTITGQLDYEKTQKYDLKLVATSSGK-QVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDETLFNISPATGELSLARPVEQDDLVNEDTKKVLNVSVTDGMFTAYAKLVVEILRSGSMQPPPRFEQSHYVANALENTIVNKSALLTVAV---KGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAFSTLTLSVIDINDKPPFFVLPFYSTSISESAKEGDT----VMMVSATDDD--ENDTIEYSLLDGSESQFFS-VHPRQGTITVAKK-LEHKAGVTLSLTIK-------ATDSANPPHH----ATT--------TVEVNIASESVKV-PRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTI--RADAAGGVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSL-----VEENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLPFTIVVSDVNDSPPQFEKEEFNIDLHLPSTSP---------ILHFSIKDDDLSPNNVSQFFIPKGNEEGVFW----IDSNNDLLLKRPEIVENKMQ-YQLKVTAFDGVFETSTKVKINLK--SSKDSDIRCPEANKTVILAENSKKGTVVLG------ESSLLGPNVTFKLSD-NDGNVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFD---EIKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGEFEDKATIL---VTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVL-TVKALDVDSEHFGAVSY-------ELEIVSETTTDTPVLPFAIN-SNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEA--IGHRLLK----------FSVSDLDGPKNGAPFTVE-IQGDGAKSFKVNEKLELLTAKKLEYRKKDKYL----LTVIAKDVKGKTTDCPLTIFIR--QTSRHAPTMKPMKIQINTLQNELPEGIIGR----LKASDEDEEDQNGLLRFGLVEGSIQSPRAQVQESRSTHLFRVDPNTGDIWSDHSITQGLHTFNVTVTDSKFNTVSYVEVHVTSIDNDVIDHAVSIRIRSMSVDEFMRKHVKEFRRIISHHLNLNDDSSIQLISVQAVP-----------------STESERRSRRNSMED--VEILMTAQRGLGRGYLKPDHIYSRLKNDFQNMNDQSQRMRYQLITEMC-TTGVCLRGECREVIELIEDSWTKVS--TDDFSFVSPFHSRSAQCLCPDGFGGKRCEVETNQCAKSPCEQWQLCIPSVHNST-YECVCPLGMEGDKCSVPS-CQNDGKCLEE----AELS----VGGDGYFEISLSNEIET-RMELEIELKTTTHNGIIMWSRGKRDFHMLRLVNGTPEYHWNAGTGT----GIVTSKTSVVDGQWHRIAIS----RRQRRTRMTVDDEDLQEAFSPIGSTVINLHRYSQKLVLGAK--VDDGE--------LTDGVSACFRTISVDGMK---------VLKTRQGMKLFGAQPGCS-ALTSSPCNDLPCQHAGTCI-----SQGKSHFKCECPSRYSGNVCEIDLEPCASSPCPTGIQCIPFYNDYLCKCPNGFTGKHCEARGFEDHETSSCSK--NVCGTSGQCISIPRHSLESSDFICNCT 4045          

HSP 2 Score: 88.5817 bits (218), Expect = 1.650e-16
Identity = 56/196 (28.57%), Postives = 103/196 (52.55%), Query Frame = 3
Query:  147 MKVNGNLAMLLLVVVSCVELWKCIESLS--ISFTKPLYNVGIYQDQDVRKYV-AHYDFQMGIEKPEEEGKITYKIRD-SSEIFNTFEAESKLVGDFFYLRIRTKYTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFV--NENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYL 716
            MK +    + LL+    + L     S      FT PLYN+ + ++    KY  +    ++G+  PE++    +++ +   E  + F+A S+ VGDF +LRIR K    LNRE   FY++ ++ + + +     ET+ +  + ++V+DRND  P+F+   + +E    ++    + +  V A+DAD G+NS I++ L
Sbjct:    1 MKKHRVFHLFLLIFCKAISLVTTSSSTEQIFEFTAPLYNLSVEENSIGSKYARSENSTKIGVPLPEKDANCKFRVAEIVGEKSSLFKAHSRQVGDFVFLRIRYKGDNPLNRELKDFYDILVKAMCKRRDLSNLETTAR--IHLRVIDRNDASPVFLVGEQGYEAEIDDDLEPFSTVLRVEASDADIGINSAIYFSL 194          

HSP 3 Score: 59.3066 bits (142), Expect = 1.019e-7
Identity = 130/585 (22.22%), Postives = 234/585 (40.00%), Query Frame = 3
Query: 1515 RNLTIAVAMNDSLETKKTFTL---RISVQD---------------VNEFPPVVMNNGSVITVKENTEIGET----VLIIQAYDPDISRTKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRD-----PYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSK--------DIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTK-NSYSLALPEDLPIGSFLVQLHATDADLDD-NSQLRYAI 3158
            RN  + V  +D ++ +K   L   R+++QD               +N+  P ++     +++ EN    E     +  I A D D    +I + + D     F++ +    V +VK  LD+E +   FF   +V   G    ++ I    + + D N+  P F   T  + +        ++ HF A   D++  + I+            + + P                S +T+F + L A  +G+++    L+F  + A         +KL  V  D  VP   T ++ +      E  N P F              V  ++E S  G  V  +T+K  D D +      YE E V    ++   + F+I    + + D++++  +D E + KY++ +   D G+P        EI VED ND+ P F D   +   + E   I  R+++   +D D          +IQ    +  + FK++ +   L  +  L+  K+D Y + ++A DV         T  +          KP+  + N+    LPE + IG    +L A+D D +D N  LR+ +
Sbjct: 2959 RNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFD--EIKFRMVDDFGGLFQIDDINGVVTVVKP-LDSEILG--FFNLTVVASDGEFEDKATIL---VTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQN--ETIE------------YYLKP----------------SDVTSF-VNLNAQ-TGILTLAKPLDFETLSA---------LKLTVVAKDSGVPPLET-EAQVEISVMDENDNAPKFEKEKY---------VGKVKENSKSGEKV--LTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAI----NSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTF-DDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQG---DGAKSFKVNEKLELLTAK-KLEYRKKDKYLLTVIAKDVKGKTTDCPLTIFIRQTSRHAPTMKPMKIQINTLQNELPEGI-IG----RLKASDEDEEDQNGLLRFGL 3468          

HSP 4 Score: 58.9214 bits (141), Expect = 1.498e-7
Identity = 39/126 (30.95%), Postives = 52/126 (41.27%), Query Frame = 3
Query: 13278 SICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKS--CSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHCEIDGL 13649
            S C  +  V G K + T+ G K         P C    S  C+ L  PC    TCI +      S   C+C     G +C+ID++ C   P  C  G   C   ++ Y C C  G+ G HCE  G 
Sbjct: 3896 SACFRTISVDGMKVLKTRQGMKLFGAQ----PGCSALTSSPCNDL--PCQHAGTCISQG----KSHFKCECPSRYSGNVCEIDLEPCASSP--CPTGIQ-CIPFYNDYLCKCPNGFTGKHCEARGF 4008          

HSP 5 Score: 54.299 bits (129), Expect = 3.316e-6
Identity = 42/134 (31.34%), Postives = 65/134 (48.51%), Query Frame = 3
Query:  459 LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRG 860
            L+ E +GF+NLT+       S G+FE   K  +++ V+D+NDN P F    +     E+ SI  ++    A+  D+  N  I YYL  S +TS       ++N  +GI+  + K  DF   S L   + A   G
Sbjct: 3074 LDSEILGFFNLTVVA-----SDGEFED--KATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQ--NETIEYYLKPSDVTS-----FVNLNAQTGILT-LAKPLDFETLSALKLTVVAKDSG 3192          
BLAST of Ft-2 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 184.882 bits (468), Expect = 1.154e-45
Identity = 248/951 (26.08%), Postives = 422/951 (44.37%), Query Frame = 3
Query: 5724 LFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVIL-SRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILP--TFPSAPLLQLRVHDPDL--NPTILFSILNGKESRFFSIDPTTGWL----KISTNDIPVSGKFPSVVLINIRAFDG---KFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSALDREERPFVQLLVLAK--GWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAID-SNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS---STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSS-SLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLN----EYYNIFKIDQSSGFIR------FNQVPNIEK----LLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSF-----VMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHV 8456
            LF +   +G I    S+DRE +   +   ++V +Y+ +    ++  +V +H+ DV DN+P F       G I E A  G+ V               L + A D D G+NG+IEY +      +   I+  +GV+  A  +DRE + S + L +   DKG+PK  S   +EI ++  D ND  P F  D Y  V IL   T P A +  ++  D D   N  + +S+ +       +ID +TG +    +I   + P++          IRA DG      ++  +TIN  D   +    L  +Q +  + EN     ++    A    S  +  IKY +   +  + I+E +G +K    LDRE      L V A+  G         + V + D ND  P F  ++Y   +   + + +Q I +KA+D D  E+  + Y I       + +   +D  + G I   SG  K     K  + I A D+G        +VF+D V + +P F+   +SV +PE +   + V T+KA          I+Y+I   +  + F +D       P    I +   LD E +   ++I++A+D +S  L+ ST + + + DIND  P F  SSY+A++SE++P+    + +S +   +  + IV++ L   E SS  S Q FR++ T+GT+ +   LD E   +    I  +  G  S +  + + + + D NDN P F Q +++  I+  S  GS V   +A D D   N+ + +++      + ++I +  + +G +R      F+      K    L  SSG +   V V            ++   + ++ P+      +MN F     +N  +  +IG I A D D+N    L Y +    ++++   +  TG +L+K+   R        +  VSD  N        IHV
Sbjct:  212 LFTLDTMSGEIRLAKSMDREVLDKHI---LKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYF-GEIREDAPIGTTV---------------LSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETL-SLIRLDVIASDKGTPKRESTAMVEITVV--DVNDNAPVFASDSY-NVTILENITIP-AVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV--------IRAKDGAQPALSSTVPLTINVID-INDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFI-IDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSI---LDIGDQGAILSVSGELKR-QDHKVRVEISATDQGGLQGRCVVNVFIDDV-NSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI---DSSQFFRID-------PSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLN--ESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVR-----------IHVSDVNDNKPALKDFVILMNRF-----DNVQMARQIGFIPAFDPDQN--ATLEYFL---EENDLIEAEKYTGKILVKQEWKRNMDV--SFKTCVSDGANTECSTCRFIHV 1086          

HSP 2 Score: 177.948 bits (450), Expect = 1.312e-43
Identity = 212/816 (25.98%), Postives = 362/816 (44.36%), Query Frame = 3
Query: 9183 FDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDD-QGWVYSVSAVDYEETKLINLVVSASDKAGHV--TNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEE-FILNIRVIDVNDHAPV-CPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCS--FKILINVLDINDNAPRFVHTS-IAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQM-ITEQNFFRLESLSGNLTLIKKLDFELSRE---YFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXF--LPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPF--LVKTDELTDECILLVAGSL---YLGVRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRD 11573
            F   +Y   + ED P+ + +   KA    +     ++YS+       +   F +D   G +    ++D E      L V+A ++       +TT+ + V DV D  P + K+      EI E            V  + A+D DS    E + + +   N     A    ++SG +    PLD E  L  ++L  +ASD+    +E   ++ I V+DVND+APV      ++ I E IT  +VI T++A D D       + Y++   S    L ++  TG V +   +D + +S +  V+ A D      S    + INV+DIND+AP  +    +    EN   G  +G+++A+D DSG N  I Y +  E    F ID D+G+++   LLDRE    + L + A D G P  +  T + +VL D+ND+ P F      + ++E+   G  +IT+KA+ +D   + +++Y++   ++  F +  + G+   I  +  EL R+     + + A+D+G        G  +  V ++D      F   P+   IPE++ +    I  + A D D G N+ + YS                     FFRI+P +G+I ++   DRE++ T+   V+ +DH  P  ++ T + + ++D NDN P+F   S+   I  D    IP       G  F    L +   D     N      LN  + SP   L + D  +    L V+  L      V  L +   D G PSL    ++ + +  +++  P  E L+   +Y    + +G    +  ++ RD
Sbjct:  165 FQQEKYVKELPEDTPIETIIASVKA---SHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFG--EIRE-----DAPIGTTVLSVFARDLDSGENGE-IEYSLGEGNGKNLLAIN--AKSGVIQTAAPLDRE-TLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTN-GKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM--EGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDI-GDQGAILSVSGELKRQDHKVRVEISATDQG-----GLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVI-TLKAEDHDRGDNARIVYSI----------------DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISED----IP------VGTSF----LQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSG--TLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYD-LYIAENSPVGS--TVGTIVARD 918          

HSP 3 Score: 170.244 bits (430), Expect = 2.964e-41
Identity = 228/848 (26.89%), Postives = 384/848 (45.28%), Query Frame = 3
Query: 8280 LRYHVIGGFDSE---IFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFA--TVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYR---IATTVISCSINVTVKINI-LYDKKKVNPIITCSI--MTIQENNPLNHIVAMCRIS----STEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVY--DVNDEIPYWTKNPPVDGIEITETCDGCSETFPR--VVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVN------DHAPVCPQIPDLMIFEGITPGSVITTLQA--YDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVL--DINDNAPRFVHTSIAPFL-ENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSS-----FSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMI--TEQNFFRLE---SLSGNLTLIKKLDFEL---SREYFLTVRAS 10691
            L Y ++   DS    +F LD+++G + L K++DRE    H L+V   +  +    A  TV++HV D+ DN P+ E+  Y    I      GTT   +L + A+D D      ++Y L                              NL   N KS   V Q A  +  E L   R   IA+   +     T  + I + D     P+       +TI EN  +  ++A  + +     T  K  +S+  SS          ID + G +  ++ +D +      +          L +T  + I++ID ND  P    ++  I + E++ +G +V +  A D+D     +I YS+      E    F ID D G + +   +D E T   +L V+A D      NT+ TI+V   D+ND  P + K       E   T    SE  PR   +  L A DND E QK +      ++ +   ++   + + G +L +   + ++    ++++  A+D+    +   ++N+ + DVN      DH P   +IP     E    G  + TL+A  +DR  +A+   + Y++          ++P +G + V++ LDRE  +T + +V A D  S   +    I V+  DINDN+P+F  +S A  + E+ P G+   ++ A+DAD G N  IV   L+ES SS     F +DR +G +RV+S LDRE+     L I A D G P  S  + + + L DVND+ P F  +   L +AE++ +G  + TI A   D G NA++S+++    +   F +E     +G + ++ + +F+    + ++F  ++AS
Sbjct:  197 LYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSY-FGEIREDAPIGTT---VLSVFARDLDSGENGEIEYSLGE------------------------GNGKNLLAINAKSG--VIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSG----IGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM------EGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKK------EYNVTI---SEEMPRGSQIITLKAVDND-EDQKITYRIEEADREV---FSILDIGDQGAILSVSG-ELKRQDHKVRVEISATDQGGL-QGRCVVNVFIDDVNSAPYFNDH-PFSVKIP-----EHSPIGYPVITLKAEDHDRGDNAR---IVYSI---DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPN-GIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQAS 976          

HSP 4 Score: 154.451 bits (389), Expect = 1.848e-36
Identity = 186/651 (28.57%), Postives = 294/651 (45.16%), Query Frame = 3
Query: 9006 QNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLM-ATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSAVDYEE-----TKLINLVVSASDKAGHVTNTT--LTISVYDVNDEIPYWTKNPPV----DGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWS-KEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVI--VNAPLDREFSSTVNFVVHALDVES--KKCSFKILINVLDINDNAPRFV-HTSIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQN-----FFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTY 10886
            +N   I++  G I+    +D ET S  R++V      +P   +T  + I ++D ND  P+F +  Y + I E+I + + +   KA D+D+     + YS+    +  +G+     D    YS   V   E        I  V+ A D A    ++T  LTI+V D+ND  P       +    + + I E            V R+ A D DS          I   ++     +    +SG +     LD E   +   LK  A D    S      + + + D+ND+AP   +   ++ I E +  GS I TL+A D D   K   +TY + E       +++      I  V+  L R+    V   + A D      +C   + I+  D+N +AP F  H       E++P G  +  + A D D G N +IVY I  +S   F ID  +G + V+S LDRE +    +++ ASD   PP +  T ++++L D+ND+ PQF +      ++ED  +G   + + AI  DIG N  V Y +    +      FRL+  SG L +  KLD E      L + A D+G PSLS  + + + + DVNDN P F  L Y   I EN+ V   T+G + A D+D G N+ +++
Sbjct:  315 KNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSM----ASSSGIGGLTID----YSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEE-----------VGRVYAIDEDSGPNG------IIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTAR-YSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQK---ITYRIEEADREVFSILDIGDQGAILSVSGELKRQ-DHKVRVEISATDQGGLQGRCVVNVFID--DVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI--DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGS-TVGTIVARDADEGDNADISF 929          

HSP 5 Score: 153.68 bits (387), Expect = 2.765e-36
Identity = 213/927 (22.98%), Postives = 385/927 (41.53%), Query Frame = 3
Query: 6522 KFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVP-DLVLPRAKFYFSHQHPSIKYILLSEQPK-----VEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVTVS--------VTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIV--SDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS---STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNSKLIYKVLNEYYNIFKI----DQ------SSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVT--DINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAF--VDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLV------PSSSPFDVQNDFEIDSNYGYIR--AKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPP 9179
            K ET          N     +  ++ + V E+PE   D P + ++   K   +   P + Y +++ Q         ++ ++G ++L  ++DRE      L V A      Y+ ++ T+S        V D  D  P+F  + Y   +  +       + V A DLD+GENG + YS+   +    +L  AI++ SGVI   +   +E L     + + A+DKG P   S   V + +V  +D +P+F    Y+V + E+     ++ TVKA      T   + Y++ + +      +D++          + L  ++D +  P   +I +      +LS +  + I V+DIND  P  + +    ++ EN+ I  E+  +  + +    + I+++S++  ED        F I+  +G I   + LD E    +   +  +  G  S      + V + D NDN P F +  +N TIS E  +GS ++   A D D + K+ Y++      +F I    DQ      S    R +    +E      G ++ + +V+ F   V            N  P F  + F + + E+  +   +  + A D D+    R+ Y +     S+ F +D  +G + +   LDRE ++   + V  SD+ +     +  I V   DINDN P    + Y  T I      GT   S LQ+ A D D+ P   +DY L     S SI    +D  +G + +                 SKL+  Q A  V   P+++    T  +S +  +T+ ++ + D       ++  +  I EN+P+   V        +      +         +  FD++ D E +   G +R   +   D+E ++  +   E +  +  L +T  + I + D ND  P
Sbjct:  143 KLETRRTKRWARRRNPDANAVHFQQEKYVKELPE---DTPIETIIASVKASHASSQP-LYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTA------YERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLG--EGNGKNL-LAINAKSGVIQTAAPLDRETL-SLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGE-------VTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED--------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDV------------NSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS---SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAAT-ISEDIPVGT---SFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRV----------------SSKLDREQFAVIVL--PIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLY-IAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQN---GVVRILTRAEFDYEAKAN-KFFFELQASSGQLSSTVPVRIHVSDVNDNKP 998          

HSP 6 Score: 147.902 bits (372), Expect = 1.912e-34
Identity = 209/891 (23.46%), Postives = 375/891 (42.09%), Query Frame = 3
Query: 4923 EPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFS----FTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSD---GEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFP-SAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSV---VLINIRAFD-GKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVTVSVT----DENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDI--VSDKSPLFDKSKYSVIVPEDALKDFIVTTV---KAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELP 7532
            +P+ YS+ A  D  + Q LF +++ +G++RL   A +   +  D                 HIL              +   Y      ++ S + V++ +D   +Q   DNS IF     F  I   + IGT + S+ A D D G NG++ +++  +    N   ++  +G I+    L      L+ L ++ SD G P R + ++V + + D  ++ + P       ++ + EN ++ +++  +K            +  ++     G L  +  STG +     +D +       +   +++ DG     +S + + I++ D+ND+AP  +   K             ++ L+ +   GE++ +      + A D D G NG I+Y +    +  F ID+ +G++     +DRE    +  L +  +D G+P L       I ++++D ND  P F+K  Y  V I    P  + ++ L+  D D +  I + I       F  +D       +S     VSG+       V + I A D G  +  C   +N F +  N            +IPE+      ++  +A+ +    +  I Y + S Q    I+  +G + + S LDRE+R    ++V A   D +   +N +  +     D ND  P F S  Y   +  ++      ++V AID D G NG V Y +           F +D  SG + + S   +E       + I A D+G P+LS+ +++ + +  V+D +P F++  Y + + E++     V T+    A       I + I  G D +LFD++  A   Q G   I    + DYE K  +         S  LS +  V I V D+ND  P
Sbjct:  195 QPLYYSMVAPQDSRS-QNLFTLDTMSGEIRL---AKSMDREVLDK----------------HIL--------------KVTAYERVDPTISASTTVVVHVLD---VQ---DNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSL-GEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVD--VNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGL-TIDYSTGEVTLRERIDAKN----SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQK-------------MITLEENVAIGEEVGR------VYAIDEDSGPNGIIKYSM--EGSEDFIIDEDSGLIKTTKLLDRETTARY-SLKVTARDMGTPSL--NTSTTIAVVLKDINDNAPTFDKKEY-NVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILS-----VSGELKRQDHKVRVEISATDQGGLQGRC--VVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ-FFRIDPSSGDISVSSDLDREDRATFSVIVTAS--DHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFA-VIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAE--QNGVVRILTRAEFDYEAKA-NKFFFELQASSGQLSSTVPVRIHVSDVNDNKP 998          

HSP 7 Score: 130.954 bits (328), Expect = 2.156e-29
Identity = 187/758 (24.67%), Postives = 306/758 (40.37%), Query Frame = 3
Query: 1572 TLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRT-KISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIR--VLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSG--LVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADS-KDIQYRLVNFRR----VFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTI--SGHSNGISLFRIN-NEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISG 3797
            T+ + V DV +  P+   +     ++E+  IG TVL + A D D     +I Y L + N         K  V+     LD ET+     IR  V+ +D G P  R   A  EI + DVN+  P F   +  +TI         I    A D D      +  S+AS S      +I   +G ++L    +  + +K +  T  ++A D     +SS + L  +V+D N                              +H      + K I    N+ I    +  V  I E+S    I+ K +M+ ++        +F+                 D  S  I     LDRET  +Y + +   D G P         + ++DINDN P F D  +  +T+ E      +I+ +KA D D  + I YR+    R    +  I  +   L +   L R+      + I A+D       L     + + + D+N + P F  + +S+ +PE  PIG  ++ L A D D  DN+++ Y+I    S  F  D S+G + +   L       + +I    D+  P  L++    ++    ++ N   P        A I E+   GT    +    +D  P   V Y +  S  S  I LFR++   G +R  S +DRE+     L I+  DR    ++   +E+ + ++D NDN P  E+  Y   +AEN      + T+ A DAD     ++ ++I  G
Sbjct:  255 TVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLS---LIRLDVIASDKGTP-KRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG-LTIDYSTGEVTL----RERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDIN------------------------------DHAPTLIAAQKMITLEENVAI-GEEVGRVYAIDEDSGPNGII-KYSMEGSE--------DFII----------------DEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF-DKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVR-VEISATD----QGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASP-PLNTSTQIEVILDDINDNS--PQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSA-ASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGG 934          

HSP 8 Score: 126.716 bits (317), Expect = 3.958e-28
Identity = 185/783 (23.63%), Postives = 330/783 (42.15%), Query Frame = 3
Query: 1482 DLNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDI-SRTKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKN-CIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKD---IQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHS----DCFHCDTSTGAVHLLCKLSPLTEYRLIAV---VKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNEGE------IRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTE 3773
            D+ A D G+P+R  T  V               I+V DVN+  PV  ++   +T+ EN  I   +  ++A D D  +  K+ Y +   + +     ++    V ++E +DA+       IR      GA  A S      I + D+N++ P  +     IT+        ++G   A D D      I+ S+         F I  +SG   L+ T K         +++ + A D G  S   +   +VV                   DI                     N P F  +   +          I EE  +G+  Q IT+K  D D D    +  + +  E ++ VFSI       A + V+  L R+   K  + I+  DQG  +  C+   F   ++D+N  P  + +     + +PE+  I   ++ +KA D D  D   I Y  ++  + F+I   +G + +  +LDRE R  + +++ ASD    +  L  +  + +I+ DINDN P FT +SY+  + ED+P+G+  +Q+ A DAD+  N  + Y ++   S      F  D ++G + +  KL    ++ +I +    +D G P +LS+ ++  +    V+ N   P+ ++      I EN   G+ V +I    +D+   + + + I G ++   LF I  + E      I T +  D E + + + +  ++  + ++ + +   V I V+D NDN P  +      +  +N+Q    +  + A D D N   E
Sbjct:  344 DVIASDKGTPKRESTAMV--------------EITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRA---KDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED----FIIDEDSG---LIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVV-----------------LKDI-------------------NDNAPTFDKKEYNV---------TISEEMPRGS--QIITLKAVDNDED---QKITYRI-EEADREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQGGLQGRCVVNVF---IDDVNSAP--YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYS-IDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASD--HASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLD-REQFAVIVLPIFARDRGTP-SLSAASEITLTLSDVNDN--APTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADA-KLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFF-ELQASSGQLSSTV--PVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQNATLE 1034          

HSP 9 Score: 113.62 bits (283), Expect = 3.882e-24
Identity = 118/426 (27.70%), Postives = 199/426 (46.71%), Query Frame = 3
Query: 2568 DSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRF-LDSFQIPMTLPENYDIKKRIVQIKATDADS---KDIQYRL--VNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI---HGIHSDCFHCDTSTGAVHLL----CKLSPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGD 3800
            D+ S +I +A  +DRE +DK+ + +   ++  P         + V D+ DN P F  DS+     + E+  I   ++ + A D DS    +I+Y L   N + +  I++++G ++    LDRE      + ++ASD     R   +TA + I V D+NDN P+F  +SY++ + E++ I + +  + ATD D   N ++ Y++    GI       D STG V L      K SP+T    +   KD  +P ALSS     I    +  N + P+L        + EN   G  V  +     D  P   + Y++ G  +    F I+ + G I+T   +DRE    Y L +   D     +N     + + + D NDN P  ++  Y  +++E +     +IT+KA D D ++K  + Y+I   D
Sbjct:  216 DTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYF--GEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRE--STAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG--LTIDYSTGEVTLRERIDAKNSPITA---VIRAKDGAQP-ALSSTVPLTI--NVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLN-TSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQK--ITYRIEEAD 622          

HSP 10 Score: 107.842 bits (268), Expect = 2.548e-22
Identity = 240/1070 (22.43%), Postives = 421/1070 (39.35%), Query Frame = 3
Query: 3039 FTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIH----SDCFHCDTSTGAVHLLCKLS-PLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDRE--PLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENAT--DPKSENDKSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGP-FSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNT-KFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRA----TYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAI--KNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLF---------GVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSF 6167
            F +  Y   LPED PI + +  + A+ A    +  L Y++         + F  DT +G + L   +   + +  ++ V         +S+     ++   V  N   P  ++      IRE+   GT V S+     D      +    G  NG +L  IN + G I+T + +DRE      L +   D+      +  A V I V D NDN P+     Y  ++ EN+     + TVKATD D     ++ Y + S    G  +I  +    T    ID +  P+ +           +   D   P   +TV + +N+ID+ND+AP+ I           + ++I           +GRV A+D D   N  ++Y+M+            E F +D  SG +    ++ + D           + + V A D+G P++ T +   V ++  +++NA   D K  N              + I  +   GS+++++  VD  + +   +  +I++AD   FS++     G       AIL V+  L  Q  KV +EI+  +      +  V +FI   N + P FN     P  + I +H+              P  +P I   +       N      I+YSI +S       + F I+ ++GD+ + S  +     TF +IV A +  +    T  ++++ + D N+  P+F      S+ Y  T+                                  D+   +GT    +SA D D G NG + + +   + S ++  F +D+ +G +RV   L   +  ++ L I   D G P     S + + + D  ++ + P  E+   DL + EN+ V S +    +         A         +  KLF         GV R    I+T +  D E   +    ++Q  S      + +S + V+IH++DVNDN P                     V L +  + +  + +   I A DPD+  N  +EY +        + ++YTG + +  +  R +  SF
Sbjct:  165 FQQEKYVKELPEDTPIETIIASVKASHA---SSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNS--PIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTP-KRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV----------IRAKDGAQPALSSTVPLTINVIDINDHAPTLI----------AAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGS----------EDFIIDEDSGLI---KTTKLLDRETTA-----RYSLKVTARDMGTPSLNTSTTIAVVLK-DINDNAPTFDKKEYN--------------VTISEEMPRGSQIITLKAVD--NDEDQKITYRIEEADREVFSILDIGDQG-------AILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFN---DHPFSVKIPEHS--------------PIGYPVITLKAEDHDRGDNAR----IVYSIDSS-------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF-----TSSSYAATISE--------------------------------DI--PVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSD--VNDNAPTFEQLSYDLYIAENSPVGSTVG-TIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVR----ILTRAEFDYEAKANKFFFELQASS-----GQLSSTVPVRIHVSDVNDNKPAL----------------KDFVILMNRFDNVQMARQIGFIPAFDPDQ--NATLEYFLEEN--DLIEAEKYTGKILVKQEWKRNMDVSF 1066          

HSP 11 Score: 104.375 bits (259), Expect = 2.273e-21
Identity = 175/695 (25.18%), Postives = 297/695 (42.73%), Query Frame = 3
Query: 2382 NIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRV--FKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHL--LCKLSPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGI-SLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLY-LSENATDPKSENDKSKLYLA 4436
            N PIF  +      IRE++  GT V  +  +  D   +  E E+  G  + +  +       ++ S  I  A  LDRET+    + +   D+G PK       EI V D+NDN P F  DS+ +  T+ EN  I   I  +KATD D   +  + Y + +   +    I   TG + LR  +D +     PI  V    D    +L++T  LTI V DIND+ P        + L E++ IG  + +++A D D   N  ++Y++ G  S+ F  D  +G +    L        Y L    +D G P +L++     +  + ++ N   P+  +      I E    G+ + +++   +D E Q   Y I      + S+  I ++G I +VS   + ++    + I   D+   +  + +  V+I   D+ ++ P      +   + E+    + +IT+KA D D      + Y I   D+  +F I  +    +    +DRE   +       + + V  SD   P    +  I V + D        INDN   F        I+      T+ L  +V+A+D D   N  V Y +      + ++ +++LF +D  SG L     SS  D  Q   + +P F     A D G P++   + +E+T+ L  +++NA  P  E     LY+A
Sbjct:  266 NSPIFEKD-SYFGEIREDAPIGTTVLSVFARDLDSGENG-EIEYSLGEGNGKNLLAI-----NAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNV--TILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNS---PITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG--SEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTP-SLNTSTTIAVVLKDINDN--APTFDKKEYNVTISEEMPRGSQIITLKAVDND-EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGG-LQGRCVVNVFI---DDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI---DSSQFFRIDPSSGDISVSSDLDREDRAT-------FSVIVTASDHASPPLNTSTQIEVILDD--------INDNSPQFTSSSYAATISEDIPVGTSFL--QVSAIDADIGPNGIVDYFLN----ESSSSPSIQLFRLDRTSGTLRV---SSKLDREQFAVIVLPIF-----ARDRGTPSL--SAASEITLTLSDVNDNA--PTFEQLSYDLYIA 902          

HSP 12 Score: 88.1965 bits (217), Expect = 1.779e-16
Identity = 156/685 (22.77%), Postives = 285/685 (41.61%), Query Frame = 3
Query: 5298 SIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFP-SAPLLQLRVHDPDL--NPTILFSILNGKESRFFSIDPTTGWLKISTN-DIPVSGKFPSVVLINIRA-------------FDGKFETSCNITINSFDNTRNKVLP-----LEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSALDREERPFVQLLVLA--KGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIY-YVKPFAYDLKFAIDSNSGVITIQSGPS--KELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIV 7271
            +I  ++ ++ ATD+D+G NG++ +++ + S  +    +D + G++ ++  + A +N  +   I   D  QP     S V + I    ++   P L  +Q  + + EN ++         R       +    ++       + F +   +G I T   LDRE         ++V + D      N+  ++ + + D+NDNAP F    + N  ISE    GS +           +LKA+     D D+    +IE      F S   I     +LS++ ++ R+      D  +R++   + +   Q R  + + I+D N  P  +  D    V I    P   P++ L+  D D   N  I++SI     S+FF IDP++G + +S++ D      F  +V  +  A              D   + S   T +S+  T ++ +P     L+ S +  +I    N + D  L       S   PSI+   L        +  +G+L++ S LDRE+   + L + A  +G         +T++++D ND  P F    Y+  +  N    +    + A D D G+N  + + I+       +D++   + N GV+ I +      E    KF   ++A+  GQ + +    + V  V+D  P              ALKDF++
Sbjct:  389 TIPAVIATVKATDEDFGTNGKVHYSMASSS-GIGGLTIDYSTGEVTLRERIDA-KNSPITAVIRAKDGAQPAL--SSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGE----EVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRET---TARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF-DKKEYNVTISEEMPRGSQII----------TLKAV---DNDEDQKITYRIEEADREVF-SILDIGDQGAILSVSGELKRQ------DHKVRVEISATDQGGLQGRCVVNVFIDDVNSAP--YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI---DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADI--GPNGIVDYFLNE-----SSSSPSIQLFRL--------DRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQN-GVVRILTRAEFDYEAKANKFFFELQAS-SGQLSSTVPVRIHVSDVNDNKP--------------ALKDFVI 1005          

HSP 13 Score: 80.4925 bits (197), Expect = 4.423e-14
Identity = 120/474 (25.32%), Postives = 201/474 (42.41%), Query Frame = 3
Query: 2760 LPENYDIKKRIVQIKATDADSKDIQYRLV-----NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNR---SXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI-HGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRIN-NEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVR 4145
            LPE+  I+  I  +KA+ A S+ + Y +V       + +F + + +G +RL  ++DRE  D + + + A     Y R   +++A+ T+ + V D+ DN PIF K+SY   + ED PIG+ ++ + A D D  +N ++ Y++  G   +    +  +G +     L    L+  RL  +  D G P+   S A  +I    V+ N   P          I EN     ++ +++    D      V+     S+GI    I+ + GE+     ID  K       I  +D     ++  +  + I V D ND+ P    A    ++ EN+     +  V A D D      +KY +   +    F I     +  + + +DRE        T  Y LKV   D G P    +  I V + D        INDN   F++      I+    + + I+   + AVD D D   T R
Sbjct:  174 LPEDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTA-----YERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKR-ESTAMVEITVVDVNDN--APVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVP-LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED---FIIDEDSGLIKTTKLLDRET-------TARYSLKVTARDMGTPSLNTSTTIAVVLKD--------INDNAPTFDKKEYNVTISEEMPRGSQIIT--LKAVDNDEDQKITYR 617          
BLAST of Ft-2 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 179.874 bits (455), Expect = 3.855e-44
Identity = 311/1385 (22.45%), Postives = 579/1385 (41.81%), Query Frame = 3
Query: 6693 IKYILLSEQPKVE-----INEITGSLKLKSALDREER--PFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKK---FTIGIKANDKGQP---ALSSFTDVFVDIVSDKSPLF-DKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRL---VGKLDYETKPFHTLIISATD------PSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHE-----IISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSP--TNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVE-------------FQVLVHDF----THXXXXXXXXXXXXIKNHPPSFVMN---EFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVI--GG----FDSEIFGLDSLTGA-----LLLKKTLDRERKSMHELRVVVSDYGNK-HDFATVLIHVTDINDNIPVIEQAYYEVTV----ILSTKSTGTTLESILQLHAKDRDV-SPRHRMDYRLVSPPLSQSIAF--VDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCS--IMTIQENNPLNHIVAMCRISSTEMKG--KWSLVPSSS---PFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAI-FISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDD-QGWVYSVSAVDYEETKLI---NLVVSASDKAGH--VTNTTLTISVYDVNDEIP--------YWTKN-PPV--DGIEITETCDGCSETFPRVVYRLSAKD-NDSESQKESLHFLITNQNLNPFYAYFRVSE-SGEVLLLHPLDAE-KILKPLQLKFLASDRLHWSKEEFI-LNIRVIDVNDHAPVCPQIPDLMIFEGITP-GSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLT-----GRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINV--LDINDNAPRFVHTSIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITN--VKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKV 10517
            I Y L  + P+ E     I+  TG + L   LD ++   P +  L +    D    ++++T+ + D ND  P F    Y   V  ++      ++V A+D D G+N  + YS+        +  F+I+SN G I+ +     + L ++   +   + A D G+P   + S+   +  +  +D+S +F   S+Y+  V EDA     V  ++A  +    + Y+  + N      ++  +     G   +R       L     P +  +I   D      PS + +   T+LI + D+N+  P F   +  + +++ M   ++     I+ +       S +  + +SL   +  S    + F I+  TG ++   ++ F+        + VK   R            V +VD NDN P+F +P++  ++S   + G+ V+   A D D   N+++ Y +        +ID ++G    N +   E +   SG +              F V+  D          A V++N +  +   P +  +   +  ++V EN  +N  I R  A  S  ++   + Y +   GG     +S+    +          +++ + LD E+ + + L +  +D  ++     T ++ V D+ND +P      +  T+      +     T  + I+ + A D D   P++ + YR+V     +      +D +TG +     + N+  +      + K+++Y +  +  +  + +   A      ++ V + IN + D     P       I  ++E+    H V   +    +     ++ L+ +     PF V+ D       G I  K+ +DFE   QY + +     +    AT  + I + D ND  P F+  +YA   I ED+ +   +    A D D + K      +Y+L+       FRI    G +  V A+D +    +   N VV A D  G+  V    + ++V D+ND  P        Y  +N  P+  DG+   +               + A+D +D  ++  ++ + I    L    + FR+ + +G++  +  LD E    +   ++  A+DR   S+E F  + I+V D+ND+AP   +       E   P G+ + +  A+D D  AK N  TY L E SD + +  +  +     G + V  PLD E  +  +     + V   +   +  ++V  +D ND+AP     +     E+ P G+ IG+  A D D+G   +       + K  F+ID+D G +RVA  LDRE    ++L+IEA D      +NI    V + L DVND+ P+   +P      E+T + ++
Sbjct:  569 ITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVD-------NHNFSINSN-GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSES---RKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSL--------EIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEI-----FPNEKFD------REKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNA---PSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTD------SGTIFVKEPLDFEASDQYHLVL--IASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRI--VYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMD---------------VQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQD-GTLRVAHTLDREDIAVYNLIIEAYDN----SNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQL 1890          

HSP 2 Score: 175.252 bits (443), Expect = 9.101e-43
Identity = 312/1303 (23.94%), Postives = 540/1303 (41.44%), Query Frame = 3
Query: 5853 SIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGS--FV-DLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKF-EKDFYLQVLILPTFPSAPLLQLRVHDPDLNP-TILFSILNGKESR---FFSIDPTTGWLK----ISTNDIPVSGKFPSVVLI-----NIRAFDGKFETSCN---ITINSFDNTRNKVLPLEKSQVVWEIPEN--RNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVE----INEITGSLKLKS--ALDREERPFVQLLVLA--KGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSI----YYVKPFAYDLKF--AIDSNSGVIT-IQSGPSKELLGKKFTIGIKANDKGQP-ALSSFTDVFVDIV--SDKSPLFDKS---KYSVIVPEDALKDFIVTTVKAISST---GHTILYTITN----GNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEI-------ISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGR-------FSPTNRAHMQVHIV--DENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNSKLIYKVLNEYYNI--FKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSV-SENFTVNSEIGRIVASDSDKN-KFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRER----KSMHELRVVVSDYGNKH-DFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRD--VSPRHRMDYRLVSPPL--SQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPII--TCSIMTIQENNPLNHIVAMCRISSTEMKGK-----WSLVPSSSPFDVQNDFEI-DSNYGYIRAKKIMDFETQSQY-RINVEYRVDNSPLMATRTILIDLIDQND-CPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIP 9494
            S + + I I DVNDN P F  PL                +     E +  +   L + A D D G N +I Y + +     F I+   G +S  +++D + +    FV   ++  +D G P  LS   + I I  E+ ND    F     Y   +        P++Q++  D D +  T  F   NG+ ++    FSID  TG +K    +S  D+  +    ++ +I     +   +  K  TS     I I   +N + +     K   + +I E   + D P +V   A    S  +  I Y L   Q +      I+  TG L        DRE RP   + V A  +G      +   +V V D ND  P F    YE  V    +     I V A D DA  N  + YS+       +    DL F   ++  SG IT I+  P K    +KF   + A+D G P AL S   V ++++    K+P +  S   K  + V E+   + ++   +A+SS       ++Y +T     GN  E     F           + ++  LDYE    +TL ++ATD +S ++ + T ++ V D+ND +P F    ++ ++ E M  N  +       I     +   S+    E   +++ +++   ++HFRI+  TG I   E  D E   I  + + V+   R        +  N+ +++V IV  D NDN P F +  +   +     +G  V+   A DLD +S L Y ++        F +   SG I   +  + E    +S      ++  D  H+   NV ++   + ++ P F   ++  +V  E+  +   +  + A+D+D++ K  R+ Y + G    E+F +   +G + L K LDR+      S + +   + D GN    +A V ++V DINDN P+  +  +   +  + +   +     + + A+D D   +    ++Y +V   L   +S+  +D  TG +    S         L+   S    + I  +  +  + S            NVT+K+  + D     P    T    +++E  P+   V        + + K     + L   S  F V  D +   S+ G +R K+ +D+E  +Q    ++  RV +    A   + + L+D+ND  P I   + +   + ED+P G+ + +  A D+D  G    F    Q D       F ID  G +     +D E+  + NL++ A D + ++    + + + DVND  P
Sbjct:  624 SHVDLTIRIDDVNDNVPTFTRPL----------------YTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNH---NFSINS-NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAM-IHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKT---QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREK--IDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFE----ASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGY-IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRS---------LDREISSEREFIIEVRANDRGVPSRE-------GFANVTIKVTDMNDNA---PFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHR--VREDVPRGTSIGRYTATDRD-AGDTARFRINRQSDPKR---QFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGP 1870          

HSP 3 Score: 136.732 bits (343), Expect = 4.405e-31
Identity = 214/845 (25.33%), Postives = 356/845 (42.13%), Query Frame = 3
Query: 9015 FEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDL----IDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYD----KDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEET---KLINLVVSASD--KAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKI-LKPLQLKFLASDRLHWS----KEEFILNIRVIDVNDHAPVCPQIPDLMIF--EGITPGSVITTLQAYDRDSSAKYNTLTYTLME-----CSDPYLLVVEPLTG----RVIVNAPLDREFSSTVNFVVHALDVESKKCSF---------KILINVLDINDNAPRF----VHTSIAPFLENA--PHGSVIGKIHAVDADSGINRKIVYRIL---DESKSSFSIDRDTGIMRVAS--LLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITE-------QN---FFRL-ESLSGNLTLIKKLDFELSREYFLTVRASDKGYP-----SLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLY-WLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKK-NGDMFEVGRLHIKDKDGPTNSNPFQ-CKLLNAETVSPFLVKTDELTDE 11342
            F +D   G +R      +E    YRI+ +  +D SP   T + L ++    I  ++ PP F    Y + +SED  +   V+  KA      +D   K  I YSL      +    FRID   G ++    +D+++    KL  L V+A +  +  HV    LTI + DVND +P +T+  P+   ++ E          + + +++A D D+      + + + N N       F ++ +GE+     LDA+++  +    +F  + R H          +++IR  + ND + V         F  E    G+ +  +QA D D     + +TY+ M+          L  ++  TG    R  V+A    E  + +N  V   D +   C +          +LI + D+N+N P F     ++ IA  +E         I K+ A D DS  N  IVY +     ES+ +F IDR TG++  +   + DRE +P   + ++A+D G  P        + ++D+ND+ PQF     +  V+    +G  +IT+ A  +D   NAE++Y +  +       QN   FF L    SG +TLIK +  + ++++   V A D G P     S   T  V+ +              P +  + EN  ++K+ + +  A  S    NS + Y       P  K    S       F   N     + +  + D E+   Y   ++ TD      S+KT V +E+ D ND  P+F    F   I  +   + P++ L+K NG      +    D DGP N   ++     N E    F +  DELT E
Sbjct:  472 FIVDPKSGVVRTG-WSKYERGDTYRISAQA-MDLSPSDNTTSQLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVD---LTIRIDDVNDNVPTFTR--PLYTAQVREDI-----PLNQTILKVTAVDKDT-GDNSRITYSVDNHN-------FSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADR----DEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQD-DGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMK-TQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGI-TVDENVELNKVIL-RCRAVSSGDSRNSDVIYKLTASGGPGNKA--ESKFRQFNKFENGNEWVEVVIMEGL-DYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEE---MTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRI--DELTGE 1279          

HSP 4 Score: 136.346 bits (342), Expect = 5.342e-31
Identity = 351/1594 (22.02%), Postives = 634/1594 (39.77%), Query Frame = 3
Query: 5862 SVKIHIADVNDNAPRFL-GPLKLNGIISESANPGSLVFL------QSDGEK--LSKSLKALVINA--EDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVH------DPDLNPTILFSILNG---KESRFFSIDPTTGWLKIST---NDIPVSGKFPSVVLINIRAFDGKFETSCNITI---NSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEIN-EITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYIN----VTVSVTDENDYKPMFL-SEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLK---FAIDSNSGVITIQSGPSKELLGKK---FTIGIKANDKGQPAL------SSFTDVFVDI--VSDKSPLF-DKSKYSVI--VPEDALKDFIVTTVKA-----ISSTGHTILYTI--TNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSS-LSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFR-------INGTTGTISIKENLDFEACMIHEFWILVKYDGRFSP---TNRAHMQVHIVDENDNPPKF-----IQPAFNATISLESSQGSLVVIAMATDLDTNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLP---SSGVVEFQVLVHDFTHXXXXXXXXXXXX---------IKNHPPSFVMNEFHMSVSENFTVNSEIGRI----------VASDSDKNKFGRLRYHVIG---GFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDY---------GNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNL---------GLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISST--EMKGKWSLVPSSSP---FDVQN-DFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYE---ETKLINLVVSASDKA--GHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQ--KESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILK--PLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAP--FLENAPHGSV-IGKIHAVDADSG 10241
            +++IH+AD+ D  P F+  PL +  ++  +   G +V+         DG+   L K++  +   +   DP  G       V+ + ++ Y + D Y             +    +DLS    D  + +L     + I+ I+ DE   PP+F K  Y   +         ++ ++        D      I +S+       E+++F IDP+TG + ++     D P     P +  + + A +   E+  ++TI   +  DN      PL  +QV  +IP N+     ++   A    +  +  I Y + +    +  N EI+  ++L  A    ER FV    +     G    ++    + +   + ND   +FL + +Y   V  +       I+++A D D  E   V YS +  K      K   F+ID ++G++ ++ G S   L +      + +   D G   +      +S+  + + I  V++  P F D +KYS I  + E   K    T VK       SS    I+Y++  T     + F +D     L P P V+      D ET+P   + + ATD     L       + V+DIND  P F + SY  SVS    +   +I++       +++  + +SL++    +    +H         +N  +G I++ + +  +     +F   V  D    P    + A + ++++D+    PK+      +P      ++E ++  L   A+++    NS +IYK+        K +  S F +FN+  N  + +      G+   QV  +  T +     S    +         + +  P F ++ F  ++ E  T N  + +           + +DSD  +   + Y ++G   G +++ F +D LTG +   +  DRE+  M+ L V  SD          G   D   V I + D+NDN P  E+  Y    I   K +      ++ + A D D     R  Y L+     +    V + +G + +K     + S+          G +N  + + ++              + ATTVI   +++   +  ++         +  I+   E    + +  + + S T   +K      P+  P   F VQ  D + +   GY            +  ++NV    DNSP+   R  L   I++N   PI  +  Y  F+          +Q + +D        I Y + +   +     FRID + G ++++ ++D E   E + I + V A+D+          +TI V D+ND  P++ K      +E T        +F        AKDN    Q  +ES +F +T    +      + S  G + +  PLD E + +     L    SD  H    E  +++ ++D NDHAP      +  + E +  G+ I    A DRD+    +T  + +   SDP         G + V   LDRE  +  N ++ A D  +      + + + D+NDN P   +T   P  F EN P   +   +I A D D+ 
Sbjct:  408 TIRIHVADI-DEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLYKTIDVIPAGSFIVDPKSG-------VVRTGWSKYERGDTY------------RISAQAMDLS--PSDNTTSQL---SEVAILEILADER--PPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPA---LPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQT----ILKVTAVDKDTGDNSRITYSVDNHNFSINSNGEISAKVRL-DADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDE---VTYS-FMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVV-----FDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEI---DTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKT---QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAE--SKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQ-NEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKY----IGRVKESEGEGHDVITIKAHDLDKHSNLR--YHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGY------------ADVQVNVRDINDNSPIFPER--LFGYIEENR-EPIHSDGVY--FMD---------VQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFI-IEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDS------KQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRH--DAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAG---DTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPE-PYTVPRPCIFRENTPVNQLGTCEIRATDRDTA 1903          

HSP 5 Score: 117.857 bits (294), Expect = 2.288e-25
Identity = 132/470 (28.09%), Postives = 215/470 (45.74%), Query Frame = 3
Query: 2463 ITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQ---------GQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADS-KDIQYRLVNF---RRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLA-LPEDLPIGSFLVQLHATDADLDD-NSQLRYAIHGIHSD-CFHCDTSTGAVHLLCKLS-------PLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLP----GTLVTSIRPETSD---KEPQSFVYTISGHS--NGISLFRIN-NEGEIRTVSSIDRE--KEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKK 3767
            +T+K  D D D  ++E  + +  E         R D  + +I   ++ DRE +D Y +T+   D+         G  K+ +  + +I + D+NDN P F +   I   + E+      ++ IKA D D   +++Y L+     R  F + + +G + ++  LD E  D Y +V++ASD         AT  + I + D+NDN P F +  Y+   + ED+ I   L  +HATDAD D+ +S++ Y + G  +D  F     +G + L+  L        P   + ++  + D+G    L   AD Q+  + ++ N   P   E +    I EN  P    G     ++    D    E  +  Y I  +   NG S+FRI+ N G+I  + S+DRE   E  + + +   DR      +  A V IKVTD NDN P  E+  Y+ SV E       +++  A DAD   K
Sbjct: 1239 VTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNV--KVQIVINDVNDNAPSFEEQKYIGR-VKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-----GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNF-VVQAIDDDGN--GLVGYADVQVNVRDINDNS--PIFPERLF-GYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPS-REGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAK 1693          

HSP 6 Score: 115.161 bits (287), Expect = 1.546e-24
Identity = 268/1051 (25.50%), Postives = 433/1051 (41.20%), Query Frame = 3
Query: 8820 INVTVKINILYDKKKVNPIITCSIMTIQ--ENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQN-DFEIDSNYGYIRAKKIMDFETQSQ----YRINVEYRVDNSP--LMATRTILIDLIDQNDCPPIF-DNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVS--FRIDDQ-GWV---YSVSAVDYEETK-LINLVVSASDKAG--------HVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHP---LDAEKILKPLQ-LKFLASDRLHWSKEEFI-LNIRVIDVNDHAPVCPQIP---DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTL---------MECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALD---VESKKCSFKILINVLDINDNAPRF-VHTSIAPFL---ENAPHGSVIGKIHAVDADSGINRKIVYRILD--------ESK----SSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFI------NIPIKLRVAEDTEI--GKVLITIKAI-SDDIGVNAEVSYQMITEQN-----FFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXX-------XXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSD--SGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRTLW---VQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRD-RSPAFDMLTFEF--VYNETLKSRVNNNFFKIDSFTGAITTTEMLD 11702
            +++T++I+ + D     P  T  + T Q  E+ PLN  +   ++++ +   K +   S   + V N +F I+SN G I AK  +D +  ++    YR NV  R    P  L ++  I I   + ND   +F   S+Y  F++ED   G+ VIQ +A D D   +D + YS    +   T     F ID+  G V   + VSA D  E +  INL V   D           H +  TL I + DVN+  P +         +I +  +G  +T P  + ++ A D+DS +  + ++ L   Q+ +     F +     VL   P    D E   +P + +   A+DR       F   ++ V+D+ND++P   +      +  FE +  G+ + T+ A+D D+ A    +TY+L          +    +  +V   +G + +  P+  +    + F V A D    E+ + S ++ +NVLD    AP++       P +   EN     VI +  AV +    N  ++Y++          ESK    + F    +   + +   LD E+   + L + A+D      S  T V + + DVND  PQF        I  ++   E  E   GK ++T+KAI +D  G   EV Y+++ E N      FR++ L+G +   +K D E    Y LTV ASD+   +L    G     V V        DN P F    Y+  + E+       I  + A+D D  S L   L  +    +P                F +   +G IF+    D E    Y   +  +D      ++ TNV I IED NDN P+F Q  +   +      I  D ++ K   +F V   H  D D    S+    +L        F +     T E +  +      GV + W   VQ  D+    L     V VNV  +++  P        Y+  + E I    +    V  RD   P  +    E+  V N+ +      + F+ID  TG I     LD
Sbjct:  626 VDLTIRIDDVNDNV---PTFTRPLYTAQVREDIPLNQTI--LKVTAVD---KDTGDNSRITYSVDNHNFSINSN-GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYS--DIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSES--RKAFVIDRQTGVLTPSPHVVFDRE--TRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAV--GTSVITVFAFDNDA-AHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFI-FNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVI-TIKAHDLDKHSNLRYHLIGAGGGRIP----------------FGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTV------IEEDVDIPKV--LFNV---HATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPS-WNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGE---SVFRIDQNTGKIFAMRSLD 1618          

HSP 7 Score: 88.5817 bits (218), Expect = 1.446e-16
Identity = 159/657 (24.20%), Postives = 273/657 (41.55%), Query Frame = 3
Query: 9336 FRIDDQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLH----------FLITNQN--LNPFYAYFRVSE----SGEVLLLHPLD--AEKILKPLQLKFLASDRL-HWSKEEFILNIRVIDVNDHAPVCPQIPDLMIFE-GITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDV----ESKKCSFKILINVLDINDNAPRFVHT-SIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLV----IEASDCGKPPK-SNITNVKIVLLDVNDSPPQFI-NIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMI-------TEQNFFRLESLSGNLTL---IKKLDF-ELSREYFLTVRASDKG----YPSLSTTTGXXXXXXXXXXXXXXXXF-----LPYVFNIPENTLVSKL-TIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFL--NFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSF 11144
             +IDD G ++ +  ++YE+T  I   V  +      T T + I V D+ DE P +  N P+  + +       + T  R+VY+  A+D   +     L+          F++  ++  +   ++ +   +    S + + L P D    ++ +   L+ LA +R   ++K+E+ + +   ++ D++ V  +      FE G + G +  +L+    +   K+                 ++P TG + +   LD  F       +H L V    ++++    + I + D+NDN P F      A   E+ P    I K+ AVD D+G N +I Y +      +FSI+ + G +     LD ++  E H V    + A D G+P   S+   + I   + ND    F+        VAED + G  +I I+A   D     EV+Y  +        + N F ++  +G + L   +   D  E      LTV   D G    YPS + T+   + +   + N  +  F        +  I E T  +   TI KV A D DS  N  + YS  Y   E +             F I+ +TG +    + V DRE +P     V  TD G          ++E+ D NDN P+F +PS+
Sbjct:  370 LKIDDDGKIHLLKPLNYEKTSSIIATVPINGLQSTRTQT-IRIHVADI-DEPPSFV-NSPLPMLAVVP----LNPTIGRIVYQFVARDEHGDGDSNVLYKTIDVIPAGSFIVDPKSGVVRTGWSKYERGDTYRISAQAMDLSPSDNTTSQLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKW---------------FRIDPSTGIIHLTRLLD--FDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV---DNHNFSINSN-GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESR-----------KAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSY 984          

HSP 8 Score: 85.8853 bits (211), Expect = 1.036e-15
Identity = 172/724 (23.76%), Postives = 286/724 (39.50%), Query Frame = 3
Query: 1638 ITVKENTEIGETVLIIQAYDPDISRTKISYYLFDQNKLPFRLGEFKRNV------------VIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDR-DGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDAD----SKDIQYRL--VNFRRVFKIHSRTGWLRLRVNLDREKRDYYP---IVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPI---GSFLVQLHATDAD--LDDNSQLRYA------IHGIHSDCFHCDTSTGAVHLLCKL----SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQS--FVYTISGHSNGISLF-----RINNEGEIRTVSSIDRE---KEESYWLYIYIED-RNDEIINKILAEVYIKVTDENDNCP 3665
            ITV EN E+ + +L  +A     SR     Y    +  P    E K               V++ E LD E +   + + +  TD  + +A +    + +E+ DVN+  P+F       TI  +   +        E L++ +G+  + +         P   +H      +     KH  + +LT      +  D      K+ +    V+A+ RS+S  P      K+++ V         IN  N+    N P F  +           +  ++E   +G  V  IT+K  D D+       + G      ++ F + RTDS +  I V + LD E  D+YH+ +   D    ++       I +ED+NDN P+F         + E+ DI K +  + ATDAD    S  I YRL       VF+I   +G + L   LDR+     P    V+ A D D     L   A + + V DINDN PIF +  +        PI   G + + + A D D    +N+ + Y       I+G     F  D +TG +  +  L    S   E+ +     D G P   S +    +  +    N   P  ++     ++ E    G  V S     +D+E +   F Y +S  S+   +      + ++ G +R    +D E   + + + L I + D R+D       A V++ + D ND+ P
Sbjct: 1103 ITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNN-YTLTLTATDMTSRVAST--KTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPN--------EHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDR----EKIDMYILTVEASDRSVSALPGANGPNKDNVKV------QIVINDVND----NAPSFEEQKY---------IGRVKESEGEGHDV--ITIKAHDLDKHSNLRYHLIGAGGG--RIPFGV-RTDSGT--IFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDD--GNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLING--ESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVP---SREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHD-----AEAAVHVALVDRNDHAP 1770          

HSP 9 Score: 83.1889 bits (204), Expect = 5.971e-15
Identity = 145/572 (25.35%), Postives = 229/572 (40.03%), Query Frame = 3
Query: 2424 IREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSA------DIVVADRLDRETVDKYHMTIAVCDQGQPKNCIF--------KRFEIQVEDINDNPPRFLDSFQ---IPMTLPENYDIKK-RIVQIKATDADSK---DIQYRLV----NFRRVFKIHSRTGWL--RLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI---------HGIHSDCFHCDTSTGAVHLLCKLSPLTEYRLI--AVVKDNGKPQALSSQADFQI----YPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETS-DKEPQSFVYTISGHSNG-----------ISLFRINNEG-EIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHL--------ITVKATDADMNK-KTELKYKIIS---GDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGV 3938
            + E++  GT V +I  + AD+D   Y      G  S ++  +FSI   D H+        +  AD  + E  +  ++T+ V D G    C++            I +ED+N+N P F D  +   I   +   Y      IV+++ATD DS    DI Y L       R+ F I  +TG L     V  DRE R    + + A+D    +R L      ++ V DINDN P F + SY  ++     +G+ ++ + A D D   N+++ Y++         H    D F           L K  P+   + I   +  DNG P+AL S A   +      QK    +  P  K P IT  + EN     ++   R  +S D      +Y ++  S G            + F   NE  E+  +  +D E+  +Y L +   D    + +       ++V D ND  P      +  ++ E +    HL        +TVKA D D +  + E+ Y+I+    G+   +F I             DRE +       D Y L V  SD  V
Sbjct:  757 VAEDAQGGTPVIQIQARDADRDEVTYSFMDKNG-RSTQKMNLFSI---DEHTGLVKLRHGVSAADLAEAE--NPINLTVIVQDDG--SCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRG--DRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCK-PGIT--VDENVELNKVILRCRAVSSGDSRNSDVIYKLTA-SGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVAST--KTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKI-------DMYILTVEASDRSV 1305          

HSP 10 Score: 80.1073 bits (196), Expect = 6.083e-14
Identity = 178/820 (21.71%), Postives = 325/820 (39.63%), Query Frame = 3
Query: 6237 MIIIEDENDCPPKFEKDFYLQVLILPTFP--------SAPLLQLRVHDPDLNP---TILFSIL---NGKESRFFSIDPTTGWL---------KISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPK---VEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYI-NVTVSVTDENDYKPMFLSEKYEF-LVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVI----TIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDI--VSDKSPLFDKSKYSVI------VPEDAL-------KDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIIS--ATDPS-SSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVL-LQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHE-FWILVKY-DGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNSKLIYKV--LNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIK----NHPPSFVMNEFHMSVSENFTVNSEIG--RIVASDSDKNKFG-RLRYHVIGGFDSE-----IFGL--DSLTGALLLK--KTLDRER---KSMHELRVVVSDYGNKHDFATVLIHVTDINDN 8474
            ++ + D ND  P+F  D +   +     P          P++ ++  D D +     + + I+   NG+E++ F ID  TG +         KI    + V     SV  +       K      I IN   +  +     E+ + +  + E+  +  D++  +A  +   +H +++Y L+          +   +G++ +K  LD E      L+++A   DG ++   NV + + D ND  P F  +KY   ++  ++        V A D D  E  + I  +Y ++    D  F I   SG I     +   P   +    F +  +A D     L  + DV V++  ++D SP+F +  +  I      +  D +       +DF   T +  +     +   + NG  E +F +D            I  +  LD E       II   A D    S      V I V D+ND  P F K+ Y  SV E  PI   ++S S     + +   +  + L    D    ++       + G + +K+ LD+E     + F + ++  DGR      A + V +VD ND+ P  I  A    +  +  +G+ +    ATD D      +++   ++    F IDQ  G +R      +   L    +  + +++  + +S      +  V ++    N P  + +    +   EN  VN ++G   I A+D D  +FG      V   F        IF    D   G++ +   +  DRE      + E+ ++++D   + + A+V + + D+NDN
Sbjct: 1198 VVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVIN---DVNDNAPSFEEQKYIGRVKESEGEGHDVITIKA--HDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIAS--DGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRI--VYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVV--QAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLING--ESVFRIDQNTGK-------IFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDA--EAAVHVALVDRNDHAPH-IHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQ-DGTLR------VAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCI-FRENTPVN-QLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILADRAGRRNEASVHVIIGDLNDN 1985          

HSP 11 Score: 69.3218 bits (168), Expect = 1.156e-10
Identity = 131/556 (23.56%), Postives = 215/556 (38.67%), Query Frame = 3
Query: 1560 KKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTKISYYLFDQN--KLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFI----AEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQAND---SGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFV-FGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAV--CDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDAD--SKD--IQYRLVNFRRVFKI-------HSRTGWLRLRVNLDRE---KRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLR 3149
            K    ++I + DVN+  P       +  VKE+   G  V+ I+A+D D   + + Y+L      ++PF +       + VKE LD E   +     VL+   G     +   +  I I DVN+  P+F  +    T+  +   D+ I   +    A D D+D + +  +           F I   SGT+ L+        + + ++   +QA D   +GLV       ++ V  N R +           ND                              N PIF   +   I    E      V  + ++  D D    E+  + +G+   +     S+ R D ++  I     LDRE   +    I V   D+G P    F    I+V D+NDN P F +  +   ++ E   I   ++   A DAD  +KD    Y+L      F +        S  G LR++  LD E   +RD + + I  SD         A A + + + D ND+ P     +    + ED+P G+ + +  ATD D  D ++ R
Sbjct: 1316 KDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD-KHSNLRYHLIGAGGGRIPFGV-RTDSGTIFVKEPLDFEASDQYHL--VLIASDGR---HNATTNVYIHIEDVNDNAPQFEQQKYATTVIEE---DVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVG------YADVQVNVRDI-----------ND------------------------------NSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAP-FFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSD-----GRHDAEAAVHVALVDRNDHAP-HIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFR 1807          

HSP 12 Score: 68.1662 bits (165), Expect = 2.376e-10
Identity = 103/432 (23.84%), Postives = 191/432 (44.21%), Query Frame = 3
Query: 2613 ETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDI--NDNPPRFLDSFQIPMTLPENYDIKKRIVQIKAT------DADSKD-IQYRLV-----NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSP--LTE----YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNR--YIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEP--QSFVYTISGHSNGISLFRINNEGEI----RTVSSID-REKEESYWLYIYIEDRNDEII-----NKILAEVYIKVTDENDNCP-MPERAFYKASVAENLQGIHH-----LITVKATDADMNKKTELKYKI 3788
            E  D Y ++    D     N   +  E+ + +I  ++ PP+F    +  +T+ E+  +   +V +KA       D  SK  I Y L      +  + F+I   TG + L   LD +      +  +       NR      T+   + D+NDN P FT+  Y+  + ED+P+   ++++ A D D  DNS++ Y++   H+   +   S G +    +L    L E    YR     +D+G+P +LSS A   I  +  +     ++P+ +    TA + E+   GT V  I+   +D++    SF+      +  ++LF I+    +      VS+ D  E E    L + ++D     +     +   A + I + D N+N P  P+ A Y + +A+ ++G +      ++ V+ATD D +   ++ Y +
Sbjct:  489 ERGDTYRISAQAMDLSPSDNTTSQLSEVAILEILADERPPQFAKQ-EYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIR--IDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDN-HNFSIN---SNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQ---YTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKY-SDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSL 909          

HSP 13 Score: 64.3142 bits (155), Expect = 3.137e-9
Identity = 101/430 (23.49%), Postives = 175/430 (40.70%), Query Frame = 3
Query: 1485 LNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDIS-RTKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFI---RVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESG----TLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPN--NYEESNKPIFGMRNIPIFATNIPSVIHIR----EESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRF 2732
            L+ +D   P+ +     A  D+ E+    T+RI   DVN+  P          V+E+  + +T+L + A D D    ++I+Y + + N      GE     +  K  LDA+ +  R F+    V   D G P++ S  A   I   + N+    F+  T Q T             F+AED  + G   IQI        +  +S   ++G     ++L    +H  L KL +   G+ A D  L  ++  +N +V+  +  S    P K       + +  +   ++    P+   Y +  K + G      + T+ P+++ +     + SA G IV  +   T  + R  +  +   GV +    +VF                  DRET  +  +T+   D+G      F +F ++V DINDN P+F
Sbjct:  600 LDFDDPALPKLHKLKVTAREDNRESHVDLTIRID--DVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGE-----ISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFL-PTSQYTA------------FVAEDA-QGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRH---GVSAAD--LAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGT-----YKTDPPTIVKVEATDDDSSANGDIVYSL-YYTQSESRKAFVIDRQTGVLTPSPHVVF------------------DRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQF 979          
BLAST of Ft-2 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 179.874 bits (455), Expect = 3.855e-44
Identity = 311/1385 (22.45%), Postives = 579/1385 (41.81%), Query Frame = 3
Query: 6693 IKYILLSEQPKVE-----INEITGSLKLKSALDREER--PFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKK---FTIGIKANDKGQP---ALSSFTDVFVDIVSDKSPLF-DKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRL---VGKLDYETKPFHTLIISATD------PSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHE-----IISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSP--TNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVE-------------FQVLVHDF----THXXXXXXXXXXXXIKNHPPSFVMN---EFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVI--GG----FDSEIFGLDSLTGA-----LLLKKTLDRERKSMHELRVVVSDYGNK-HDFATVLIHVTDINDNIPVIEQAYYEVTV----ILSTKSTGTTLESILQLHAKDRDV-SPRHRMDYRLVSPPLSQSIAF--VDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCS--IMTIQENNPLNHIVAMCRISSTEMKG--KWSLVPSSS---PFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAI-FISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDD-QGWVYSVSAVDYEETKLI---NLVVSASDKAGH--VTNTTLTISVYDVNDEIP--------YWTKN-PPV--DGIEITETCDGCSETFPRVVYRLSAKD-NDSESQKESLHFLITNQNLNPFYAYFRVSE-SGEVLLLHPLDAE-KILKPLQLKFLASDRLHWSKEEFI-LNIRVIDVNDHAPVCPQIPDLMIFEGITP-GSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLT-----GRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINV--LDINDNAPRFVHTSIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITN--VKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKV 10517
            I Y L  + P+ E     I+  TG + L   LD ++   P +  L +    D    ++++T+ + D ND  P F    Y   V  ++      ++V A+D D G+N  + YS+        +  F+I+SN G I+ +     + L ++   +   + A D G+P   + S+   +  +  +D+S +F   S+Y+  V EDA     V  ++A  +    + Y+  + N      ++  +     G   +R       L     P +  +I   D      PS + +   T+LI + D+N+  P F   +  + +++ M   ++     I+ +       S +  + +SL   +  S    + F I+  TG ++   ++ F+        + VK   R            V +VD NDN P+F +P++  ++S   + G+ V+   A D D   N+++ Y +        +ID ++G    N +   E +   SG +              F V+  D          A V++N +  +   P +  +   +  ++V EN  +N  I R  A  S  ++   + Y +   GG     +S+    +          +++ + LD E+ + + L +  +D  ++     T ++ V D+ND +P      +  T+      +     T  + I+ + A D D   P++ + YR+V     +      +D +TG +     + N+  +      + K+++Y +  +  +  + +   A      ++ V + IN + D     P       I  ++E+    H V   +    +     ++ L+ +     PF V+ D       G I  K+ +DFE   QY + +     +    AT  + I + D ND  P F+  +YA   I ED+ +   +    A D D + K      +Y+L+       FRI    G +  V A+D +    +   N VV A D  G+  V    + ++V D+ND  P        Y  +N  P+  DG+   +               + A+D +D  ++  ++ + I    L    + FR+ + +G++  +  LD E    +   ++  A+DR   S+E F  + I+V D+ND+AP   +       E   P G+ + +  A+D D  AK N  TY L E SD + +  +  +     G + V  PLD E  +  +     + V   +   +  ++V  +D ND+AP     +     E+ P G+ IG+  A D D+G   +       + K  F+ID+D G +RVA  LDRE    ++L+IEA D      +NI    V + L DVND+ P+   +P      E+T + ++
Sbjct:  569 ITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVD-------NHNFSINSN-GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSES---RKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSL--------EIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEI-----FPNEKFD------REKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNA---PSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTD------SGTIFVKEPLDFEASDQYHLVL--IASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRI--VYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMD---------------VQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQD-GTLRVAHTLDREDIAVYNLIIEAYDN----SNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQL 1890          

HSP 2 Score: 175.252 bits (443), Expect = 9.101e-43
Identity = 312/1303 (23.94%), Postives = 540/1303 (41.44%), Query Frame = 3
Query: 5853 SIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGS--FV-DLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKF-EKDFYLQVLILPTFPSAPLLQLRVHDPDLNP-TILFSILNGKESR---FFSIDPTTGWLK----ISTNDIPVSGKFPSVVLI-----NIRAFDGKFETSCN---ITINSFDNTRNKVLPLEKSQVVWEIPEN--RNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVE----INEITGSLKLKS--ALDREERPFVQLLVLA--KGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSI----YYVKPFAYDLKF--AIDSNSGVIT-IQSGPSKELLGKKFTIGIKANDKGQP-ALSSFTDVFVDIV--SDKSPLFDKS---KYSVIVPEDALKDFIVTTVKAISST---GHTILYTITN----GNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEI-------ISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGR-------FSPTNRAHMQVHIV--DENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNSKLIYKVLNEYYNI--FKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSV-SENFTVNSEIGRIVASDSDKN-KFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRER----KSMHELRVVVSDYGNKH-DFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRD--VSPRHRMDYRLVSPPL--SQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPII--TCSIMTIQENNPLNHIVAMCRISSTEMKGK-----WSLVPSSSPFDVQNDFEI-DSNYGYIRAKKIMDFETQSQY-RINVEYRVDNSPLMATRTILIDLIDQND-CPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIP 9494
            S + + I I DVNDN P F  PL                +     E +  +   L + A D D G N +I Y + +     F I+   G +S  +++D + +    FV   ++  +D G P  LS   + I I  E+ ND    F     Y   +        P++Q++  D D +  T  F   NG+ ++    FSID  TG +K    +S  D+  +    ++ +I     +   +  K  TS     I I   +N + +     K   + +I E   + D P +V   A    S  +  I Y L   Q +      I+  TG L        DRE RP   + V A  +G      +   +V V D ND  P F    YE  V    +     I V A D DA  N  + YS+       +    DL F   ++  SG IT I+  P K    +KF   + A+D G P AL S   V ++++    K+P +  S   K  + V E+   + ++   +A+SS       ++Y +T     GN  E     F           + ++  LDYE    +TL ++ATD +S ++ + T ++ V D+ND +P F    ++ ++ E M  N  +       I     +   S+    E   +++ +++   ++HFRI+  TG I   E  D E   I  + + V+   R        +  N+ +++V IV  D NDN P F +  +   +     +G  V+   A DLD +S L Y ++        F +   SG I   +  + E    +S      ++  D  H+   NV ++   + ++ P F   ++  +V  E+  +   +  + A+D+D++ K  R+ Y + G    E+F +   +G + L K LDR+      S + +   + D GN    +A V ++V DINDN P+  +  +   +  + +   +     + + A+D D   +    ++Y +V   L   +S+  +D  TG +    S         L+   S    + I  +  +  + S            NVT+K+  + D     P    T    +++E  P+   V        + + K     + L   S  F V  D +   S+ G +R K+ +D+E  +Q    ++  RV +    A   + + L+D+ND  P I   + +   + ED+P G+ + +  A D+D  G    F    Q D       F ID  G +     +D E+  + NL++ A D + ++    + + + DVND  P
Sbjct:  624 SHVDLTIRIDDVNDNVPTFTRPL----------------YTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNH---NFSINS-NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAM-IHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKT---QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREK--IDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFE----ASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGY-IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRS---------LDREISSEREFIIEVRANDRGVPSRE-------GFANVTIKVTDMNDNA---PFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHR--VREDVPRGTSIGRYTATDRD-AGDTARFRINRQSDPKR---QFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGP 1870          

HSP 3 Score: 136.732 bits (343), Expect = 4.405e-31
Identity = 214/845 (25.33%), Postives = 356/845 (42.13%), Query Frame = 3
Query: 9015 FEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDL----IDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYD----KDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEET---KLINLVVSASD--KAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKI-LKPLQLKFLASDRLHWS----KEEFILNIRVIDVNDHAPVCPQIPDLMIF--EGITPGSVITTLQAYDRDSSAKYNTLTYTLME-----CSDPYLLVVEPLTG----RVIVNAPLDREFSSTVNFVVHALDVESKKCSF---------KILINVLDINDNAPRF----VHTSIAPFLENA--PHGSVIGKIHAVDADSGINRKIVYRIL---DESKSSFSIDRDTGIMRVAS--LLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITE-------QN---FFRL-ESLSGNLTLIKKLDFELSREYFLTVRASDKGYP-----SLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLY-WLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKK-NGDMFEVGRLHIKDKDGPTNSNPFQ-CKLLNAETVSPFLVKTDELTDE 11342
            F +D   G +R      +E    YRI+ +  +D SP   T + L ++    I  ++ PP F    Y + +SED  +   V+  KA      +D   K  I YSL      +    FRID   G ++    +D+++    KL  L V+A +  +  HV    LTI + DVND +P +T+  P+   ++ E          + + +++A D D+      + + + N N       F ++ +GE+     LDA+++  +    +F  + R H          +++IR  + ND + V         F  E    G+ +  +QA D D     + +TY+ M+          L  ++  TG    R  V+A    E  + +N  V   D +   C +          +LI + D+N+N P F     ++ IA  +E         I K+ A D DS  N  IVY +     ES+ +F IDR TG++  +   + DRE +P   + ++A+D G  P        + ++D+ND+ PQF     +  V+    +G  +IT+ A  +D   NAE++Y +  +       QN   FF L    SG +TLIK +  + ++++   V A D G P     S   T  V+ +              P +  + EN  ++K+ + +  A  S    NS + Y       P  K    S       F   N     + +  + D E+   Y   ++ TD      S+KT V +E+ D ND  P+F    F   I  +   + P++ L+K NG      +    D DGP N   ++     N E    F +  DELT E
Sbjct:  472 FIVDPKSGVVRTG-WSKYERGDTYRISAQA-MDLSPSDNTTSQLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVD---LTIRIDDVNDNVPTFTR--PLYTAQVREDI-----PLNQTILKVTAVDKDT-GDNSRITYSVDNHN-------FSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADR----DEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQD-DGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMK-TQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGI-TVDENVELNKVIL-RCRAVSSGDSRNSDVIYKLTASGGPGNKA--ESKFRQFNKFENGNEWVEVVIMEGL-DYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEE---MTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRI--DELTGE 1279          

HSP 4 Score: 136.346 bits (342), Expect = 5.342e-31
Identity = 351/1594 (22.02%), Postives = 634/1594 (39.77%), Query Frame = 3
Query: 5862 SVKIHIADVNDNAPRFL-GPLKLNGIISESANPGSLVFL------QSDGEK--LSKSLKALVINA--EDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVH------DPDLNPTILFSILNG---KESRFFSIDPTTGWLKIST---NDIPVSGKFPSVVLINIRAFDGKFETSCNITI---NSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEIN-EITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYIN----VTVSVTDENDYKPMFL-SEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLK---FAIDSNSGVITIQSGPSKELLGKK---FTIGIKANDKGQPAL------SSFTDVFVDI--VSDKSPLF-DKSKYSVI--VPEDALKDFIVTTVKA-----ISSTGHTILYTI--TNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSS-LSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFR-------INGTTGTISIKENLDFEACMIHEFWILVKYDGRFSP---TNRAHMQVHIVDENDNPPKF-----IQPAFNATISLESSQGSLVVIAMATDLDTNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLP---SSGVVEFQVLVHDFTHXXXXXXXXXXXX---------IKNHPPSFVMNEFHMSVSENFTVNSEIGRI----------VASDSDKNKFGRLRYHVIG---GFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDY---------GNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNL---------GLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISST--EMKGKWSLVPSSSP---FDVQN-DFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYE---ETKLINLVVSASDKA--GHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQ--KESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILK--PLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAP--FLENAPHGSV-IGKIHAVDADSG 10241
            +++IH+AD+ D  P F+  PL +  ++  +   G +V+         DG+   L K++  +   +   DP  G       V+ + ++ Y + D Y             +    +DLS    D  + +L     + I+ I+ DE   PP+F K  Y   +         ++ ++        D      I +S+       E+++F IDP+TG + ++     D P     P +  + + A +   E+  ++TI   +  DN      PL  +QV  +IP N+     ++   A    +  +  I Y + +    +  N EI+  ++L  A    ER FV    +     G    ++    + +   + ND   +FL + +Y   V  +       I+++A D D  E   V YS +  K      K   F+ID ++G++ ++ G S   L +      + +   D G   +      +S+  + + I  V++  P F D +KYS I  + E   K    T VK       SS    I+Y++  T     + F +D     L P P V+      D ET+P   + + ATD     L       + V+DIND  P F + SY  SVS    +   +I++       +++  + +SL++    +    +H         +N  +G I++ + +  +     +F   V  D    P    + A + ++++D+    PK+      +P      ++E ++  L   A+++    NS +IYK+        K +  S F +FN+  N  + +      G+   QV  +  T +     S    +         + +  P F ++ F  ++ E  T N  + +           + +DSD  +   + Y ++G   G +++ F +D LTG +   +  DRE+  M+ L V  SD          G   D   V I + D+NDN P  E+  Y    I   K +      ++ + A D D     R  Y L+     +    V + +G + +K     + S+          G +N  + + ++              + ATTVI   +++   +  ++         +  I+   E    + +  + + S T   +K      P+  P   F VQ  D + +   GY            +  ++NV    DNSP+   R  L   I++N   PI  +  Y  F+          +Q + +D        I Y + +   +     FRID + G ++++ ++D E   E + I + V A+D+          +TI V D+ND  P++ K      +E T        +F        AKDN    Q  +ES +F +T    +      + S  G + +  PLD E + +     L    SD  H    E  +++ ++D NDHAP      +  + E +  G+ I    A DRD+    +T  + +   SDP         G + V   LDRE  +  N ++ A D  +      + + + D+NDN P   +T   P  F EN P   +   +I A D D+ 
Sbjct:  408 TIRIHVADI-DEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLYKTIDVIPAGSFIVDPKSG-------VVRTGWSKYERGDTY------------RISAQAMDLS--PSDNTTSQL---SEVAILEILADER--PPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPA---LPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQT----ILKVTAVDKDTGDNSRITYSVDNHNFSINSNGEISAKVRL-DADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDE---VTYS-FMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVV-----FDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEI---DTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKT---QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAE--SKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQ-NEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKY----IGRVKESEGEGHDVITIKAHDLDKHSNLR--YHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGY------------ADVQVNVRDINDNSPIFPER--LFGYIEENR-EPIHSDGVY--FMD---------VQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFI-IEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDS------KQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRH--DAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAG---DTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPE-PYTVPRPCIFRENTPVNQLGTCEIRATDRDTA 1903          

HSP 5 Score: 117.857 bits (294), Expect = 2.288e-25
Identity = 132/470 (28.09%), Postives = 215/470 (45.74%), Query Frame = 3
Query: 2463 ITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQ---------GQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADS-KDIQYRLVNF---RRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLA-LPEDLPIGSFLVQLHATDADLDD-NSQLRYAIHGIHSD-CFHCDTSTGAVHLLCKLS-------PLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLP----GTLVTSIRPETSD---KEPQSFVYTISGHS--NGISLFRIN-NEGEIRTVSSIDRE--KEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKK 3767
            +T+K  D D D  ++E  + +  E         R D  + +I   ++ DRE +D Y +T+   D+         G  K+ +  + +I + D+NDN P F +   I   + E+      ++ IKA D D   +++Y L+     R  F + + +G + ++  LD E  D Y +V++ASD         AT  + I + D+NDN P F +  Y+   + ED+ I   L  +HATDAD D+ +S++ Y + G  +D  F     +G + L+  L        P   + ++  + D+G    L   AD Q+  + ++ N   P   E +    I EN  P    G     ++    D    E  +  Y I  +   NG S+FRI+ N G+I  + S+DRE   E  + + +   DR      +  A V IKVTD NDN P  E+  Y+ SV E       +++  A DAD   K
Sbjct: 1239 VTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNV--KVQIVINDVNDNAPSFEEQKYIGR-VKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-----GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNF-VVQAIDDDGN--GLVGYADVQVNVRDINDNS--PIFPERLF-GYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPS-REGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAK 1693          

HSP 6 Score: 115.161 bits (287), Expect = 1.546e-24
Identity = 268/1051 (25.50%), Postives = 433/1051 (41.20%), Query Frame = 3
Query: 8820 INVTVKINILYDKKKVNPIITCSIMTIQ--ENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQN-DFEIDSNYGYIRAKKIMDFETQSQ----YRINVEYRVDNSP--LMATRTILIDLIDQNDCPPIF-DNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVS--FRIDDQ-GWV---YSVSAVDYEETK-LINLVVSASDKAG--------HVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHP---LDAEKILKPLQ-LKFLASDRLHWSKEEFI-LNIRVIDVNDHAPVCPQIP---DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTL---------MECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALD---VESKKCSFKILINVLDINDNAPRF-VHTSIAPFL---ENAPHGSVIGKIHAVDADSGINRKIVYRILD--------ESK----SSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFI------NIPIKLRVAEDTEI--GKVLITIKAI-SDDIGVNAEVSYQMITEQN-----FFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXX-------XXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSD--SGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRTLW---VQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRD-RSPAFDMLTFEF--VYNETLKSRVNNNFFKIDSFTGAITTTEMLD 11702
            +++T++I+ + D     P  T  + T Q  E+ PLN  +   ++++ +   K +   S   + V N +F I+SN G I AK  +D +  ++    YR NV  R    P  L ++  I I   + ND   +F   S+Y  F++ED   G+ VIQ +A D D   +D + YS    +   T     F ID+  G V   + VSA D  E +  INL V   D           H +  TL I + DVN+  P +         +I +  +G  +T P  + ++ A D+DS +  + ++ L   Q+ +     F +     VL   P    D E   +P + +   A+DR       F   ++ V+D+ND++P   +      +  FE +  G+ + T+ A+D D+ A    +TY+L          +    +  +V   +G + +  P+  +    + F V A D    E+ + S ++ +NVLD    AP++       P +   EN     VI +  AV +    N  ++Y++          ESK    + F    +   + +   LD E+   + L + A+D      S  T V + + DVND  PQF        I  ++   E  E   GK ++T+KAI +D  G   EV Y+++ E N      FR++ L+G +   +K D E    Y LTV ASD+   +L    G     V V        DN P F    Y+  + E+       I  + A+D D  S L   L  +    +P                F +   +G IF+    D E    Y   +  +D      ++ TNV I IED NDN P+F Q  +   +      I  D ++ K   +F V   H  D D    S+    +L        F +     T E +  +      GV + W   VQ  D+    L     V VNV  +++  P        Y+  + E I    +    V  RD   P  +    E+  V N+ +      + F+ID  TG I     LD
Sbjct:  626 VDLTIRIDDVNDNV---PTFTRPLYTAQVREDIPLNQTI--LKVTAVD---KDTGDNSRITYSVDNHNFSINSN-GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYS--DIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSES--RKAFVIDRQTGVLTPSPHVVFDRE--TRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAV--GTSVITVFAFDNDA-AHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFI-FNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVI-TIKAHDLDKHSNLRYHLIGAGGGRIP----------------FGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTV------IEEDVDIPKV--LFNV---HATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPS-WNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGE---SVFRIDQNTGKIFAMRSLD 1618          

HSP 7 Score: 88.5817 bits (218), Expect = 1.446e-16
Identity = 159/657 (24.20%), Postives = 273/657 (41.55%), Query Frame = 3
Query: 9336 FRIDDQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLH----------FLITNQN--LNPFYAYFRVSE----SGEVLLLHPLD--AEKILKPLQLKFLASDRL-HWSKEEFILNIRVIDVNDHAPVCPQIPDLMIFE-GITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDV----ESKKCSFKILINVLDINDNAPRFVHT-SIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLV----IEASDCGKPPK-SNITNVKIVLLDVNDSPPQFI-NIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMI-------TEQNFFRLESLSGNLTL---IKKLDF-ELSREYFLTVRASDKG----YPSLSTTTGXXXXXXXXXXXXXXXXF-----LPYVFNIPENTLVSKL-TIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFL--NFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSF 11144
             +IDD G ++ +  ++YE+T  I   V  +      T T + I V D+ DE P +  N P+  + +       + T  R+VY+  A+D   +     L+          F++  ++  +   ++ +   +    S + + L P D    ++ +   L+ LA +R   ++K+E+ + +   ++ D++ V  +      FE G + G +  +L+    +   K+                 ++P TG + +   LD  F       +H L V    ++++    + I + D+NDN P F      A   E+ P    I K+ AVD D+G N +I Y +      +FSI+ + G +     LD ++  E H V    + A D G+P   S+   + I   + ND    F+        VAED + G  +I I+A   D     EV+Y  +        + N F ++  +G + L   +   D  E      LTV   D G    YPS + T+   + +   + N  +  F        +  I E T  +   TI KV A D DS  N  + YS  Y   E +             F I+ +TG +    + V DRE +P     V  TD G          ++E+ D NDN P+F +PS+
Sbjct:  370 LKIDDDGKIHLLKPLNYEKTSSIIATVPINGLQSTRTQT-IRIHVADI-DEPPSFV-NSPLPMLAVVP----LNPTIGRIVYQFVARDEHGDGDSNVLYKTIDVIPAGSFIVDPKSGVVRTGWSKYERGDTYRISAQAMDLSPSDNTTSQLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKW---------------FRIDPSTGIIHLTRLLD--FDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV---DNHNFSINSN-GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESR-----------KAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSY 984          

HSP 8 Score: 85.8853 bits (211), Expect = 1.036e-15
Identity = 172/724 (23.76%), Postives = 286/724 (39.50%), Query Frame = 3
Query: 1638 ITVKENTEIGETVLIIQAYDPDISRTKISYYLFDQNKLPFRLGEFKRNV------------VIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDR-DGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDAD----SKDIQYRL--VNFRRVFKIHSRTGWLRLRVNLDREKRDYYP---IVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPI---GSFLVQLHATDAD--LDDNSQLRYA------IHGIHSDCFHCDTSTGAVHLLCKL----SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQS--FVYTISGHSNGISLF-----RINNEGEIRTVSSIDRE---KEESYWLYIYIED-RNDEIINKILAEVYIKVTDENDNCP 3665
            ITV EN E+ + +L  +A     SR     Y    +  P    E K               V++ E LD E +   + + +  TD  + +A +    + +E+ DVN+  P+F       TI  +   +        E L++ +G+  + +         P   +H      +     KH  + +LT      +  D      K+ +    V+A+ RS+S  P      K+++ V         IN  N+    N P F  +           +  ++E   +G  V  IT+K  D D+       + G      ++ F + RTDS +  I V + LD E  D+YH+ +   D    ++       I +ED+NDN P+F         + E+ DI K +  + ATDAD    S  I YRL       VF+I   +G + L   LDR+     P    V+ A D D     L   A + + V DINDN PIF +  +        PI   G + + + A D D    +N+ + Y       I+G     F  D +TG +  +  L    S   E+ +     D G P   S +    +  +    N   P  ++     ++ E    G  V S     +D+E +   F Y +S  S+   +      + ++ G +R    +D E   + + + L I + D R+D       A V++ + D ND+ P
Sbjct: 1103 ITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNN-YTLTLTATDMTSRVAST--KTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPN--------EHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDR----EKIDMYILTVEASDRSVSALPGANGPNKDNVKV------QIVINDVND----NAPSFEEQKY---------IGRVKESEGEGHDV--ITIKAHDLDKHSNLRYHLIGAGGG--RIPFGV-RTDSGT--IFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDD--GNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLING--ESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVP---SREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHD-----AEAAVHVALVDRNDHAP 1770          

HSP 9 Score: 83.1889 bits (204), Expect = 5.971e-15
Identity = 145/572 (25.35%), Postives = 229/572 (40.03%), Query Frame = 3
Query: 2424 IREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSA------DIVVADRLDRETVDKYHMTIAVCDQGQPKNCIF--------KRFEIQVEDINDNPPRFLDSFQ---IPMTLPENYDIKK-RIVQIKATDADSK---DIQYRLV----NFRRVFKIHSRTGWL--RLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI---------HGIHSDCFHCDTSTGAVHLLCKLSPLTEYRLI--AVVKDNGKPQALSSQADFQI----YPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETS-DKEPQSFVYTISGHSNG-----------ISLFRINNEG-EIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHL--------ITVKATDADMNK-KTELKYKIIS---GDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGV 3938
            + E++  GT V +I  + AD+D   Y      G  S ++  +FSI   D H+        +  AD  + E  +  ++T+ V D G    C++            I +ED+N+N P F D  +   I   +   Y      IV+++ATD DS    DI Y L       R+ F I  +TG L     V  DRE R    + + A+D    +R L      ++ V DINDN P F + SY  ++     +G+ ++ + A D D   N+++ Y++         H    D F           L K  P+   + I   +  DNG P+AL S A   +      QK    +  P  K P IT  + EN     ++   R  +S D      +Y ++  S G            + F   NE  E+  +  +D E+  +Y L +   D    + +       ++V D ND  P      +  ++ E +    HL        +TVKA D D +  + E+ Y+I+    G+   +F I             DRE +       D Y L V  SD  V
Sbjct:  757 VAEDAQGGTPVIQIQARDADRDEVTYSFMDKNG-RSTQKMNLFSI---DEHTGLVKLRHGVSAADLAEAE--NPINLTVIVQDDG--SCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRG--DRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCK-PGIT--VDENVELNKVILRCRAVSSGDSRNSDVIYKLTA-SGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVAST--KTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKI-------DMYILTVEASDRSV 1305          

HSP 10 Score: 80.1073 bits (196), Expect = 6.083e-14
Identity = 178/820 (21.71%), Postives = 325/820 (39.63%), Query Frame = 3
Query: 6237 MIIIEDENDCPPKFEKDFYLQVLILPTFP--------SAPLLQLRVHDPDLNP---TILFSIL---NGKESRFFSIDPTTGWL---------KISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPK---VEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYI-NVTVSVTDENDYKPMFLSEKYEF-LVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVI----TIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDI--VSDKSPLFDKSKYSVI------VPEDAL-------KDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIIS--ATDPS-SSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVL-LQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHE-FWILVKY-DGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNSKLIYKV--LNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIK----NHPPSFVMNEFHMSVSENFTVNSEIG--RIVASDSDKNKFG-RLRYHVIGGFDSE-----IFGL--DSLTGALLLK--KTLDRER---KSMHELRVVVSDYGNKHDFATVLIHVTDINDN 8474
            ++ + D ND  P+F  D +   +     P          P++ ++  D D +     + + I+   NG+E++ F ID  TG +         KI    + V     SV  +       K      I IN   +  +     E+ + +  + E+  +  D++  +A  +   +H +++Y L+          +   +G++ +K  LD E      L+++A   DG ++   NV + + D ND  P F  +KY   ++  ++        V A D D  E  + I  +Y ++    D  F I   SG I     +   P   +    F +  +A D     L  + DV V++  ++D SP+F +  +  I      +  D +       +DF   T +  +     +   + NG  E +F +D            I  +  LD E       II   A D    S      V I V D+ND  P F K+ Y  SV E  PI   ++S S     + +   +  + L    D    ++       + G + +K+ LD+E     + F + ++  DGR      A + V +VD ND+ P  I  A    +  +  +G+ +    ATD D      +++   ++    F IDQ  G +R      +   L    +  + +++  + +S      +  V ++    N P  + +    +   EN  VN ++G   I A+D D  +FG      V   F        IF    D   G++ +   +  DRE      + E+ ++++D   + + A+V + + D+NDN
Sbjct: 1198 VVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVIN---DVNDNAPSFEEQKYIGRVKESEGEGHDVITIKA--HDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIAS--DGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRI--VYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVV--QAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLING--ESVFRIDQNTGK-------IFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDA--EAAVHVALVDRNDHAPH-IHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQ-DGTLR------VAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCI-FRENTPVN-QLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILADRAGRRNEASVHVIIGDLNDN 1985          

HSP 11 Score: 69.3218 bits (168), Expect = 1.156e-10
Identity = 131/556 (23.56%), Postives = 215/556 (38.67%), Query Frame = 3
Query: 1560 KKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTKISYYLFDQN--KLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFI----AEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQAND---SGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFV-FGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAV--CDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDAD--SKD--IQYRLVNFRRVFKI-------HSRTGWLRLRVNLDRE---KRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLR 3149
            K    ++I + DVN+  P       +  VKE+   G  V+ I+A+D D   + + Y+L      ++PF +       + VKE LD E   +     VL+   G     +   +  I I DVN+  P+F  +    T+  +   D+ I   +    A D D+D + +  +           F I   SGT+ L+        + + ++   +QA D   +GLV       ++ V  N R +           ND                              N PIF   +   I    E      V  + ++  D D    E+  + +G+   +     S+ R D ++  I     LDRE   +    I V   D+G P    F    I+V D+NDN P F +  +   ++ E   I   ++   A DAD  +KD    Y+L      F +        S  G LR++  LD E   +RD + + I  SD         A A + + + D ND+ P     +    + ED+P G+ + +  ATD D  D ++ R
Sbjct: 1316 KDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD-KHSNLRYHLIGAGGGRIPFGV-RTDSGTIFVKEPLDFEASDQYHL--VLIASDGR---HNATTNVYIHIEDVNDNAPQFEQQKYATTVIEE---DVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVG------YADVQVNVRDI-----------ND------------------------------NSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAP-FFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSD-----GRHDAEAAVHVALVDRNDHAP-HIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFR 1807          

HSP 12 Score: 68.1662 bits (165), Expect = 2.376e-10
Identity = 103/432 (23.84%), Postives = 191/432 (44.21%), Query Frame = 3
Query: 2613 ETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDI--NDNPPRFLDSFQIPMTLPENYDIKKRIVQIKAT------DADSKD-IQYRLV-----NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSP--LTE----YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNR--YIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEP--QSFVYTISGHSNGISLFRINNEGEI----RTVSSID-REKEESYWLYIYIEDRNDEII-----NKILAEVYIKVTDENDNCP-MPERAFYKASVAENLQGIHH-----LITVKATDADMNKKTELKYKI 3788
            E  D Y ++    D     N   +  E+ + +I  ++ PP+F    +  +T+ E+  +   +V +KA       D  SK  I Y L      +  + F+I   TG + L   LD +      +  +       NR      T+   + D+NDN P FT+  Y+  + ED+P+   ++++ A D D  DNS++ Y++   H+   +   S G +    +L    L E    YR     +D+G+P +LSS A   I  +  +     ++P+ +    TA + E+   GT V  I+   +D++    SF+      +  ++LF I+    +      VS+ D  E E    L + ++D     +     +   A + I + D N+N P  P+ A Y + +A+ ++G +      ++ V+ATD D +   ++ Y +
Sbjct:  489 ERGDTYRISAQAMDLSPSDNTTSQLSEVAILEILADERPPQFAKQ-EYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIR--IDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDN-HNFSIN---SNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQ---YTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKY-SDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSL 909          

HSP 13 Score: 64.3142 bits (155), Expect = 3.137e-9
Identity = 101/430 (23.49%), Postives = 175/430 (40.70%), Query Frame = 3
Query: 1485 LNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDIS-RTKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFI---RVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESG----TLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPN--NYEESNKPIFGMRNIPIFATNIPSVIHIR----EESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRF 2732
            L+ +D   P+ +     A  D+ E+    T+RI   DVN+  P          V+E+  + +T+L + A D D    ++I+Y + + N      GE     +  K  LDA+ +  R F+    V   D G P++ S  A   I   + N+    F+  T Q T             F+AED  + G   IQI        +  +S   ++G     ++L    +H  L KL +   G+ A D  L  ++  +N +V+  +  S    P K       + +  +   ++    P+   Y +  K + G      + T+ P+++ +     + SA G IV  +   T  + R  +  +   GV +    +VF                  DRET  +  +T+   D+G      F +F ++V DINDN P+F
Sbjct:  600 LDFDDPALPKLHKLKVTAREDNRESHVDLTIRID--DVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGE-----ISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFL-PTSQYTA------------FVAEDA-QGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRH---GVSAAD--LAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGT-----YKTDPPTIVKVEATDDDSSANGDIVYSL-YYTQSESRKAFVIDRQTGVLTPSPHVVF------------------DRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQF 979          
BLAST of Ft-2 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 177.563 bits (449), Expect = 1.798e-43
Identity = 261/1016 (25.69%), Postives = 430/1016 (42.32%), Query Frame = 3
Query: 8160 NHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDS------LTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVL--IHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDY--RLVSPPLSQSIAFVDS--ITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTI--SVYDVNDEIPYWTKNPPVDGIEITE-----TCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRV-SESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVC-PQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALD--VESKKCSFKILINVLDINDNAPRFVHTSIA-PFLENAPHGSVIGKIHAVDADSGINRKIVYRILD-ESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQ--NFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPP 11123
            ++ PSF      + +SE   + +       +D D  KF   R+ ++ G  + +F L S      L   L++   LDRE +  +EL +   D G       +   I + D NDN PV  ++ Y  +V  +  S G+ L   + + A D D+    R+ Y  +  S P + + A   S  IT   SL P+              S  +V  +A       L S  + T  +  S   +  ++I++       ++  +   + EN+ L  IVA   I+      K  L+ SS+    Q D    ++   +    I+D ET S++ +      D   ++     L+ + D ND  P + +S+  I ++     GS+ +  K  D D      I YS+   + V       ID + G ++  + +D      I   V A D      +T L +   + D   + P + K   +  +EI E     TC        +VV      +N      + + + + NQ+      +  V + SG V +    D EK  K  Q   +A++    +    I +IR+ DVND+ P+  P    L + EG  P   +  + A D D S  +  ++Y ++  S  +   + P+TG V    PL R      + VV A D   +S + S  I I V+D +   P+F  +       E+   G  IG + A+        K+ Y I   +   +FSID DTG + V   LD +      L I+A+      +SN T V I + D ND+PPQF +  +++ + ED ++ +    ++A   D   N EV Y +I+    +   ++  +G L+    LD+E +R Y L V+A+D G P  S+   + I V+DVNDN P+F    Y   + EN+   K  +GKV A D DS  N  + Y                + +   +F I+ K G ++     DRE        +   D G+P  SS  +  I + D NDNPP
Sbjct:  117 DNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANI-SIGSHL---ITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPA--------------STHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIW-------LVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTD---QAHVYLLLLCGILDRETASEHHLKFLLEKDGQ-IIIEHPQLLTIGDINDNAPQWHSSQIHISLNR-TQGGSRTLTAK--DPDLGQNGWIRYSVLDTELVS------IDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEK--ALWQVEIPEDTPIGTC------LVKVV-----ANNSQCGNSKRIRYSLQNQD-----EHLTVDTMSGTVCIQKTFDFEK-QKSYQTTVIATNANSETSTSLI-SIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMD-SGTFGEVSYHILSESSSF--SINPVTGEVFAQKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMS-------KVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSG--ESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENS-PPKTIVGKVVARDKDSLENGQIVYR---------------ITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPP 1043          

HSP 2 Score: 161.77 bits (408), Expect = 1.109e-38
Identity = 247/1013 (24.38%), Postives = 436/1013 (43.04%), Query Frame = 3
Query: 5685 QYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQ--DIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPL-KLNGIISESANPGSLVFLQS--DGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDL--NPTILFSI--LNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPD---LVLPRAKFYFSHQHPSIKYILLSEQ---PKVEINEITGSLKLKSALDREERPFVQL-LVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSK-EAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIV--SDKSPLFDKSKYSVIVPEDA-LKDFIVTTVKAISSTGHT--ILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNSKLIYKVL--NEYYNIFKIDQSSGFIRFNQ----------VPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYG--NKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRL 8615
            +Y V+     T K   V   +G I T++ LD E+    DIV++ ++              I + + + D NDNAP F   + KL   ISE A  G+   L +  DG+     +   VI          G +  V   + AS    +Q    L +  ++DRE    + +L I  QD G P  + Q R  I II  D ND  P F +  Y   +       + L+ ++  D D+  N  I + I   +   +  F+I   +G +  + + +P S     V+++          +S  +TI    +T +   PL+   ++W +  N   + +   L    A+   + Q+   K  L+      P+         L L   LDRE      L  +L K      ++  + +++ D ND  P + S +    +H +L++ +  S  + A D D G+NG + YS+   +        +ID  +G I + +     + G +    ++A D G PALS+   V  D++    K P F+K+ + V +PED  +   +V  V   S  G++  I Y++ N  DE L     T   +    C+ +     D+E +  +   + AT+ +S  S ++ + I + D+ND  PIF  + Y  +V E       ++ +S     + +    E S  ++ +SS      F IN  TG +  ++ L   A       +  K  G  S  N A++ + ++D++   P+F +  +     + +++  L  IA+ + +   SK+ Y +   ++ +N F ID+ +G I   +          + NI+  LPS    + QV++    H              ++PP F  +   +S+ E+  ++     + ASD DK K G +RY +I         +D  TG L     LD E    ++LRV  +D G   +    T+ IHV D+NDN P  E+++Y + V L      T +  ++   A+D+D     ++ YR+
Sbjct:   55 KYFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKVE---------ESGETIDILVEVDDENDNAPSFADQVVKLE--ISEFAQLGTSFALPTVTDGDGPKFDVHRFVI--------LQGNVNNVF--KLASRKVNEQLQADLVVNGQLDREFRDKY-ELLIEAQDGGKPAKIGQLRCSIEII--DANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAIS-QSGVITTTASLLPASTH--DVIVVASDHGSPSLSSSAVVTITVLGSTLSSP-PLD---IIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQL-LTIGDINDNAPQWHSSQ----IHISLNRTQGGSRTLTAKDPDLGQNGWIRYSVLDTE------LVSIDKETGRIFVPNTIDCNI-GSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQN-QDEHL-----TVDTMSGTVCIQK---TFDFEKQKSYQTTVIATNANSETS-TSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSA--SDMDSGTFGEVSYHILSESS-----SFSINPVTGEVFAQKPL---ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYE----IRTTEDILPGIAIGS-VGAMSKVKYSIYSGDQDHN-FSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDH-------------NDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEV-LENSPPKTIVGKVV---ARDKDSLENGQIVYRI 981          

HSP 3 Score: 142.51 bits (358), Expect = 7.829e-33
Identity = 199/842 (23.63%), Postives = 345/842 (40.97%), Query Frame = 3
Query: 8886 SIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDF-----------EIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATR-TILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDD-QGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETC-DGCSETFPRVVYRLSAKDNDSESQKE-SLHFLITNQN--LNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFI-LNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIA-PFLENAPHGSVIGKIHAVDADSGINRKIVYRILD-ESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTT-TGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKL--LNAETVSPFLVKTDELTD 11339
            +I  I +N P  H  +   IS    +G    + +  P   QN +            ID   G I     +D    S+ +  V      SP ++T   ++ DL+D    PP F+ + + + I ED P+G+ +++  A +        I YSL   D         +D   G V      D+E+ K     V A++     + + ++I + DVND  P +  N      E   T  +G     P +V  +SA D DS +  E S H L  + +  +NP         +GEV    PL   +      L   A D    S E    ++I VID +   P   +   ++   E I PG  I ++ A  +        + Y++      +   ++  TG++ V   LD +   TV   + A     +    +++I + D NDN P+F  + +     E+         + A D D   N ++ Y I+     SS  ID+ TG +   SLLD E    + L ++A+D G PP+S+   + I +LDVND+ P+F      + V E++    ++  + A   D   N ++ Y++     +F ++   GN+   + +D E+     +++ A DKG P  S+T +  I  +   ++        P V  +P  + +S   IG + A D D GLN  + Y             R+ L       + N   G+++L    +  ++   +  V V+D G+P  S   +V + I  K     +  +P F+  I++ +S                                P  C+L  LNA  VS +L+++ E+++
Sbjct:  430 TIGDINDNAPQWH-SSQIHISLNRTQGGSRTLTAKDPDLGQNGWIRYSVLDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDE-----HLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPN------EYHLTVREGPKPEEPLLV--VSASDMDSGTFGEVSYHILSESSSFSINPV--------TGEVFAQKPLARGR----FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSK--------VKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIV--VPAGSPLST-AIGTIVAMDPDKGLNGSVLY-------------RAQLQSSLFVVKSN---GDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRIS-KGSADIQIQEP-FQKYIEIPKSC-------------------------------PTGCRLTTLNATGVSSWLIQSSEISN 1185          

HSP 4 Score: 139.043 bits (349), Expect = 9.445e-32
Identity = 222/888 (25.00%), Postives = 369/888 (41.55%), Query Frame = 3
Query: 6720 PKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSI-RVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGK-----KFTIGIKANDKGQPALSSFTDVFVDI------VSDKSPL-FDKSKYSVIVPEDALK-DFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLES-SQGSLVVIAMATDLDTNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSG------VVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVT--DINDNIPVIEQ-AYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQ---SQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSL 9302
            PK  IN  TGS+ +   LDRE      L+++        D   V V+V D+ND KP   +     L     S+    + R +A D+D G+NG           F+++L   ++ +SG + +       +L +      + I ++  D G P L  + +  ++I         K+PL F K  Y   + E   +  FI      ++     + Y+I  GN +  F +D           VIR   +LD E    ++L +  T     +   T V + V ++ND +P F   S    V EN+ +   + ++    + V N  +      L+ DSS  +  HF I+  TGTI +   LDFE    H   I    DG F      ++ + + D NDN P F +P +  T+S  + S G       A DLD    L Y +     +IF++   SG +         K+LP +G      V      V  F+ SV  +V +      +  P F   EF   V EN  +  +IG +   +S +       Y +     S+IF +D   G L +   +DRE+++ HE +V + +            HV   D NDN+PV    AYY     LS K +    + I Q+ A D+D     R+ YR++S     +I  ++  TG++ L   W +   +   N T   L   +         +   +++  + S S +    +  +Y+   V+ +   S+ T+     L  I A  R+        +SL       + Q    ID   G +  K  +D+E++   S Y ++V      S ++  + I+++ +D+    P+F  S Y + I    P G  V Q +A D+D     V+ YS+
Sbjct: 1671 PKFSINSTTGSISVL-PLDREASQEHLLIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGK----------FSFEL---LEDSSGSLDLVPETGDLVLRRLSSLQSWKIKLRVVDHGVPGL--YVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPELAG----LTYSIVEGNIDSAFSVDSEG--------VIRTNLELDREILERYSLKVIGTGSGQQI--GTRVDVRVNNLNDNVPSF-PMSKPRRVPENLRVGSYVATVGA--KDVDN--LAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKAT-DGSFD--TFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDARGALTYSLGQGSSSIFRVAPESGAL-------FMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDK-PGFEKAEFRFEVMENSKIGLQIGNLSGEESRE-----FHYRIQDPEASKIFSIDKF-GRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYY-----LSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGN-DLNIVTLNPDTGSIQLN-EWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYE---VHVLEDTSVGTV-----LQKIRASNRLGMRNDGLLYSLK------EHQGKLGIDVKTGELTLKTHLDWESEPIISMY-LSVSDGNGRSAVVPLK-IVVEPVDE--FAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSI 2481          

HSP 5 Score: 132.88 bits (333), Expect = 5.375e-30
Identity = 225/948 (23.73%), Postives = 389/948 (41.03%), Query Frame = 3
Query: 6729 EINE-ITGSLKLKSALDREERPFVQLLVLAK--GWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSD--KSPLFD----KSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTL-IISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMI-HEFWILVKYDGRFSPTNRAHMQV--HIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT-NSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVT--DINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSI--MTIQENNPLNHIVAMCRISSTEMKG----KWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYR-VDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLT--ISVYDVNDEIP 9494
            ++NE +   L +   LDRE R   +LL+ A+  G       +  ++ + D ND  P+F   +Y   V  N+S  +  I V+A D D GEN  + Y I      + +  FAI S SGVIT  +     L      + + A+D G P+LSS   V + ++     SP  D        S  + E++    IV  V        T L  I       L       A++     ++ L G LD ET   H L  +   D    + H    L+T+ DIND  P +  S    S++     +    +++     +  +  + +S+          ++   I+  TG I +   +D   C I  E    V+ +   SP     +QV   ++D    PP+F +  +   I  ++  G+ +V  +A +    NSK I   L        +D  SG +   +  + EK       V   +  +  + +  + +S+    + ++ P F  NE+H++V E       +  + ASD D   FG + YH++   +S  F ++ +TG +  +K L R R     L V   D G +    +  IH+T  D +   P   ++ YE+           T E IL   A    V    ++ Y + S                        +Q+ N  ++    K+ V +       + +    I  T+ S   N T  +  + D     P  + S+  ++I+E+  L+    + + S  + K     ++S++ SS P    +  EID   G +    ++D+E    Y++ V+   +   P  +  T+ I ++D ND  P F+ S Y + + E+ P  + V +  A DKD      I Y +           F ID++ G VY+  ++D E    +++ + A DK     ++T +  ISV DVND  P
Sbjct:  176 KVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPS-NSNFAI-SQSGVITTTA---SLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLI---GSSALCPQQTDQAHV----YLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQ--LLTIGDINDNAPQWHSSQIHISLNRTQGGSR---TLTAKDPDLGQNGWIRYSV--------LDTELVSIDKETGRIFVPNTID---CNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTV---IATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILS--ESSSFSINPVTGEVFAQKPLARGR---FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIR----------TTEDILPGIAIG-SVGAMSKVKYSIYSG-----------------------DQDHNFSIDEDTGKIYVTRYLDADVHDTVL-LNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSII-SSHP---GSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEY-----FGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPP 1043          

HSP 6 Score: 130.954 bits (328), Expect = 2.108e-29
Identity = 220/910 (24.18%), Postives = 390/910 (42.86%), Query Frame = 3
Query: 9060 MDFETQSQYRINVEYRVDNSPL-MATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGC---SETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNP-----FYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCS--FKILINVLDINDNAPRFVHTSI-APFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAF-SSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIP-------DQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSL--YLGVRT--LWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHS---ETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNN--FFKIDSFTGAITTTEMLD 11702
            +D E + +Y + +E +    P  +      I++ID ND  P+F  SRY   +S +I +GS +I  +A D D      I Y + +  S  +  +F I   G + + +++    T   +++V ASD      +++  +++  +   +     +PP+D I + E+       + T   +V R+S     ++  +++   LI +  L P      + Y        +LL   LD E   +   LKFL         E   L + + D+ND+AP        +       GS   TL A D D   +   + Y+++   D  L+ ++  TGR+ V   +D    S + F V A D  S   S   +++ ++LD     P+F          E+ P G+ + K+ A ++  G +++I Y + ++ +   ++D  +G + +    D E+Q  +   + A++      +++ +++  L DVND+ P F      L V E  +  + L+ + A   D G   EVSY +++E + F +  ++G +   K L       + L V A D G  S   +  + I V+D +   PQF    Y     E+ L   + IG V       G  S + YS   +  +Q           +H F I+  TG+I++    D +   T    +  T   +P+  S++T V I IED NDNPP+F+       I+ D     P       D++ KKNG++    R  I       +S+P               ++ D+ T +   L  GSL  Y   R   L V+ TD G P     + + ++V+ +++  PE E    T     +   +TI+GK      V+ RD+         + + N  +  R+ N   +F ID   G + T   +D
Sbjct:  191 LDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKT-SAPSNSNFAISQSGVITTTASLLPASTH--DVIVVASDHGSPSLSSSAVVTITVLGSTL----SSPPLDIIWLVESNSAHLMENSTLGSIVARVSI----AQQYRDTKLRLIGSSALCPQQTDQAHVYL-------LLLCGILDRETASE-HHLKFLLEKDGQIIIEHPQL-LTIGDINDNAPQWHSSQIHISLNRTQGGS--RTLTAKDPD-LGQNGWIRYSVL---DTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDE-HLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIR--LKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPL---ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDIL-PGIAIGSV-------GAMSKVKYSI--YSGDQ-----------DHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQAT---LPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEV----RYSI------ISSHPGSS------------IEIDQFTGQ---LSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGK------VVARDK---------DSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSID 1004          

HSP 7 Score: 120.939 bits (302), Expect = 2.218e-26
Identity = 235/940 (25.00%), Postives = 392/940 (41.70%), Query Frame = 3
Query: 5253 DNSLIFSFTW----IDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQL------EESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFP-SAPLLQLRVHDPDLNPT--ILFSILNGKESRFFSIDPTTGWLKIS-TNDIPVSGKFPSVVLINIRAFDGKFETSCN-ITINSFDNTRNKVL--PLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSALDREERPFVQLLVLAK--GWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPED-ALKD--FIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATD----PSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQK--VSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKF--IQP-AFNATISLESSQGSLVVIAMATDLDTNSKLIYKV 7979
            DN+ +FS +     +    SIG+ L ++ ATD D G N ++ + IK  S   N       +G I    SL       +   +V SD G P   + +VV + +    +S   P L      E +   L+  EN+++ SI+  + +    +          ++ P       V     C I    LDRE   +   +   ++    ++  +  +++    I D+NDNAP++            S    SL   Q     L+         A+DPD G+NG I Y +L        ID+ TG + +   ID  + GS +   +R +D GSP L +   L+++  + D    PP+FEK  + QV I    P    L+++  ++     +  I +S+ N  E    ++D  +G + I  T D      + + V+    A +   ETS + I+I   D   N  +  P E    V E P  + + P LV+  A    S     + Y +LSE     IN +TG +  +  L R       L+V AK  G   S +  N+ ++V D++   P F   KYE     ++      I + ++    G    V YSIY       D  F+ID ++G I +      ++      + I+A      +  +   +F++  +D  P F  S   + + ED  L +  ++V            + Y+I + +     ++D     L  G         LDYE    + L + ATD    P SS   + T+ I VLD+ND  P F KS Y+  V EN P    I+   V   K  + N +IV    ++        S++F I+   G +  K ++D E     +  I+ +  G    ++ A  ++ ++D NDNPP    I P    A   L ++ G++V  AM  D   N  ++Y+ 
Sbjct:  228 DNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHDVI--VVASDHGSPSLSSSAVVTITVLGSTLSS--PPLDIIWLVESNSAHLM--ENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGI----LDRETASE-HHLKFLLEKDGQIIIEHPQLLT----IGDINDNAPQW----------HSSQIHISLNRTQGGSRTLT---------AKDPDLGQNGWIRYSVLD--TELVSIDKETGRIFVPNTIDCNI-GSEIKFRVRAEDGGSPALSTD--LQVVADLLDTESKPPQFEKALW-QVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDE--HLTVDTMSGTVCIQKTFDFEKQKSYQTTVI----ATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGP--KPEEPLLVV-SASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPLARGR---FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDI---LPGIAIGSV----GAMSKVKYSIYSGD---QDHNFSIDEDTGKIYVTRYLDADV-HDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSL-------LDYEATRNYKLRVKATDLGIPPRSS---NMTLFIHVLDVNDNAPEFEKSWYTMEVLENSP-PKTIVGKVVARDKDSLENGQIV---YRITN-----GSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIV--AMDPDKGLNGSVLYRA 1083          

HSP 8 Score: 106.686 bits (265), Expect = 5.591e-22
Identity = 115/447 (25.73%), Postives = 192/447 (42.95%), Query Frame = 3
Query: 2505 SEFVFGVWSEEEQMVFSIARTDSHSADIVVAD-------RLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADS-KDIQYRLVNFRRV-----FKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLAL-PEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTEYRLIAVVK-DNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGD 3800
             +F+  +  E   + +SI   +  SA  V ++        LDRE +++Y + +     GQ    I  R +++V ++NDN P F      P  +PEN  +   +  + A D D+   ++Y LV+         F I   TG + L   LD E    + + I A+D  F          LTI V+DINDN P F+K  Y   + P     G    ++ A   DLD    L Y++    S  F     +GA+ +   L P  E  L+ V   DNG P + S+     +   +  P    P  ++      + EN   G  + ++    S +E + F Y I        +F I+  G +     IDRE+  ++   + I D       K+  + ++ V DENDN P+     Y  S+ +++     +  + A+D D  +   + Y+I+SG+
Sbjct: 1848 GQFIAKLQPELAGLTYSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQQ---IGTRVDVRVNNLNDNVPSF--PMSKPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSF-----DTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEA--HDLDARGALTYSLGQGSSSIFRVAPESGALFMKV-LPPAGERYLVTVTATDNGVP-SFSTSVPVSVIIGEAEPTDK-PGFEKAEFRFEVMENSKIGLQIGNL----SGEESREFHYRIQ-DPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEI-DNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGN 2273          

HSP 9 Score: 104.76 bits (260), Expect = 1.999e-21
Identity = 116/384 (30.21%), Postives = 183/384 (47.66%), Query Frame = 3
Query: 10008 GRVIVNAPLDREFSSTVNFVVHALDVE---SKKCSFKILINVLDINDNAPRFVHTSIAPFL---ENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSF-SIDRDTGIMRVA----SLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLL--DVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGV-NAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLP------YVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEI 11099
            GR+ V  P+DRE  +T  F V  +D E   S+K   K  + VLD NDN P F  TS+A +L   ++  HG  IG+I A D DSG N ++ YRIL  +  +  +++ DTG +++     + LD        +++EA D G P ++ +  V++ L     + S P F+    ++ V EDT +G VL  I+A S+ +G+ N  + Y +   Q    ++  +G LTL   LD+E   E  +++      Y S+S   G    V       P   F P      Y   IP +T   + ++G++ A D D G++ ++ YS          + +ST+   EH       TG I L   P    +     Q++V  +  P   SKT V +EI
Sbjct: 2180 GRLFVAGPIDREQRATHEFQVE-IDNEMMTSQKVQCKCHVIVLDENDNLPVF--TSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRA-SNRLGMRNDGLLYSLKEHQGKLGIDVKTGELTLKTHLDWE--SEPIISM------YLSVSDGNGRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGE-SVGQMQAIDEDGGVHGVVKYSI--------SDRQSTVKIEEH-------TGIIRLQ-KPLVSRRNLTIEQITVVAYSSPTKQSKTTVYLEI 2534          

HSP 10 Score: 97.0561 bits (240), Expect = 4.131e-19
Identity = 221/919 (24.05%), Postives = 378/919 (41.13%), Query Frame = 3
Query: 6078 SRF-----ASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLL-QLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFET----------SCNITINSFDNTRNKVLPLE--KSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEIN-------EITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDAL---KDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATD---PSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIV--DENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLNEY-YNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLV--HDFTHXXXXXXXXXXXXIK-----NHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSE--IFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQ 8699
            SRF     A  F I+  TG +S+ L +DRE     + L I L D GS      +   + + + D+ND  P+ +     ++ I  +     +L + R  D D+         NGK S F  ++ ++G L +    +P +G      L +++++  K               N+ I++ +       PLE  K   +  I E         LPR +F    Q P +  +  S    VE N       +  G ++    LDRE      L V+  G  G      V V V + ND  P F   K    V  NL   +    V A D+D      + Y +           F ID  +G I + +    E+L  + T+ IKA D      ++ T +FV  ++D +P F K  Y   V        + F       + + G  + Y++  G          +++  +  P    L  K+       + + ++ATD   PS S S   +V+I   +  D+ P F K+ +   V EN  I  +I         +S  +  EF  + I+D  P +S+ F I+   G + +   +D E    HEF   V+ D     + +   + H++  DENDN P F   A+  ++    + G  +   MA+D D+  N ++ Y++L+    NI  ++  +G I+ N+  + +  L       +Q+LV   D  H   A V    VS+K        P FV+  + + V E+ +V + + +I AS    N+ G     ++          G+D  TG L LK  LD E + +  + + VSD   +     + I V  +++  PV  ++ Y + + +ST +     ES+ Q+ A D D      + Y +      QS   ++  TG + L+   +++
Sbjct: 1662 SRFRFQGNAPKFSINSTTGSISV-LPLDREASQEHL-LIIILTDGGS----RNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQ-------NGKFS-FELLEDSSGSLDL----VPETGDLVLRRLSSLQSWKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEG--------LPRGQFIAKLQ-PELAGLTYS---IVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTG-SGQQIGTRVDVRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVD--NLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVL-PEHTLTIKATDGSFDTFTNLT-IFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDARG-ALTYSLGQG----------SSSIFRVAPESGALFMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDK-PGFEKAEFRFEVMENSKIGLQI-------GNLSGEESREFHYR-IQD--PEASKIFSID-KFGRLFVAGPIDREQRATHEFQ--VEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQ--LDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRAS----NRLGMRNDGLLYSLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAG----ESVGQMQAIDEDGGVHGVVKYSISD---RQSTVKIEEHTGIIRLQKPLVSR 2506          

HSP 11 Score: 93.9745 bits (232), Expect = 3.302e-18
Identity = 154/654 (23.55%), Postives = 274/654 (41.90%), Query Frame = 3
Query: 9333 SFRIDDQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSE-SGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFI-LNIRVIDVNDHAPVC--PQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNA--PLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIA-PFLENAPHGSVIGKIHAVDADSGINRKIVYRILD-ESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSR----EYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDG 11252
            +F +D +G + +   +D E  +  +L V  +  +G    T + + V ++ND +P +  + P     + E     S      V  + AKD D+ +    L + + + +      +F + + +G + L  PLD E +L    L   A+D    S + F  L I V D+ND+AP    P     +     +PG     ++A+D D+      LTY+L + S   +  V P +G + +    P    +  TV    + +   S      ++I   +  D  P F         +EN+  G  IG +   ++     R+  YRI D E+   FSID+  G + VA  +DRE++  H   +E  +     +       +++LD ND+ P F ++   L + +    G+ +  I A   D G N  VSY++++  + N   L   +G++ L +  D +L       + + V A D G+P+ +   G +   + ++      PF  +V  + E  ++   ++G V      S    M     LY L E +               I+ KTGE+ L    D E +P     +SV+D      S+   + I +E  ++  P F + S+   I +      P  E         VG++   D+DG
Sbjct: 1873 AFSVDSEGVIRTNLELDREILERYSLKVIGT-GSGQQIGTRVDVRVNNLNDNVPSFPMSKPR---RVPENLRVGS-----YVATVGAKDVDNLA---PLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFE-VLPEHTLTIKATD---GSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDARG---ALTYSLGQGSS-SIFRVAPESGALFMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDK-PGFEKAEFRFEVMENSKIGLQIGNLSGEES-----REFHYRIQDPEASKIFSIDK-FGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARA-AVGKVQVSLKMSSWSGSAPF--FVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGK-----------LGIDVKTGELTLKTHLDWESEPIISMYLSVSDGN--GRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPIS----TPAGE--------SVGQMQAIDEDG 2471          

HSP 12 Score: 89.7373 bits (221), Expect = 6.921e-17
Identity = 86/305 (28.20%), Postives = 143/305 (46.89%), Query Frame = 3
Query: 2433 ESAK-GTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHM-TIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKDIQ-YRLV----NFRRVFKIHSRTGWLRLRVNL------DREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIH--SDCFHCDTSTGAVHLLCKLSPLTEYRLIAVVKDNGKPQALSSQA 3302
            ESA+ GT +  I+ K  +     Y     F V+ +E+   F   + D  S +I     LD E   K+ +  + V + G+  + +     ++V+D NDN P F D   + + + E   +         TD D      +R V    N   VFK+ SR    +L+ +L      DRE RD Y ++I A D      +       +I + D NDN P+F+++ Y+ ++  ++ IGS L+ + ATDAD+ +NS++ Y I      S+     + +G +     L P + + +I V  D+G P +LSS A
Sbjct:   33 ESAQIGTRIGWISGKREESAAPKY-----FVVFPDEQTSKF--LKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESGETIDIL-----VEVDDENDNAPSFADQV-VKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGG--KPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHDVIVVASDHGSP-SLSSSA 321          

HSP 13 Score: 88.5817 bits (218), Expect = 1.459e-16
Identity = 140/619 (22.62%), Postives = 268/619 (43.30%), Query Frame = 3
Query: 6681 QHPSIKYILLSEQPKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVTVSVT----DENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIV-----PEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLS-HSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWIL-VKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATI--SLESSQGSLVVIAMATDLDTNSKLIYKVLNEY-YNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFT---HXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYG--NKHDFATVLIHVTDINDNIP 8480
            Q+  I+Y +L  +  V I++ TG + + + +D      ++  V A+  DG    ++  + V     D     P F    ++  +  +       ++V A +   G +  + YS+        D    +D+ SG + IQ     E   K +   + A +      +S   + +  V+D  P+F  ++Y + V     PE+ L   +V+     S T   + Y I +  +   F ++         P    +  +       FH L++SA D     S +S  + ITV+D + + P F +S Y    +E++     I S+  + +       V++S+      S     +F I+  TG I +   LD +   +H+  +L ++       +N+  + + I D NDNPP+F       +I   L+  +   VV A   D   N ++ Y +++ +  +  +IDQ +G +    + + E    ++   + +V   D      S    + ++ + + ++ P F  + + M V EN    + +G++VA D D  + G++ Y +  G  SE FG+D   G +  K+++DRE  S  ++ +V  D G   +   A+  I V D+NDN P
Sbjct:  469 QNGWIRYSVLDTE-LVSIDKETGRIFVPNTIDCNIGSEIKFRVRAE--DGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQ-----NQDEHLTVDTMSGTVCIQKTFDFEKQ-KSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPL--LVVSASDMDSGTFGEVSYHILS--ESSSFSIN---------PVTGEVFAQKPLARGRFH-LVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSK-------VKYSIY-----SGDQDHNFSIDEDTGKIYVTRYLDAD---VHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYE----ATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNG--SEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPP 1043          

HSP 14 Score: 87.4261 bits (215), Expect = 3.077e-16
Identity = 126/506 (24.90%), Postives = 224/506 (44.27%), Query Frame = 3
Query: 9684 SESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAP-VCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPFL---------ENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQN-----FFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEI-EDKNDNPPEFAQPSFRF 11150
            S +G + +L PLD E   + L +  L         +   + + V D ND+ P +    P +L I E    G V+   +A D D   +    ++ L+E S   L +V P TG +++     R  SS  ++ +    V+       +  N L+I++  P+    +   FL         E  P G  I K+    A  G+   IV   +D   S+FS+D + G++R    LDRE    + L +  +  G+      T V + + ++ND+ P F  +    RV E+  +G  + T+ A   D+   A + Y ++++ +      F ++  +G + L   LDFE+  E+ LT++A+D  + + +  T  +  + D      +     Y   +   T        K+ A+D D+     LTYS             S++      FR+ P++G +F+  +P   E+  Y   V+ TD+G+P+FS+   V++ I E +  + P F +  FRF
Sbjct: 1677 STTGSISVL-PLDREASQEHLLIIILTDGGSR--NDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDI-GQNGKFSFELLEDSSGSLDLV-PETGDLVL-----RRLSSLQSWKIKLRVVDHGVPGLYVEKN-LEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPELA--GLTYSIVEGNID---SAFSVDSE-GVIRTNLELDREILERYSLKVIGTGSGQQIG---TRVDVRVNNLNDNVPSF-PMSKPRRVPENLRVGSYVATVGA--KDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIFVSDINDNAPTFSKPL---YQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSL--------GQGSSSI------FRVAPESGALFMKVLPPAGER--YLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRF 2138          

HSP 15 Score: 85.1149 bits (209), Expect = 1.701e-15
Identity = 146/584 (25.00%), Postives = 237/584 (40.58%), Query Frame = 3
Query: 2679 FKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIK--KRIVQIKATDADSKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYS-LALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPS--LKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCP-----MPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKII---SGDTWGYFXXXXXXXXXXXXXXXDREPL-------KST-CAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTI 4367
            +   +I VE +   PP+   +    +T+ EN  I+  KRI+    T+    + ++R       F I+S TG + + + LDRE    + ++I+ +D    N S T   T    VAD NDNKP    ++ S L + E   +G  L +  A+D D+  N +  + +    S        TG + +L +LS L  +++   V D+G P  L  + + +I  +        P   LK+  + + I E    G  +  ++PE +        Y+I    N  S F +++EG IRT   +DRE  E Y L +       +I  +    V ++V + NDN P      P R      V ENL+   ++ TV A D D      L+Y ++   SG T  +F+I            +D E L       K+T  +F  F +L + +SD                          INDN   F++ L    ++           G+  A    +DL+A    T       +L   +  +F V  +SG LF  +     +           + + V A D G P+  T  P  V I
Sbjct: 1614 YSTLKIHVEPVFTEPPKISSTSCGVVTIEENVGIEDFKRILATGMTE----ESRFRFQGNAPKFSINSTTGSISV-LPLDREASQEHLLIIILTDGGSRNDSCTVRVT----VADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVPETGDL-VLRRLSSLQSWKIKLRVVDHGVP-GLYVEKNLEISNRNPQTEAKAPLEFLKQTYL-STIDEGLPRGQFIAKLQPELA-----GLTYSIV-EGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQQIGTR----VDVRVNNLNDNVPSFPMSKPRR------VPENLRVGSYVATVGAKDVD--NLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIFVSD--------------------------INDNAPTFSKPLYQTTVSPATFSP-----GQPFAKIEAHDLDARGALTY------SLGQGSSSIFRVAPESGALFMKVLPPAGER----------YLVTVTATDNGVPSFSTSVPVSVII 2120          

HSP 16 Score: 75.0998 bits (183), Expect = 1.641e-12
Identity = 80/262 (30.53%), Postives = 118/262 (45.04%), Query Frame = 3
Query: 9984 LLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIA-PFLENAPHGSVIGKIHAVDADS---GINRKIVYR-------ILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMI-----TEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTT 10721
             L V+  +G +   A LD E  S  + V  A+ VE    +  IL+ V D NDNAP F    +     E A  G+        D D     ++R ++ +        L   K +  +  D   + V   LDRE + ++ L+IEA D GKP K       I ++D ND+ P F        V+ +  IG  LIT++A   DIG N+ +SY +      +  NF    S SG +T    L    +  + + V ASD G PSLS++
Sbjct:   68 FLKVDERSGEISTIAHLDYEKRSKFDIV--AVKVEESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQAD---LVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNF--AISQSGVITTTASL--LPASTHDVIVVASDHGSPSLSSS 320          

HSP 17 Score: 73.1738 bits (178), Expect = 6.821e-12
Identity = 179/805 (22.24%), Postives = 320/805 (39.75%), Query Frame = 3
Query: 7194 SDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISS--TGHTILYTITNGNDEELFDLD-FTAAYLQPGPCVIRLVGKLDYETKPFHTLIISA--TDPSSSLSHSTTVLITVLDINDELP-------IFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTI----------------SIKENLDFEACMIHEFWILVKYDGR---FSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHM-SVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKG-KWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDD-QGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTK 9506
            SDK P FD     V + ED     I+TTV A  S  +   I Y      D   F +D FT          I L+  L +   P + LI+ A  + P ++L     V + V D+ND  P       + L SSY         + H +++I +          + +SLK     S  + + F+I+  +G I                 + E L   A  + +   L K+D +      +N +    H  DE            + TI   S QGS + + +      + +LI    +      KI Q S  +             ++G   F ++         + + ++   +   PP        + ++ EN  +  +  RI+A+   +    R R+      ++  F ++S TG++ +   LDRE    H L ++++D G+++D  TV + V D NDN P ++ +      I  +   G  L    +  A D D+    +  + L           ++  +G++ L P    +  +L L    S L+ ++I  +V +     + +    +  ++ ++ +      K  +  +    + TI E  P    +A  +    E+ G  +S+V      ++ + F +DS  G IR    +D E   +Y + V     +   + TR + + + + ND  P F  S+    + E++ +GS V    A  KD +    + Y L    S +T   F ID   G ++  + +D+E      L + A+D     T T LTI V D+ND  P ++K
Sbjct: 1326 SDK-PRFDTGHLRVNIREDTPTGSIITTVNATVSDDSASPISYRFPLLIDN--FSIDQFTGD--------ITLIDTLHWHVTPTYNLIVEAFTSGPGTTL----LVTVNVDDVNDHTPFIVSQPTVLLPSSYRKG-----GMVHRVVAIDL-----DKDPEIRYSLKYA--GSEVAKEFFKIDEKSGEIFVVESSSALSTSFGGAGLPETLTIRATDLQD---LTKFDEQKVLLKASNASRSTWHFFDEQHK---------DVTILSTSPQGSQI-LQLKFQEGVDLQLIPSSPHFELKSSKIVQKSASV-------------ATGTQRFTIVAQKDDELDYSTLKIHVEPVFTEPPKISSTSCGVVTIEENVGIE-DFKRILATGMTEES--RFRFQ----GNAPKFSINSTTGSISVLP-LDREASQEHLLIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLH---RFRASDMDIGQNGKFSFEL-----------LEDSSGSLDLVP----ETGDLVLRRL-SSLQSWKIKLRVVD-----HGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQ---PELAGLTYSIVEG----NIDSAFSVDSE-GVIRTNLELDREILERYSLKV-IGTGSGQQIGTR-VDVRVNNLNDNVPSFPMSK-PRRVPENLRVGSYVATVGA--KDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATD-GSFDTFTNLTIFVSDINDNAPTFSK 2031          

HSP 18 Score: 66.6254 bits (161), Expect = 6.141e-10
Identity = 75/281 (26.69%), Postives = 127/281 (45.20%), Query Frame = 3
Query: 5238 IQRHLDNSLIFSFTWIDVGSSIGTLLTS----ISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEY 6068
            I+ H DN   FS + +++       L      + A+D+D  +NG++ ++I + S   +  E+DQ  G +     L     R   L +  +DLG PPR +   + + + D  ++ + P+ E+S   + V EN+   +I+    +      L   Q V      S  + FG+    G + T  S+DRE I  +   DI + + D  V   +S  S +I + DVNDN P     L +  I+  + +P            LS ++  +V  A DPD+G NG + Y
Sbjct:  827 IEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIIS-SHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLD--VNDNAPEFEKSWYTMEVLENSPPKTIV-GKVVARDKDSLENGQIVYRITNGS--EYFGIDEKLGNVYTKRSIDREVISHV---DISIVAEDKGVPPRSSTASARISVLDVNDNPPSC---LSITPIVVPAGSP------------LSTAIGTIV--AMDPDKGLNGSVLY 1081          

HSP 19 Score: 63.929 bits (154), Expect = 4.785e-9
Identity = 49/148 (33.11%), Postives = 76/148 (51.35%), Query Frame = 3
Query: 10290 FSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQF-INIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKL-DFELSR-----EYFLTVRASDKGYPSL 10712
            FSI+  TG + V  L DRE   EH L+I  +D G   +++   V++ + D ND+ PQ   + P +L +AE + +G VL   +A   DIG N + S+++        LE  SG+L L+ +  D  L R      + + +R  D G P L
Sbjct: 1673 FSINSTTGSISVLPL-DREASQEHLLIIILTDGGS--RNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFEL--------LEDSSGSLDLVPETGDLVLRRLSSLQSWKIKLRVVDHGVPGL 1809          

HSP 20 Score: 58.9214 bits (141), Expect = 1.344e-7
Identity = 86/338 (25.44%), Postives = 150/338 (44.38%), Query Frame = 3
Query: 5136 EFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAI--KNDSVALNYFEMDQNNGDIRVQR----SLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSL 6131
            EF V  E  N  M + +   K    VL+E D L +      S+ +  +  D   + G  +  I A+DQD G NG++ + I   ND   LN   ++ + G I++       L    N    + +   D G P R     V V ++    S S P       ++ V E+TSV ++L  ++  +   +      ++ S+K   GKL G+   TG +   + LD E  + I+SM + V   +G     ++++ +KI +  V++ AP F          ++S+    +      GE + +      + A D D G +G ++Y I  R  S  KI+++TG++ L
Sbjct: 2197 EFQV--EIDNEMMTSQKVQCKCHVIVLDENDNLPVF----TSVAYYLSLKD-SMAHGQKIGQIMASDQDSGENGRVSYRILSGND---LNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDG--LLYSLKEHQGKL-GIDVKTGELTLKTHLDWES-EPIISMYLSVSDGNG----RSAVVPLKIVVEPVDEFAPVF----------TKSSYTLQIPISTPAGESVGQ------MQAIDEDGGVHGVVKYSISDR-QSTVKIEEHTGIIRL 2499          

HSP 21 Score: 58.5362 bits (140), Expect = 1.943e-7
Identity = 118/480 (24.58%), Postives = 191/480 (39.79%), Query Frame = 3
Query: 2277 CVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMR------NIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDS-FQIPMTLPENYDIKKRIVQIKATDADSKDIQYRLVNFRR--VFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHS------DCFHCDTSTGAVHLLCKLSPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDK-EPQSFVYTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCP 3665
            C++       Q +  +T+   N   E++  +  +R      N PIF    P+  H+            + +  +D D   +  E  + + SE     FSI   +  + ++     L R    ++H+ ++  D G   +       I V D +   P+F  S ++I  T     DI   I  I +  A SK ++Y + +  +   F I   TG + +   LD +  D   + I A+         +    + I + D NDN P F+ +   +++ EDL +      + A+D D   N ++RY+I   H       D F    STG+   L        Y+L     D G P   S+   F I+   V+ N   P  ++   T  + EN  P T+V  +     D  E    VY I   +NG   F I+ + G + T  SIDRE      + I  ED+     +   A   I V D NDN P
Sbjct:  596 CIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIF---YPNEYHLTVREGPKPEEPLLVVSASDMDSGTF-GEVSYHILSESSS--FSI---NPVTGEVFAQKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTT----EDILPGIA-IGSVGAMSK-VKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQAT----LPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGS---LLDYEATRNYKLRVKATDLGIPPRSSNMTLF-IHVLDVNDN--APEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRI---TNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSST-ASARISVLDVNDNPP 1043          

HSP 22 Score: 56.6102 bits (135), Expect = 7.060e-7
Identity = 175/807 (21.69%), Postives = 321/807 (39.78%), Query Frame = 3
Query: 1554 ETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTKISYYLFDQNKLP--FRLGEFKRNV-----VIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIG-HFIA-EDLDRDGRDNIQISIASVSFQQPC---FSIHPESG----TLSLLCTFKHGMLSKLTNFTIGLQANDSGL--VSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIA----RTD-SHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEI-QVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKDIQYRLVNFRRVFKIHSRTGWLRLRV------NLDRE-KRDYYPIVI---VASDVDFYNRSXXXXXXXXXX----VADINDNK---PIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHL--LCKLSPLTEYRLIAVVKDNGKPQALSSQADFQI----------YPQKVHPN-RYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSF---VYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAEN-LQGIHHLITVKATDADMNKKTELKYKIISGD 3800
            E+ +T  + + V D N+  P   +    + + E  ++G +  +    D D  +  +  ++  Q  +   F+L   K N      ++V   LD E  + ++ + +   D G P A+       IEI D N+  P  V+   + T S  A  ++ IG H I  +  D D  +N +IS        P    F+I  +SG    T SLL    H ++         + A+D G   +SS   +  +V+ +   +LS  P+ +      I++                 ESN                    H+ E S  G+IV ++++  A + RD             + +++ S A    +TD +H   +++   LDRET  ++H+   +   GQ    I +  ++  + DINDN P++  S QI ++L       + +    A D D                   + GW+R  V      ++D+E  R + P  I   + S++ F  R+    +         VAD+ D +   P F K  + + +PED PIG+ LV++ A ++   ++ ++RY++     +    DT +G V +           Y+   V+  N   +  +S    ++          YP + H   R  P  +EP++  +                  SD +  +F    Y I   S+  S+  +   GE+     + R +   + L +  +D   +  ++  A ++I V D++   P   R+ Y+    E+ L GI            +   +++KY I SGD
Sbjct:  101 ESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDRE-FRDKYELLIEAQDGGKP-AKIGQLRCSIEIIDANDNAP--VFSRSRYTASVSA--NISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAIS-QSGVITTTASLLPASTHDVI---------VVASDHGSPSLSSSAVVTITVLGS---TLSSPPLDI------IWL----------------VESNS------------------AHLMENSTLGSIVARVSI--AQQYRD------------TKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQ---IIIEHPQLLTIGDINDNAPQWHSS-QIHISLNRTQGGSRTLT---AKDPD-----------------LGQNGWIRYSVLDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQN-QDEHLTVDTMSGTVCIQKTFDFEKQKSYQ-TTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVS-----------------ASDMDSGTFGEVSYHILSESSSFSINPVT--GEVFAQKPLARGR---FHLVVSAKDGGGQ-SSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGI--------AIGSVGAMSKVKYSIYSGD 777          

HSP 23 Score: 54.6842 bits (130), Expect = 2.440e-6
Identity = 83/404 (20.54%), Postives = 164/404 (40.59%), Query Frame = 3
Query: 2622 DKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKDIQYRLVN--FRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNR---SXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI-HGIHSDCFHCDTSTGAVHLL----CKLS--PLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETS-DKEPQSFVYTISGHSN--GISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKI 3788
            ++Y +T+   D G P         + + +         +  +    + EN  I  +I  +     +S++  YR+ +    ++F I  + G L +   +DRE+R  +        V+  N    S        +IV D NDN P+FT  +Y L+L + +  G  + Q+ A+D D  +N ++ Y I  G   +    +  TG++ L      +L   P   ++++   +D+G P A ++    Q+  +    +   P    P+    + E+   GT++  IR            +Y++  H    GI +      GE+   + +D E E    +Y+ + D N       +  + I V   ++  P+  ++ Y   +  +      +  ++A D D      +KY I
Sbjct: 2094 ERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSG--EESREFHYRIQDPEASKIFSI-DKFGRLFVAGPIDREQRATHEF-----QVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHP-ARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDV----KTGELTLKTHLDWESEPIISMYLSVSDGNGR---SAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSI 2481          

HSP 24 Score: 53.1434 bits (126), Expect = 7.691e-6
Identity = 44/141 (31.21%), Postives = 68/141 (48.23%), Query Frame = 3
Query:  384 NTFEAESKLVGDFFYLRIRTKYTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLF 806
            N F+  S+ V +   L+        L+RE    Y L    L E++  GK     + +  I+++D NDN P+F    +      N SI + + TV ATDAD G NS I Y + +++  S+S    F+I+  SG+I     L 
Sbjct:  168 NVFKLASRKVNE--QLQADLVVNGQLDREFRDKYEL----LIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNS---NFAISQ-SGVITTTASLL 298          
BLAST of Ft-2 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332722)

HSP 1 Score: 1061.21 bits (2743), Expect = 0.000e+0
Identity = 1204/4572 (26.33%), Postives = 2049/4572 (44.82%), Query Frame = 3
Query:  390 FEAESKLVGDFFYLRIRTKYT-ASLNRERIGFYNLTIQGL--FESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVKYLSKYFDPDFNDYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNVFLTPTGEL-NRYVLKLRAIFSPISTPAI--SVTIEAKDLSLNPKTSSTHLTIPLG-NLRNINLLSVPEFVSVSIPENAIVNSSVCLLK---------TFIXXXXXXXXXXXXFRWIPDLEGTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVV----DANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFG---------MRNI--PIFATNIPSVIHIREESAKGTIVQKITMKTADKDRD-PYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPP---RFLDSFQIPMTLPENYDIKKRIVQIKATDADS---KDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSD--CFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEP--QSFVYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXX-XXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAP--TMWTRSPAEVTIRLYLSENATDPKSENDKSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRA----TYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFA-SYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSAL-DREERPFVQLLVLAKG--WDGSYDYI-----NVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDA-LKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNS--KLIYKVL--NEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSI---TGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCE--EPLYSYRIATTV--ISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLM-ATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKA--GHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFP-RVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIPDLMIF--EGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVE--SKKCSFKILINVLDINDNAPRFVHTSIAPFL----ENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVR---------TLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFH---SETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKPNIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNE----NEYRFFKS----SALVDRIKTLTPDLTKIFQASSVKIFNNVCD-DKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSF----RVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRL--SILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGARNYISTREYNLEKSVI----LDESMTGCIQDVILNNQKLPYQQLPAPVPS-SSLGVLSK--NLNYGCSES--LMR-SLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKC-VDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGY---MCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHCEIDGLISIYPDNSSFGLSQFHIYVIVGI 13718
            F+AE KLVGDF +L IRT+     LNRE+   Y + ++       ++   +ET  +  + IKVLDRND  P+F    +  +  E+      I  VTA DAD G+N EI+Y     ++  DS  F  +I+P +G I  +Q+L  +   S     + A  RG     +    S++ +SISV   N +AP+I  K  S    P  N   +  + V D+D  +N N     I+      +P   FL    E  + Y ++L   F+ ++      ++T+ A+DL    + +   + I +    +NI + +  E   VSIPE A +N  V  LK           +    V       FR  PD    Y+               K L+AE   S    ++     N     + +  ++ISVQD+N+  P+  N   VI++ EN   G  V+ + A D D      ISY + + N +PF +  F   +V     LD ETM+R + + +  +D G P  R       I + D+N+ +P+F    C   +++ AP   ++  F+   +D D  D I   ++  + +  CF++ P SG+LS+ C  K    + LTN  + + A D    S  + +N  ++      +S  L G     +C   +  V  +     ++   NN + ++  +F           +N+  P F  N P  + I E    G  V  I  K    DRD  Y  + VF +   +   VF   R D    ++ +   LDRE  ++Y + I V D G P     K   I + D+NDN P   + L +F+    L E+  I   +  + ATDADS     + Y L      F +++ TG LRL   LDREK+D Y + I A D    +  L++ A + ++V D+NDN P+F    Y   + EDLP G+ L  + A D D+  N+++++++     D   F  D  TGA+     L    +  + LI    D G P +L+S     I    V+ NR+ P   + +    ++EN   GT V ++     D         Y+I+G  +G+ +F +N++G I ++S +D E +  YWL +  +D     ++  + EVYI+V +ENDN P+ ++  Y  +V E       +IT+KA D D++    + Y I+SG+  GYF I S   +  T+ER +DRE           + L+V ISD+G P   +T  I V+++D        INDN   F++ +    +      N +I   +V A+D D   N  + Y+++  +  N        F +D + GH+  +I+  +  +++        F+I++ A D G P  +   R    V      S+NA           L +     + +++  ++  G  +  I  VD  + +   L   I + +   +    + +G+       ILL         +   L I++ +  F    N+ + +   N N P F   + +   +NI ++ +    I  + A                    T+ D  + + Y + A+ DP ++  LF I+S +G++ +    +        +IV  +++ A     Y K+ +++ D N+ +PEF     QS                                        +   ++IG+ L  + A D+D G N ++ ++I   +V  + FE+D   G I +  +L   + +   L +   DLG PP    S + V I      +  P+   + + + + EN  + + +      +     +++      I  +  + F +  STG I+   ++D E I+     ++ V+  +  ++  +S  ++ IHI D NDN P F+    + G + ESA  GS V    D  K       L +  +D D G NG +EY I+   A ++FKID  TG + L  ++D E    +    + + D G PKL S     + I + + NDCPP F +      L LPTF +  + Q+   D D N T+ F I++G  +  F I+  TG +     +I ++ +      +++RA DG F     + I       +     ++    +   EN   V  + L       +    +++Y +L+     +I   +G+LK    + DRE +   +L V AK   +DG    +     ++ +SV D ND  P+F++  Y   V  +  K    ++VKAIDLD+ ENG V Y +   K    +L F +D  SG ++I+     E   + + + + A D      SS   + V ++    P+F+K  Y+V V ED  +   +  +++A S  G +++YTI++  + + F++D+           I +V +LDYE    H + I ATD  S +     + ++++D+ND  P      Y+ ++ EN     +I+ I+        +  + + ++ I   +  +S+ F I+ T G + +K  LD+E    H   + VK  G  S ++R+++ + + D NDN P F++P++   +S+ + +G  V +  A D D +    L YK++  NE    + ID+ +G I    + N      SS V+   + V D  H+  A + ++ +    + P F  + +   V EN      I  + ASD D   +  L Y ++     +IF +D  TG +  K T DRE+K  + + + VSD G K  FA++ + V D+NDN+P      Y++ V  + ++     ++IL + AKD D+     + +++V     +++  V  I   TG +  K    ++  + G+N+       YQ   +  +  EP +   +  ++  I    N+       ++K  V       ++ I E+ P   +     ++   M G ++   S +    Q+ F I S+ G +  ++ +D E Q  + + V       P+  A   +LID+ D+ND  P FDN+ Y+  ++E+      +++  A D D      I Y L + D+      F ID   GW+  ++++D E     N  V A+D     H     +TI + D ND  P +    P++G+ + E         P  V+  L   D D E  K+ + F I + +     A F++ +SGE+ +  PLD E+++    L  +A+D    +K    + I V D+ND+ P C + P   I   E I+ G+ +  ++A D D  +K     Y   + +D + +  E  +G + V + LDRE +     V H  D +  +++C  +I+I V DINDN P F   S+A +     E+A   ++I K+HA+D D G+NR+I Y ++ E+   F I + TGI+R+   LDRE     +L ++A DCG P   +I  V + +LD+ND+PP+F       ++ E+   G  +  + A S DIGVNA++ Y +++  EQ  F+++S +G+L L   LD+E+S+ YFLT++A D G P LS    V I ++D+NDN P F    Y  N+ E+  V    I  V A D DS +N ++TY+       ++ +N          F I+PK G I ++   DRE    Y  ++   D G P   +   + I I D NDN P F+  ++  ++Q +R            G +F      I D D   N+ P+   + +      F ++ D           GSL    R          + V+V DNG P LY    V V +I  S  PP + PL VT   F    S   IGK      V   D+   +D L F  V       + ++  F I + TG I     LD G+Y LNV V++       ++ I +  +T DM++ + VI+   +  + F         +  ++++M  +   +I +   S  +           S   V NRR R   + D  ++V+ AV  +    +   FF S      L+D+   +  +   + +     +  + C  +K+ CV G+C+  + +        F    ++F +  +   ++C+C   F+G  C+  +N C+  PC   R+C P  + + G+ C CP+  SG YCER S     S C +E C +   +  + F G  +  + + +      +E  FS+    R +Q+   L+        +IL  IN  G V    D  +   +    S+N ++DG+WH + L  S+     M D   HV   G  P +  + +    D     I +GA       E     S+I    +     GC+ ++     K+  + LP  +   S++  L +  N+ + C  S  L+R  +C +  C N G+C  ++ + D    + C CQ  ++G++CEI    C   PC+ GG+C     + + C CP  L+G RC++GK C+   NPC     C E          +  C    RGY    C+IDVDEC+ QP  C  G   C N    ++C C     G  C       +Y ++ S  L  F I  I GI
Sbjct:  113 FKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYET--EANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYY-----SLLMDSEYF--AIHPTTGEITLLQQL-QYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSS-VTPTSNPLIYGIVRVNDKDTGINGNIGRLEIV----DGNPDGTFLLKAAETKDEYYIELNQ-FAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFT-QEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTA--------------KQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFS-GIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEV--FVTSAIDFDAGDIISYRLSDGN-EDGCFNLDPTSGSLSISCDLKK---TTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFG-SFEC--RETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFV-NFPQELSINESVQLGETVAWIEAK----DRDLGYNGKLVFAISDGDYDSVF---RIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFR----LTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGG--SPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDP-SLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITG-GDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCV-EVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAE-------HILEVAISDNGSPVLSSTSRIVVSVLD--------INDNSPEFDQRVYKVQVPSSATVNQSIF--QVHAIDSDSGENGRITYSIKSGKGKNK-------FRIDSQRGHI--HIAKPLDSDNE--------FEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNA----------PLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQ---LWYNISNGNDDNTFYIGQDNGN-------ILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQF---AKDVYHVNISENIEEESVIMQLHA--------------------TDRDEDKKLFYHLHATQDPSSL-ALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSK---------------------------------------VPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVG-SVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPL--SSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFV------TQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIK---VFNLTVKGTN--MAAESSCQNIIIHILDANDNIPYFVQNEYV-GALPESAAIGSYVLKVHDSSK-----DHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYT-FDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDAD-NDTLRFDIVDGNTNECFQIEKYTGIITTRNFEI-LNNENDRDYALHVRASDGIFSAILIVKIKVLSAIDSN-FAFQRESYRFSAFENNTKVATIGL--VNVIGNTLDENVEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYEL---KKGNGEL-FKLDRKSGELSIKQ--HVEGHNRNYELTVAAYDGAITPCSSEAPLQVKVIDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISS--ESQSFEIDYNTG-------SIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQN--NSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNEL-QTYSIDKLTGVISLQNMLNFTD--KSSTVL--NISVSDGVHTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEAN----QTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFK----SKAESYGVNS-------YQFFVRASDRGEPQFHSEVPVSIEIIETDANIPT-----FEKSSV-------LLKIIESTPPGTV-----LTKLHMIGNYTFKFSIAA--DQDHFMI-SDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYL-ESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKL--PIEGLSVFENA------LPGTVLINLLLIDPDIE--KQEMDFFIVSGDKQ---AQFQIGKSGELFIAKPLDREQLMF-YNLSIIATDGKFTAKAN--VEIDVKDINDNTPYCLK-PRYHISTNESISIGTTLVEVKAIDFDFQSKLRF--YLSGKGADDFSIGKE--SGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF---SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGS-KILDVKATDEDSDVNGLVTYNI------ERGDNIGQ-------FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLL----------GYVFLT--FKISDADETPNTTPYTFDIRSGNEGGLFRLEQD-----------GSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGK------VHASDQD-KYDELNFSLVSGPDDMYQ-SSKLFNISNNTGKIYAISNLDIGLYKLNVSVSDGKFHVFSIVKINVELVTNDMLKESVVIRFRRISASEFLLSHRK-TFMRSIRNIMRCRQKDVILITLQSDYQKA---------SQHAVGNRRAR---SIDSDLNVVFAVRKQQIIPDSDEFFTSDEIRQTLIDKKNEIENETNLVVE----DVLPSTCQSNKNDCVHGECKQILQILKNNVTTTF-TDVISFAAPSYIPVNTCVCRPGFDGKHCKETVNACSTDPCSPQRICMPSGS-ALGYQCVCPKGFSGTYCERKS-----SKCSNESCDMGLFT-AVSFGGKSYAHYKINKVKAKFTLENGFSYSLQIRTVQQTGTLLYASGKVDYNILEIIN--GAVQYRFDLGSGEGVISVSSIN-ISDGEWHQISLERSLNSAKVMVDNK-HVS-HGSAPGVNGILNIQSND-----IFVGA-------EVRPHPSIIGYEDIQRGFIGCMANI-----KIAKESLPLYISGGSTIAALKRFTNVEFKCDPSNVLVRLGICGSQPCANSGIC--KELDTD---VFECACQPRYSGKHCEIDLDPCSSGPCLFGGRCDYHGPNNYSCTCPIHLSGKRCEYGKFCTP--NPCKNGGICEE-------GDGISHC--MCRGYTGPTCEIDVDECENQP--CGNG-ATCINEPGSFRCICPSYLTGASCG----DPLYSNSISTKLKNFSIEHISGI 4286          

HSP 2 Score: 77.7962 bits (190), Expect = 3.783e-13
Identity = 135/599 (22.54%), Postives = 240/599 (40.07%), Query Frame = 3
Query: 6333 LLQLRVHDPDLNPTILFSILNGKESRFFSI------DPTTGWLKISTNDIPVSGKFPSVVLINIRAFD-------GKFETSCNITINSFDNTRNKVLPL-EKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSALDREERPFVQLLVLA---KGWDGSYDY----INVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTV-IYSIYYVKP-FAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIV--SDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS---STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPS---SSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRA---HMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNSKLIYKVLNEYYN-IFKIDQSSG 8024
            L  LRV    LN  + + I++G + + F        D     ++  TN++ ++ +     +I ++A           +ET  NI I   D  RN + PL   +Q    IPE+      ++   A       +  I Y LL +     I+  TG + L   L   E    +L V+A     W    ++      V++SV   N Y P   ++ +  +  T+       +RV   D D G NG +    I    P   + LK A   +   I +            + + + A D G P   ++  V + I   S   P+F +  Y V +PE A  +  V  +K           +   I  GN+ + F ++       P   ++    +LD E K  +TL +SA D +   S    S  V I+V D+ND  PIF   +   S++EN      ++ ++   +    +  + +S+  + ++ P    HF     +G +     LDFE  M   + ++++      P  R     + + + D NDN P+F +      ++  +  G+ V +  A D D    + Y++ +   +  F +D +SG
Sbjct:   89 LAGLRV---GLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLD--RNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVN--DKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRIN-------PDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANL-NAVPFEIDHF-----SGIVKTTSLLDFET-MKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSG 666          

HSP 3 Score: 68.1662 bits (165), Expect = 3.384e-10
Identity = 115/555 (20.72%), Postives = 219/555 (39.46%), Query Frame = 3
Query: 10239 GINRKIVYRILDESKSSFSIDRDTGIMRVASL----------LDRERQPEHHLVIEAS----DCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLV---SKLTIGKVTAYDSDSGLNSMLT-YSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVR---------TLWVQVTDNGQPSLYCRVQ----VAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLD----SGMYSLNVKVTNVTLSTEKVIFIKIVALTKDM 11798
            G+N ++ YRI+   K       +  +   A L          L+RE+  E+ + ++A     D          N+ I +LD ND  P F      + + EDT   + ++ + A   D+G+N E+ Y ++ +  +F +   +G +TL+++L +  +  + LTV A D+G   ++       +            + P +F    +++    + L  G V   D D+G+N  +     +   P+  +  ++     E++  +N         F    ++   Y   +   D G P   +  +V I+I+ ++ N P F Q  +   I       +P            V RL + D D   N+  +  +++       F +  D          +G LY   +         TL V   D  Q ++  R Q    V ++V  +++  P  E  NV  V   +E  +     + ++  +DR         E  Y     + +N   F+ID F+G + TT +LD       Y L ++ ++  L   +   IK+  + KD+
Sbjct:   95 GLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRG-SWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELN--------QFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMP------------VIRLKVSDPDLGKNALVY-LEIVGGNEGDEFRINPD----------SGMLYTAKQLDAEKKSSYTLTVSAID--QANVGSRKQSSAKVKISVQDMNDNDPIFE--NVNKVISINENNLAGSF-VVKLTAKDRDSG------ENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDI 606          

HSP 4 Score: 58.5362 bits (140), Expect = 2.183e-7
Identity = 112/447 (25.06%), Postives = 182/447 (40.72%), Query Frame = 3
Query: 10548 IGVNAEVSYQMIT---EQNFFRLESLSGNLTLIK--------KLDFELSREYFLTVRAS----DKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAF-----SSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLG----VRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIE--PLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDS---GMYSLNVK-VTNVTLSTEKVIFIKIVALTKDM 11798
            +G+NAEV Y++I+   E+ F   E L G+   +          L+ E + EY + V+A     D+   S  T   + I+V+D ND  P F    Y   IPE+T   + +I KVTA D+D G+N  + YS L                   +F I+P TGEI L       E   ++  V   D G         +SKT V+I ++  N   PE    +F        S + P        +    G + + DKD   N N  + ++++      FL+K  E  DE  + +    +L     +  L +   D G P  +    V +       I PE +  P+    +Y   E  I +   I   ++R +    D+     VY E +     +  F+I+  +G + T + LD+     Y+L V  +    + + K    K+    +DM
Sbjct:   94 VGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQ-SILKVTADDADLGINGEIYYSLLMD---------------SEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTF--------SSVTP------TSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPI------QIKPESKNIPIFTQEIY---EVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDE-FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDM 500          
BLAST of Ft-2 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0346077)

HSP 1 Score: 1059.28 bits (2738), Expect = 0.000e+0
Identity = 1204/4572 (26.33%), Postives = 2049/4572 (44.82%), Query Frame = 3
Query:  390 FEAESKLVGDFFYLRIRTKYT-ASLNRERIGFYNLTIQGL--FESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVKYLSKYFDPDFNDYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNVFLTPTGEL-NRYVLKLRAIFSPISTPAI--SVTIEAKDLSLNPKTSSTHLTIPLG-NLRNINLLSVPEFVSVSIPENAIVNSSVCLLK---------TFIXXXXXXXXXXXXFRWIPDLEGTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVV----DANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFG---------MRNI--PIFATNIPSVIHIREESAKGTIVQKITMKTADKDRD-PYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPP---RFLDSFQIPMTLPENYDIKKRIVQIKATDADS---KDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSD--CFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEP--QSFVYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXX-XXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAP--TMWTRSPAEVTIRLYLSENATDPKSENDKSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRA----TYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFA-SYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSAL-DREERPFVQLLVLAKG--WDGSYDYI-----NVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDA-LKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNS--KLIYKVL--NEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSI---TGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCE--EPLYSYRIATTV--ISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLM-ATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKA--GHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFP-RVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIPDLMIF--EGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVE--SKKCSFKILINVLDINDNAPRFVHTSIAPFL----ENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVR---------TLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFH---SETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKPNIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNE----NEYRFFKS----SALVDRIKTLTPDLTKIFQASSVKIFNNVCD-DKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSF----RVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRL--SILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGARNYISTREYNLEKSVI----LDESMTGCIQDVILNNQKLPYQQLPAPVPS-SSLGVLSK--NLNYGCSES--LMR-SLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKC-VDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGY---MCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHCEIDGLISIYPDNSSFGLSQFHIYVIVGI 13718
            F+AE KLVGDF +L IRT+     LNRE+   Y + ++       ++   +ET  +  + IKVLDRND  P+F    +  +  E+      I  VTA DAD G+N EI+Y     ++  DS  F  +I+P +G I  +Q+L  +   S     + A  RG     +    S++ +SISV   N +AP+I  K  S    P  N   +  + V D+D  +N N     I+      +P   FL    E  + Y ++L   F+ ++      ++T+ A+DL    + +   + I +    +NI + +  E   VSIPE A +N  V  LK           +    V       FR  PD    Y+               K L+AE   S    ++     N     + +  ++ISVQD+N+  P+  N   VI++ EN   G  V+ + A D D      ISY + + N +PF +  F   +V     LD ETM+R + + +  +D G P  R       I + D+N+ +P+F    C   +++ AP   ++  F+   +D D  D I   ++  + +  CF++ P SG+LS+ C  K    + LTN  + + A D    S  + +N  ++      +S  L G     +C   +  V  +     ++   NN + ++  +F           +N+  P F  N P  + I E    G  V  I  K    DRD  Y  + VF +   +   VF   R D    ++ +   LDRE  ++Y + I V D G P     K   I + D+NDN P   + L +F+    L E+  I   +  + ATDADS     + Y L      F +++ TG LRL   LDREK+D Y + I A D    +  L++ A + ++V D+NDN P+F    Y   + EDLP G+ L  + A D D+  N+++++++     D   F  D  TGA+     L    +  + LI    D G P +L+S     I    V+ NR+ P   + +    ++EN   GT V ++     D         Y+I+G  +G+ +F +N++G I ++S +D E +  YWL +  +D     ++  + EVYI+V +ENDN P+ ++  Y  +V E       +IT+KA D D++    + Y I+SG+  GYF I S   +  T+ER +DRE           + L+V ISD+G P   +T  I V+++D        INDN   F++ +    +      N +I   +V A+D D   N  + Y+++  +  N        F +D + GH+  +I+  +  +++        F+I++ A D G P  +   R    V      S+NA           L +     + +++  ++  G  +  I  VD  + +   L   I + +   +    + +G+       ILL         +   L I++ +  F    N+ + +   N N P F   + +   +NI ++ +    I  + A                    T+ D  + + Y + A+ DP ++  LF I+S +G++ +    +        +IV  +++ A     Y K+ +++ D N+ +PEF     QS                                        +   ++IG+ L  + A D+D G N ++ ++I   +V  + FE+D   G I +  +L   + +   L +   DLG PP    S + V I      +  P+   + + + + EN  + + +      +     +++      I  +  + F +  STG I+   ++D E I+     ++ V+  +  ++  +S  ++ IHI D NDN P F+    + G + ESA  GS V    D  K       L +  +D D G NG +EY I+   A ++FKID  TG + L  ++D E    +    + + D G PKL S     + I + + NDCPP F +      L LPTF +  + Q+   D D N T+ F I++G  +  F I+  TG +     +I ++ +      +++RA DG F     + I       +     ++    +   EN   V  + L       +    +++Y +L+     +I   +G+LK    + DRE +   +L V AK   +DG    +     ++ +SV D ND  P+F++  Y   V  +  K    ++VKAIDLD+ ENG V Y +   K    +L F +D  SG ++I+     E   + + + + A D      SS   + V ++    P+F+K  Y+V V ED  +   +  +++A S  G +++YTI++  + + F++D+           I +V +LDYE    H + I ATD  S +     + ++++D+ND  P      Y+ ++ EN     +I+ I+        +  + + ++ I   +  +S+ F I+ T G + +K  LD+E    H   + VK  G  S ++R+++ + + D NDN P F++P++   +S+ + +G  V +  A D D +    L YK++  NE    + ID+ +G I    + N      SS V+   + V D  H+  A + ++ +    + P F  + +   V EN      I  + ASD D   +  L Y ++     +IF +D  TG +  K T DRE+K  + + + VSD G K  FA++ + V D+NDN+P      Y++ V  + ++     ++IL + AKD D+     + +++V     +++  V  I   TG +  K    ++  + G+N+       YQ   +  +  EP +   +  ++  I    N+       ++K  V       ++ I E+ P   +     ++   M G ++   S +    Q+ F I S+ G +  ++ +D E Q  + + V       P+  A   +LID+ D+ND  P FDN+ Y+  ++E+      +++  A D D      I Y L + D+      F ID   GW+  ++++D E     N  V A+D     H     +TI + D ND  P +    P++G+ + E         P  V+  L   D D E  K+ + F I + +     A F++ +SGE+ +  PLD E+++    L  +A+D    +K    + I V D+ND+ P C + P   I   E I+ G+ +  ++A D D  +K     Y   + +D + +  E  +G + V + LDRE +     V H  D +  +++C  +I+I V DINDN P F   S+A +     E+A   ++I K+HA+D D G+NR+I Y ++ E+   F I + TGI+R+   LDRE     +L ++A DCG P   +I  V + +LD+ND+PP+F       ++ E+   G  +  + A S DIGVNA++ Y +++  EQ  F+++S +G+L L   LD+E+S+ YFLT++A D G P LS    V I ++D+NDN P F    Y  N+ E+  V    I  V A D DS +N ++TY+       ++ +N          F I+PK G I ++   DRE    Y  ++   D G P   +   + I I D NDN P F+  ++  ++Q +R            G +F      I D D   N+ P+   + +      F ++ D           GSL    R          + V+V DNG P LY    V V +I  S  PP + PL VT   F    S   IGK      V   D+   +D L F  V       + ++  F I + TG I     LD G+Y LNV V++       ++ I +  +T DM++ + VI+   +  + F         +  ++++M  +   +I +   S  +           S   V NRR R   + D  ++V+ AV  +    +   FF S      L+D+   +  +   + +     +  + C  +K+ CV G+C+  + +        F    ++F +  +   ++C+C   F+G  C+  +N C+  PC   R+C P  + + G+ C CP+  SG YCER S     S C +E C +   +  + F G  +  + + +      +E  FS+    R +Q+   L+        +IL  IN  G V    D  +   +    S+N ++DG+WH + L  S+     M D   HV   G  P +  + +    D     I +GA       E     S+I    +     GC+ ++     K+  + LP  +   S++  L +  N+ + C  S  L+R  +C +  C N G+C  ++ + D    + C CQ  ++G++CEI    C   PC+ GG+C     + + C CP  L+G RC++GK C+   NPC     C E          +  C    RGY    C+IDVDEC+ QP  C  G   C N    ++C C     G  C       +Y ++ S  L  F I  I GI
Sbjct:  113 FKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYET--EANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYY-----SLLMDSEYF--AIHPTTGEITLLQQL-QYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSS-VTPTSNPLIYGIVRVNDKDTGINGNIGRLEIV----DGNPDGTFLLKAAETKDEYYIELNQ-FAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFT-QEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTA--------------KQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFS-GIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEV--FVTSAIDFDAGDIISYRLSDGN-EDGCFNLDPTSGSLSISCDLKK---TTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFG-SFEC--RETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFV-NFPQELSINESVQLGETVAWIEAK----DRDLGYNGKLVFAISDGDYDSVF---RIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFR----LTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGG--SPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDP-SLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITG-GDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCV-EVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAE-------HILEVAISDNGSPVLSSTSRIVVSVLD--------INDNSPEFDQRVYKVQVPSSATVNQSIF--QVHAIDSDSGENGRITYSIKSGKGKNK-------FRIDSQRGHI--HIAKPLDSDNE--------FEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNA----------PLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQ---LWYNISNGNDDNTFYIGQDNGN-------ILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQF---AKDVYHVNISENIEEESVIMQLHA--------------------TDRDEDKKLFYHLHATQDPSSL-ALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSK---------------------------------------VPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVG-SVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPL--SSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFV------TQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIK---VFNLTVKGTN--MAAESSCQNIIIHILDANDNIPYFVQNEYV-GALPESAAIGSYVLKVHDSSK-----DHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYT-FDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDAD-NDTLRFDIVDGNTNECFQIEKYTGIITTRNFEI-LNNENDRDYALHVRASDGIFSAILIVKIKVLSAIDSN-FAFQRESYRFSAFENNTKVATIGL--VNVIGNTLDENVEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYEL---KKGNGEL-FKLDRKSGELSIKQ--HVEGHNRNYELTVAAYDGAITPCSSEAPLQVKVIDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISS--ESQSFEIDYNTG-------SIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQN--NSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNEL-QTYSIDKLTGVISLQNMLNFTD--KSSTVL--NISVSDGVHTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEAN----QTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFK----SKAESYGVNS-------YQFFVRASDRGEPQFHSEVPVSIEIIETDANIPT-----FEKSSV-------LLKIIESTPPGTV-----LTKLHMIGNYTFKFSIAA--DQDHFMI-SDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYL-ESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKL--PIEGLSVFENA------LPGTVLINLLLIDPDIE--KQEMDFFIVSGDKQ---AQFQIGKSGELFIAKPLDREQLMF-YNLSIIATDGKFTAKAN--VEIDVKDINDNTPYCLK-PRYHISTNESISIGTTLVEVKAIDFDFQSKLRF--YLSGKGADDFSIGKE--SGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF---SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGS-KILDVKATDEDSDVNGLVTYNI------ERGDNIGQ-------FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLL----------GYVFLT--FKISDADETPNTTPYTFDIRSGNEGGLFRLEQD-----------GSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGK------VHASDQD-KYDELNFSLVSGPDDMYQ-SSKLFNISNNTGKIYAISNLDIGLYKLNVSVSDGKFHVFSIVKINVELVTNDMLKESVVIRFRRISASEFLLSHRK-TFMRSIRNIMRCRQKDVILITLQSDYQKA---------SQHAVGNRRAR---SIDSDLNVVFAVRKQQIIPDSDEFFTSDEIRQTLIDKKNEIENETNLVVE----DVLPSTCQSNKNDCVHGECKQILQILKNNVTTTF-TDVISFAAPSYIPVNTCVCRPGFDGKHCKETVNACSTDPCSPQRICMPSGS-ALGYQCVCPKGFSGTYCERKS-----SKCSNESCDMGLFT-AVSFGGKSYAHYKINKVKAKFTLENGFSYSLQIRTVQQTGTLLYASGKVDYNILEIIN--GAVQYRFDLGSGEGVISVSSIN-ISDGEWHQISLERSLNSAKVMVDNK-HVS-HGSAPGVNGILNIQSND-----IFVGA-------EVRPHPSIIGYEDIQRGFIGCMANI-----KIAKESLPLYISGGSTIAALKRFTNVEFKCDPSNVLVRLGICGSQPCANSGIC--KELDTD---VFECACQPRYSGKHCEIDLDPCSSGPCLFGGRCDYHGPNNYSCTCPIHLSGKRCEYGKFCTP--NPCKNGGICEE-------GDGISHC--MCRGYTGPTCEIDVDECENQP--CGNG-ATCINEPGSFRCICPSYLTGASCG----DPLYSNSISTKLKNFSIEHISGI 4286          

HSP 2 Score: 77.411 bits (189), Expect = 4.821e-13
Identity = 135/599 (22.54%), Postives = 240/599 (40.07%), Query Frame = 3
Query: 6333 LLQLRVHDPDLNPTILFSILNGKESRFFSI------DPTTGWLKISTNDIPVSGKFPSVVLINIRAFD-------GKFETSCNITINSFDNTRNKVLPL-EKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSALDREERPFVQLLVLA---KGWDGSYDY----INVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTV-IYSIYYVKP-FAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIV--SDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS---STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPS---SSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRA---HMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNSKLIYKVLNEYYN-IFKIDQSSG 8024
            L  LRV    LN  + + I++G + + F        D     ++  TN++ ++ +     +I ++A           +ET  NI I   D  RN + PL   +Q    IPE+      ++   A       +  I Y LL +     I+  TG + L   L   E    +L V+A     W    ++      V++SV   N Y P   ++ +  +  T+       +RV   D D G NG +    I    P   + LK A   +   I +            + + + A D G P   ++  V + I   S   P+F +  Y V +PE A  +  V  +K           +   I  GN+ + F ++       P   ++    +LD E K  +TL +SA D +   S    S  V I+V D+ND  PIF   +   S++EN      ++ ++   +    +  + +S+  + ++ P    HF     +G +     LDFE  M   + ++++      P  R     + + + D NDN P+F +      ++  +  G+ V +  A D D    + Y++ +   +  F +D +SG
Sbjct:   89 LAGLRV---GLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLD--RNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVN--DKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRIN-------PDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANL-NAVPFEIDHF-----SGIVKTTSLLDFET-MKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSG 666          

HSP 3 Score: 67.781 bits (164), Expect = 4.033e-10
Identity = 115/555 (20.72%), Postives = 219/555 (39.46%), Query Frame = 3
Query: 10239 GINRKIVYRILDESKSSFSIDRDTGIMRVASL----------LDRERQPEHHLVIEAS----DCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLV---SKLTIGKVTAYDSDSGLNSMLT-YSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVR---------TLWVQVTDNGQPSLYCRVQ----VAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLD----SGMYSLNVKVTNVTLSTEKVIFIKIVALTKDM 11798
            G+N ++ YRI+   K       +  +   A L          L+RE+  E+ + ++A     D          N+ I +LD ND  P F      + + EDT   + ++ + A   D+G+N E+ Y ++ +  +F +   +G +TL+++L +  +  + LTV A D+G   ++       +            + P +F    +++    + L  G V   D D+G+N  +     +   P+  +  ++     E++  +N         F    ++   Y   +   D G P   +  +V I+I+ ++ N P F Q  +   I       +P            V RL + D D   N+  +  +++       F +  D          +G LY   +         TL V   D  Q ++  R Q    V ++V  +++  P  E  NV  V   +E  +     + ++  +DR         E  Y     + +N   F+ID F+G + TT +LD       Y L ++ ++  L   +   IK+  + KD+
Sbjct:   95 GLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRG-SWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELN--------QFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMP------------VIRLKVSDPDLGKNALVY-LEIVGGNEGDEFRINPD----------SGMLYTAKQLDAEKKSSYTLTVSAID--QANVGSRKQSSAKVKISVQDMNDNDPIFE--NVNKVISINENNLAGSF-VVKLTAKDRDSG------ENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDI 606          

HSP 4 Score: 58.5362 bits (140), Expect = 2.646e-7
Identity = 112/447 (25.06%), Postives = 182/447 (40.72%), Query Frame = 3
Query: 10548 IGVNAEVSYQMIT---EQNFFRLESLSGNLTLIK--------KLDFELSREYFLTVRAS----DKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAF-----SSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLG----VRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIE--PLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDS---GMYSLNVK-VTNVTLSTEKVIFIKIVALTKDM 11798
            +G+NAEV Y++I+   E+ F   E L G+   +          L+ E + EY + V+A     D+   S  T   + I+V+D ND  P F    Y   IPE+T   + +I KVTA D+D G+N  + YS L                   +F I+P TGEI L       E   ++  V   D G         +SKT V+I ++  N   PE    +F        S + P        +    G + + DKD   N N  + ++++      FL+K  E  DE  + +    +L     +  L +   D G P  +    V +       I PE +  P+    +Y   E  I +   I   ++R +    D+     VY E +     +  F+I+  +G + T + LD+     Y+L V  +    + + K    K+    +DM
Sbjct:   94 VGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQ-SILKVTADDADLGINGEIYYSLLMD---------------SEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTF--------SSVTP------TSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPI------QIKPESKNIPIFTQEIY---EVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDE-FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDM 500          
BLAST of Ft-2 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332721)

HSP 1 Score: 1059.28 bits (2738), Expect = 0.000e+0
Identity = 1204/4572 (26.33%), Postives = 2049/4572 (44.82%), Query Frame = 3
Query:  390 FEAESKLVGDFFYLRIRTKYT-ASLNRERIGFYNLTIQGL--FESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVKYLSKYFDPDFNDYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNVFLTPTGEL-NRYVLKLRAIFSPISTPAI--SVTIEAKDLSLNPKTSSTHLTIPLG-NLRNINLLSVPEFVSVSIPENAIVNSSVCLLK---------TFIXXXXXXXXXXXXFRWIPDLEGTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVV----DANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFG---------MRNI--PIFATNIPSVIHIREESAKGTIVQKITMKTADKDRD-PYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPP---RFLDSFQIPMTLPENYDIKKRIVQIKATDADS---KDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSD--CFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEP--QSFVYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXX-XXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAP--TMWTRSPAEVTIRLYLSENATDPKSENDKSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRA----TYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFA-SYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSAL-DREERPFVQLLVLAKG--WDGSYDYI-----NVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDA-LKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNS--KLIYKVL--NEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSI---TGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCE--EPLYSYRIATTV--ISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLM-ATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKA--GHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFP-RVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIPDLMIF--EGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVE--SKKCSFKILINVLDINDNAPRFVHTSIAPFL----ENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVR---------TLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFH---SETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKPNIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNE----NEYRFFKS----SALVDRIKTLTPDLTKIFQASSVKIFNNVCD-DKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSF----RVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRL--SILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGARNYISTREYNLEKSVI----LDESMTGCIQDVILNNQKLPYQQLPAPVPS-SSLGVLSK--NLNYGCSES--LMR-SLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKC-VDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGY---MCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHCEIDGLISIYPDNSSFGLSQFHIYVIVGI 13718
            F+AE KLVGDF +L IRT+     LNRE+   Y + ++       ++   +ET  +  + IKVLDRND  P+F    +  +  E+      I  VTA DAD G+N EI+Y     ++  DS  F  +I+P +G I  +Q+L  +   S     + A  RG     +    S++ +SISV   N +AP+I  K  S    P  N   +  + V D+D  +N N     I+      +P   FL    E  + Y ++L   F+ ++      ++T+ A+DL    + +   + I +    +NI + +  E   VSIPE A +N  V  LK           +    V       FR  PD    Y+               K L+AE   S    ++     N     + +  ++ISVQD+N+  P+  N   VI++ EN   G  V+ + A D D      ISY + + N +PF +  F   +V     LD ETM+R + + +  +D G P  R       I + D+N+ +P+F    C   +++ AP   ++  F+   +D D  D I   ++  + +  CF++ P SG+LS+ C  K    + LTN  + + A D    S  + +N  ++      +S  L G     +C   +  V  +     ++   NN + ++  +F           +N+  P F  N P  + I E    G  V  I  K    DRD  Y  + VF +   +   VF   R D    ++ +   LDRE  ++Y + I V D G P     K   I + D+NDN P   + L +F+    L E+  I   +  + ATDADS     + Y L      F +++ TG LRL   LDREK+D Y + I A D    +  L++ A + ++V D+NDN P+F    Y   + EDLP G+ L  + A D D+  N+++++++     D   F  D  TGA+     L    +  + LI    D G P +L+S     I    V+ NR+ P   + +    ++EN   GT V ++     D         Y+I+G  +G+ +F +N++G I ++S +D E +  YWL +  +D     ++  + EVYI+V +ENDN P+ ++  Y  +V E       +IT+KA D D++    + Y I+SG+  GYF I S   +  T+ER +DRE           + L+V ISD+G P   +T  I V+++D        INDN   F++ +    +      N +I   +V A+D D   N  + Y+++  +  N        F +D + GH+  +I+  +  +++        F+I++ A D G P  +   R    V      S+NA           L +     + +++  ++  G  +  I  VD  + +   L   I + +   +    + +G+       ILL         +   L I++ +  F    N+ + +   N N P F   + +   +NI ++ +    I  + A                    T+ D  + + Y + A+ DP ++  LF I+S +G++ +    +        +IV  +++ A     Y K+ +++ D N+ +PEF     QS                                        +   ++IG+ L  + A D+D G N ++ ++I   +V  + FE+D   G I +  +L   + +   L +   DLG PP    S + V I      +  P+   + + + + EN  + + +      +     +++      I  +  + F +  STG I+   ++D E I+     ++ V+  +  ++  +S  ++ IHI D NDN P F+    + G + ESA  GS V    D  K       L +  +D D G NG +EY I+   A ++FKID  TG + L  ++D E    +    + + D G PKL S     + I + + NDCPP F +      L LPTF +  + Q+   D D N T+ F I++G  +  F I+  TG +     +I ++ +      +++RA DG F     + I       +     ++    +   EN   V  + L       +    +++Y +L+     +I   +G+LK    + DRE +   +L V AK   +DG    +     ++ +SV D ND  P+F++  Y   V  +  K    ++VKAIDLD+ ENG V Y +   K    +L F +D  SG ++I+     E   + + + + A D      SS   + V ++    P+F+K  Y+V V ED  +   +  +++A S  G +++YTI++  + + F++D+           I +V +LDYE    H + I ATD  S +     + ++++D+ND  P      Y+ ++ EN     +I+ I+        +  + + ++ I   +  +S+ F I+ T G + +K  LD+E    H   + VK  G  S ++R+++ + + D NDN P F++P++   +S+ + +G  V +  A D D +    L YK++  NE    + ID+ +G I    + N      SS V+   + V D  H+  A + ++ +    + P F  + +   V EN      I  + ASD D   +  L Y ++     +IF +D  TG +  K T DRE+K  + + + VSD G K  FA++ + V D+NDN+P      Y++ V  + ++     ++IL + AKD D+     + +++V     +++  V  I   TG +  K    ++  + G+N+       YQ   +  +  EP +   +  ++  I    N+       ++K  V       ++ I E+ P   +     ++   M G ++   S +    Q+ F I S+ G +  ++ +D E Q  + + V       P+  A   +LID+ D+ND  P FDN+ Y+  ++E+      +++  A D D      I Y L + D+      F ID   GW+  ++++D E     N  V A+D     H     +TI + D ND  P +    P++G+ + E         P  V+  L   D D E  K+ + F I + +     A F++ +SGE+ +  PLD E+++    L  +A+D    +K    + I V D+ND+ P C + P   I   E I+ G+ +  ++A D D  +K     Y   + +D + +  E  +G + V + LDRE +     V H  D +  +++C  +I+I V DINDN P F   S+A +     E+A   ++I K+HA+D D G+NR+I Y ++ E+   F I + TGI+R+   LDRE     +L ++A DCG P   +I  V + +LD+ND+PP+F       ++ E+   G  +  + A S DIGVNA++ Y +++  EQ  F+++S +G+L L   LD+E+S+ YFLT++A D G P LS    V I ++D+NDN P F    Y  N+ E+  V    I  V A D DS +N ++TY+       ++ +N          F I+PK G I ++   DRE    Y  ++   D G P   +   + I I D NDN P F+  ++  ++Q +R            G +F      I D D   N+ P+   + +      F ++ D           GSL    R          + V+V DNG P LY    V V +I  S  PP + PL VT   F    S   IGK      V   D+   +D L F  V       + ++  F I + TG I     LD G+Y LNV V++       ++ I +  +T DM++ + VI+   +  + F         +  ++++M  +   +I +   S  +           S   V NRR R   + D  ++V+ AV  +    +   FF S      L+D+   +  +   + +     +  + C  +K+ CV G+C+  + +        F    ++F +  +   ++C+C   F+G  C+  +N C+  PC   R+C P  + + G+ C CP+  SG YCER S     S C +E C +   +  + F G  +  + + +      +E  FS+    R +Q+   L+        +IL  IN  G V    D  +   +    S+N ++DG+WH + L  S+     M D   HV   G  P +  + +    D     I +GA       E     S+I    +     GC+ ++     K+  + LP  +   S++  L +  N+ + C  S  L+R  +C +  C N G+C  ++ + D    + C CQ  ++G++CEI    C   PC+ GG+C     + + C CP  L+G RC++GK C+   NPC     C E          +  C    RGY    C+IDVDEC+ QP  C  G   C N    ++C C     G  C       +Y ++ S  L  F I  I GI
Sbjct:  113 FKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYET--EANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYY-----SLLMDSEYF--AIHPTTGEITLLQQL-QYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSS-VTPTSNPLIYGIVRVNDKDTGINGNIGRLEIV----DGNPDGTFLLKAAETKDEYYIELNQ-FAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFT-QEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTA--------------KQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFS-GIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEV--FVTSAIDFDAGDIISYRLSDGN-EDGCFNLDPTSGSLSISCDLKK---TTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGDSSILHGFG-SFEC--RETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFV-NFPQELSINESVQLGETVAWIEAK----DRDLGYNGKLVFAISDGDYDSVF---RIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFR----LTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGG--SPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDP-SLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITG-GDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCV-EVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAE-------HILEVAISDNGSPVLSSTSRIVVSVLD--------INDNSPEFDQRVYKVQVPSSATVNQSIF--QVHAIDSDSGENGRITYSIKSGKGKNK-------FRIDSQRGHI--HIAKPLDSDNE--------FEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNA----------PLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQ---LWYNISNGNDDNTFYIGQDNGN-------ILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQF---AKDVYHVNISENIEEESVIMQLHA--------------------TDRDEDKKLFYHLHATQDPSSL-ALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSK---------------------------------------VPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVG-SVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPL--SSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFV------TQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIK---VFNLTVKGTN--MAAESSCQNIIIHILDANDNIPYFVQNEYV-GALPESAAIGSYVLKVHDSSK-----DHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYT-FDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDAD-NDTLRFDIVDGNTNECFQIEKYTGIITTRNFEI-LNNENDRDYALHVRASDGIFSAILIVKIKVLSAIDSN-FAFQRESYRFSAFENNTKVATIGL--VNVIGNTLDENVEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYEL---KKGNGEL-FKLDRKSGELSIKQ--HVEGHNRNYELTVAAYDGAITPCSSEAPLQVKVIDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISS--ESQSFEIDYNTG-------SIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQN--NSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNEL-QTYSIDKLTGVISLQNMLNFTD--KSSTVL--NISVSDGVHTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEAN----QTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFK----SKAESYGVNS-------YQFFVRASDRGEPQFHSEVPVSIEIIETDANIPT-----FEKSSV-------LLKIIESTPPGTV-----LTKLHMIGNYTFKFSIAA--DQDHFMI-SDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYL-ESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKL--PIEGLSVFENA------LPGTVLINLLLIDPDIE--KQEMDFFIVSGDKQ---AQFQIGKSGELFIAKPLDREQLMF-YNLSIIATDGKFTAKAN--VEIDVKDINDNTPYCLK-PRYHISTNESISIGTTLVEVKAIDFDFQSKLRF--YLSGKGADDFSIGKE--SGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF---SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGS-KILDVKATDEDSDVNGLVTYNI------ERGDNIGQ-------FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLL----------GYVFLT--FKISDADETPNTTPYTFDIRSGNEGGLFRLEQD-----------GSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGK------VHASDQD-KYDELNFSLVSGPDDMYQ-SSKLFNISNNTGKIYAISNLDIGLYKLNVSVSDGKFHVFSIVKINVELVTNDMLKESVVIRFRRISASEFLLSHRK-TFMRSIRNIMRCRQKDVILITLQSDYQKA---------SQHAVGNRRAR---SIDSDLNVVFAVRKQQIIPDSDEFFTSDEIRQTLIDKKNEIENETNLVVE----DVLPSTCQSNKNDCVHGECKQILQILKNNVTTTF-TDVISFAAPSYIPVNTCVCRPGFDGKHCKETVNACSTDPCSPQRICMPSGS-ALGYQCVCPKGFSGTYCERKS-----SKCSNESCDMGLFT-AVSFGGKSYAHYKINKVKAKFTLENGFSYSLQIRTVQQTGTLLYASGKVDYNILEIIN--GAVQYRFDLGSGEGVISVSSIN-ISDGEWHQISLERSLNSAKVMVDNK-HVS-HGSAPGVNGILNIQSND-----IFVGA-------EVRPHPSIIGYEDIQRGFIGCMANI-----KIAKESLPLYISGGSTIAALKRFTNVEFKCDPSNVLVRLGICGSQPCANSGIC--KELDTD---VFECACQPRYSGKHCEIDLDPCSSGPCLFGGRCDYHGPNNYSCTCPIHLSGKRCEYGKFCTP--NPCKNGGICEE-------GDGISHC--MCRGYTGPTCEIDVDECENQP--CGNG-ATCINEPGSFRCICPSYLTGASCG----DPLYSNSISTKLKNFSIEHISGI 4286          

HSP 2 Score: 77.411 bits (189), Expect = 4.821e-13
Identity = 135/599 (22.54%), Postives = 240/599 (40.07%), Query Frame = 3
Query: 6333 LLQLRVHDPDLNPTILFSILNGKESRFFSI------DPTTGWLKISTNDIPVSGKFPSVVLINIRAFD-------GKFETSCNITINSFDNTRNKVLPL-EKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSALDREERPFVQLLVLA---KGWDGSYDY----INVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTV-IYSIYYVKP-FAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIV--SDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS---STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPS---SSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRA---HMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNSKLIYKVLNEYYN-IFKIDQSSG 8024
            L  LRV    LN  + + I++G + + F        D     ++  TN++ ++ +     +I ++A           +ET  NI I   D  RN + PL   +Q    IPE+      ++   A       +  I Y LL +     I+  TG + L   L   E    +L V+A     W    ++      V++SV   N Y P   ++ +  +  T+       +RV   D D G NG +    I    P   + LK A   +   I +            + + + A D G P   ++  V + I   S   P+F +  Y V +PE A  +  V  +K           +   I  GN+ + F ++       P   ++    +LD E K  +TL +SA D +   S    S  V I+V D+ND  PIF   +   S++EN      ++ ++   +    +  + +S+  + ++ P    HF     +G +     LDFE  M   + ++++      P  R     + + + D NDN P+F +      ++  +  G+ V +  A D D    + Y++ +   +  F +D +SG
Sbjct:   89 LAGLRV---GLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLD--RNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVN--DKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRIN-------PDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANL-NAVPFEIDHF-----SGIVKTTSLLDFET-MKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSG 666          

HSP 3 Score: 67.781 bits (164), Expect = 4.033e-10
Identity = 115/555 (20.72%), Postives = 219/555 (39.46%), Query Frame = 3
Query: 10239 GINRKIVYRILDESKSSFSIDRDTGIMRVASL----------LDRERQPEHHLVIEAS----DCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLV---SKLTIGKVTAYDSDSGLNSMLT-YSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVR---------TLWVQVTDNGQPSLYCRVQ----VAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLD----SGMYSLNVKVTNVTLSTEKVIFIKIVALTKDM 11798
            G+N ++ YRI+   K       +  +   A L          L+RE+  E+ + ++A     D          N+ I +LD ND  P F      + + EDT   + ++ + A   D+G+N E+ Y ++ +  +F +   +G +TL+++L +  +  + LTV A D+G   ++       +            + P +F    +++    + L  G V   D D+G+N  +     +   P+  +  ++     E++  +N         F    ++   Y   +   D G P   +  +V I+I+ ++ N P F Q  +   I       +P            V RL + D D   N+  +  +++       F +  D          +G LY   +         TL V   D  Q ++  R Q    V ++V  +++  P  E  NV  V   +E  +     + ++  +DR         E  Y     + +N   F+ID F+G + TT +LD       Y L ++ ++  L   +   IK+  + KD+
Sbjct:   95 GLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRG-SWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELN--------QFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMP------------VIRLKVSDPDLGKNALVY-LEIVGGNEGDEFRINPD----------SGMLYTAKQLDAEKKSSYTLTVSAID--QANVGSRKQSSAKVKISVQDMNDNDPIFE--NVNKVISINENNLAGSF-VVKLTAKDRDSG------ENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDI 606          

HSP 4 Score: 58.5362 bits (140), Expect = 2.646e-7
Identity = 112/447 (25.06%), Postives = 182/447 (40.72%), Query Frame = 3
Query: 10548 IGVNAEVSYQMIT---EQNFFRLESLSGNLTLIK--------KLDFELSREYFLTVRAS----DKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAF-----SSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLG----VRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIE--PLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDS---GMYSLNVK-VTNVTLSTEKVIFIKIVALTKDM 11798
            +G+NAEV Y++I+   E+ F   E L G+   +          L+ E + EY + V+A     D+   S  T   + I+V+D ND  P F    Y   IPE+T   + +I KVTA D+D G+N  + YS L                   +F I+P TGEI L       E   ++  V   D G         +SKT V+I ++  N   PE    +F        S + P        +    G + + DKD   N N  + ++++      FL+K  E  DE  + +    +L     +  L +   D G P  +    V +       I PE +  P+    +Y   E  I +   I   ++R +    D+     VY E +     +  F+I+  +G + T + LD+     Y+L V  +    + + K    K+    +DM
Sbjct:   94 VGLNAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQ-SILKVTADDADLGINGEIYYSLLMD---------------SEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTF--------SSVTP------TSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPI------QIKPESKNIPIFTQEIY---EVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDE-FRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDM 500          
BLAST of Ft-2 vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 362.844 bits (930), Expect = 2.995e-99
Identity = 553/2223 (24.88%), Postives = 940/2223 (42.29%), Query Frame = 3
Query: 4929 IIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKR-----ATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNS-ILHCXXXXXXXXXXXXAQYVVLSIKPS--TGKLFGVTRSTGCIITVSSLDREQIQD----IVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSL--ALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCP---PKFEKDFYLQVLILPTFP-SAPLLQLRVHDPDLNPTILFSILN-------GKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQV---VWEIPENRNDVPDLVLPRAKFYFSHQHP----SIKYILL-SEQPKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDG-SYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIV--SDKSPLFDKSKYSVIVPEDA--LKDFIVTTVKAISSTGHTIL-YTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSS-----------------------------LSH------STTVLITVL--DINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQH--FRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLD--TNSKLIYK-VLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIV---ASDSDKNKF-GRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFAT--VLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQ----YRINVEYRVDNSPLMATRTILIDLIDQNDCPPIF---DNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVS--AVDYEETKLINLVVSASDK--AGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILK-PLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIA-PFLENAPHGSVIGKIHAVDAD-SGINRKIVYRILDESKSSFSIDRDTG--IMRVASLLDRE---RQPE--HHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKA-ISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNS 11264
            + YS++  N+       F+++S  G L L    +  S +   +IV A++       ++   + I +LD N+  PEF  S                S+ SVL                          S  GT L    A+D D G N Q+VF+I   +   + F +D   G + + + L         L I  SD G P      +  V + D   + + P    + +   + E   + + I+        + L     Y +   +P    G+ FG+   TG I T+  +DRE I      +V+ D    S   L +       V + + D+NDNAP F+    +N  I          F  S G     S   + ++A+D D   NG + Y I+S     FK+ + TG+++     +  +EV      L+++  D+          + I II           P+FE+   L   +    P    +L +  H    +  I + + N       G+  R F ID   G L  +      +G     V +   A  G+  TS          T+ +V  L+K+       + P   N   DL +           P    S+ ++L+     K  +   TG L L   LDRE +   +L +     DG  Y     T+ V+D ND  P+F    Y F +  N  +  Q  ++ A D D G+N  + Y +  V  +A D+ F+++  +G++T+ +    E + + + + ++A D GQP+LS+   V+ +++  +D +P+FD   YS  V E+     + +  + K I S  + ++ Y+IT G+ +  F +D            IR    LD E +  +TL ++A D +                               L+H      S+TV +T+L  D+NDE+P+F+ ++ +A + EN+ IN  +I++  +      +  +++ +K   D     S    F +N T G + + + LD E    +   I  +  G    +  + + + I+DENDN P F    ++A+++  +S G++V+   ATD+D   N ++ Y  VL +  + F I + +G +R  +  N E+L   S  V  +    +      A +++N + I ++ P+F+ + +   V EN TV    G ++   A D+D      ++RY +  G DS++F +++ +G + L K LDRE++S + L +V  D G+     T  V + V DINDN PV E   Y  TV  +  S GT    +L   A D+D     ++ + L+   + +    +DS TG +S   +             + +  VY +     +  +   R      + S+N+T+ ++ + D        T ++  + E       V   R    +  G+ ++V  +     Q+ F+I++  G +  K  +  +T+S     Y I +         ++++  L  ++   +  P F    NS +A  +SED+  G  + +  A       K ++    Y +     G S R+D    + SV    +DYE T L  + + A+D       + T +T++V D ND  P   +   +   E+ E      E+ P+++  + A D DS      ++ L      N F   F ++ESGE+     LD E+I      ++ +     H +    +L + ++D ND+ P   ++  L + E    GS +  + + D D  A  N  +Y+  E        +EP +G + V   LDRE        V A D  + +    I I + D NDNAP F H+  +  F E     +++G+I A D D  G N  I Y  L +    FSID  TG    + A         R PE  + L + A+D GKPP  +   V I ++D +++PP+F        + +D   G+ ++ + A    D+G N E+ Y ++T    + F +    G +TL+K +    +  Y L VRA+D+G P  S  T V+I V   N + P+F    Y   +PEN  V   TI  V A D D+G N ML YS          N R         F ++ +TG I +    D +    Y   ++V D G    SS   +TI + D NDNPP F    +   I           E K  G    V + H  DKD P N+
Sbjct: 1313 VYYSLAKGNE----AGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQS---------------SSEVSVLET------------------------SPTGTELMRFRASDADQGVNSQVVFSISAGN-RRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDD--NDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEK----LVTVIVEDINDNAPVFV---SMNAAILPPK------FSTSKG----SSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEV---RYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHL--ASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTS---------RTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVS--DGVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGV--VSDWANDV-FSLNPQTGMLTLTARLDYEEV-QHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNG--------TIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETA-IMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMEN-TVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEG-DSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPS-GT---HVLTPRATDKDEGLNAKLRFNLLGEHMHR--FHIDSETGEISTATTL-----------DREETSVYHLTLMAQDSSITEPR------ASSVNLTISVSDVNDNIPKFDSTTYNV-AVPERISKGEFVFGARALDLD-DGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFA--MSEDVRPGKMITKVSATSPK---KGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQ--LIYNAEVLE-----EESPPQLIAVVKASDRDSGDNGNVIYRL-----QNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVL-LHLLDKNDNPPKFTRLFSLNVTENAEIGSFVIRVTSSDLDLGANANA-SYSFSENPGEKFR-IEPQSGNITVAGHLDREQQDEYILKVVASD-GAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYS-LQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTN-EMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGS-TILTVGATDDDTGPNGMLRYSI------SGGNERQD-------FSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYI----------PENKPVGTF--VFQAHAADKDSPKNA 3367          

HSP 2 Score: 353.599 bits (906), Expect = 1.996e-96
Identity = 506/2057 (24.60%), Postives = 886/2057 (43.07%), Query Frame = 3
Query: 5334 DQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNS-ILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDRE---------------------VVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPD--LNPTILFSILNGKESRFFSIDPTTGWLKISTN-DIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRN---------KVLPLEKSQVVWEIPENR-NDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSALDREERPFVQLLVLAK--GWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKP-FAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPA---LSS--FTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAI------SSTGHTILYTITNGNDEELFDLDFTAAYLQ--PGPCVIRLVGKLDYETKPFHTLIISATDPS-SSLSHSTTVLITVL-----DINDELPIF-LKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCS-SQHFRINGTTGTISIKENLDFEAC-MIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIH--VTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQN-SNLGLNNTK----------SKLEVYQI--------AFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIV-AMCRISSTEMKGKW--SLVPSSSPFDV-QND---FEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRT-ILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRI-DDQGWVYSVSAVDYEETKLINLVVSASD-----KAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGI-EITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRV-SESGEVLLLHPLDAEKILKPLQLKFLASDRLHWS-KEEFILNIRVIDVNDHAPVCP-QIPDLMIFEGITPGSVITTLQAYDRD----SSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALD---VESKKCSFKILINVLDINDNAPRFVHTSI-APFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHH------LVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPI-------KLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITE--QNFFRLESLSGNLTLIK-KLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQ 11135
            D+D G N ++ +++ N+      F +    G + +QR + A    L+ + ++ +D G PP  ++  ++V I D  ++   P  + +  +  + E T VN+                   Y +  I+ +T ++FGV    G +   + LDRE+ +D  ++ +  +   G  SR +S++ V IH+ D NDNAP+F         I E+A   + V       KL+         A D D G+N ++ + + S+    F ID   G +      DRE                     + G+++ L   + D G P+L  Q+++++ +I+ D ND  P+F +  Y   +         +  +   D D  LN  + +S+  G E+  F++D  TG L +    D         +V+    A      ++ +ITI   D   N         +V  LE S    E+   R +D    V  +  F  S  +          +    I+ ITGSL L   LD E+     L + A   G       +   V V D+ND  P+F S      +   +  +   + V A D D+G NG V Y+I   +P       F I++ +GVI       +E +   F + + A D+ QP+   LS+     V V+ ++D +P+F     +++ P+ +      T V  +      SS+   + Y I +G  +ELF L      +   PGP          ++ +  + L + +TD +  S   S+ V IT++          +P F  +S  S SV EN PI   I++++  L   ++++I  F   +    S     + F I+   G +S    LD EA    +E  +     G    T+R  ++V ++D+ND+PP+F+   F   +S +   G  +    A D DT   + + +++ +   F ++ S+G +  N   + E    +    E ++ V D      A  ++      ++PP F    +   + EN     ++G+IVA D+D  +  +L Y V+  + +++F L+  TG L L   LD E    + L V   D G      T+ ++  V D+NDN P+ +   Y   V  +          ++ + AKD D      ++Y + +  +      +DS  G +  + +   ++ S   L  T           S+LE  Q+         +Q   +   +++     +S ++ VT+ I  + D+  V   I+ +   I EN  +N +V A+  + + E +  +   L+  +   D+ Q+D   F ++   G +R    +D E +S Y +N+  R    P  +T + +LI ++D+ND  P+FD  +Y+  ++E+  +G+ V+Q  A D D      I YS+   D       F I +D G V     ++YE     +L V A D      AG      LTI++ D+ND  P +  +P +  + E T   +G        V  ++A D D+      + + +   + +     FR+ + SG++ LL PLD E+      L  +A D          I+ + V D+ND+ PV   Q     + E +  G+ + T +A D+D    +  ++N L   +      +   ++  TG +     LDRE +S  +  + A D    E +  S  + I+V D+NDN P+F  T+      E    G  +    A+D D G N  + Y I    +  F I+  TG+  V++ L+ + + + H      +VI A D G+   S+   + ++L      PP+    P           ++ED   GK++  + A S   G+  ++ Y +      +  R++  SG L++ +  LD+EL+  Y + + A+D   PSL + T + + V D NDN P    L Y   + E     +L I  V A D DSG N  + Y                 N  +  F I  ++GEI+     DREE   Y F V   D G+P  +   +V + + DKNDNPP+F +
Sbjct:  971 DRDAGVNSRISYSLTNNPN--QQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIAD--VNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEI--IEGNTERMFGVF-PDGYLFVRAPLDREE-RDYYALTVSCRDA-GQPSR-SSVVPVVIHVIDENDNAPQFTNS-TFTFSIPENAPADTFV------GKLT---------AVDRDIGRNAELSFTLSSQTQD-FTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRL--QDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGN---------RRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESI-DTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSG-PQELFKLQRNTGIITFTPGP---------QFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHL---ASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRE----TKSKYELRIRVSDGVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVP----IATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFG-IDS-NGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQ-KQQRLSSTVKVTILIKDVNDEVPV--FISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNH---DFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAE--LTINILDINDNRPTFLDSPYLARVMENTVPPNGG------YVLTVNAYDADTPPLNSQVRYFLKEGDSD----LFRINASSGDIALLKPLDREQ-QSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHM------HRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGV--VSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVIL-----RPPEL--FPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQL-IAVVKASDRDSGDNGNVIYRL--------------QNDFDGTFEIT-ESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTR 2915          

HSP 3 Score: 297.745 bits (761), Expect = 1.211e-79
Identity = 495/2057 (24.06%), Postives = 831/2057 (40.40%), Query Frame = 3
Query: 5499 LGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFAS-YFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLI--LPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFD-----GKF----ETSCNITINS---FDNTRNKVLPLEKSQ--------------VVWEIP-----------------------------ENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSALDREERPFVQLLVLAK--GWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKG--QPA--LSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDAL--KDFIVTTVKAISST----GHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSS-LSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSP-TNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLD--TNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFV-----MNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKK-TLDRERKSMHELRVVVSDYGNKHDFATVLI---HVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSI-----NVTVKINILYDKKKVNPIITCSI-MTIQENNPLNHIVAMCRISSTEMK-GKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKD-VIFYSLYQLDSVETGVSFRIDDQ-GWVYSVSAVDYEETKLIN-------LVVSASD--KAGHVTNTTLTISVYDVNDEIPYWTKNP-----PVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDR-LHWSKEEFILNIRVIDVNDHAP-VCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREF--SSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPFL-ENAPHGSVIGKIHAVDADSGINRKIVYRILDES--KSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNI---TNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQN--FFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSL-STTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIG-KVT---AYDSD-SGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAE 11297
            LG  PR +R+ V V + DK  + S PQ  ++     V E+  +    H +    +    T      L +    GK F +  STG +I   +LDRE        +++++  DG+  +Y    +  I ++D NDN P F                   V+     E   +  +   I A D D G+N Q+ Y ++S +A+  F ++  TG+L+L  ++D E V  ++ L ++ QD G P L +   + +   + D ND  P F+   Y   +   +P       +  +  D   N  I +SI  G     F ID + G ++   N   +  +  S   + + A D       F    ET   +   S   +  TR + L  +K Q              V  E+P                             E RN   D ++  A+     Q   + + L         N   G L++  ALDRE R    L + A+  G         + + + DEND  P+F  ++Y   V  N S  A  ++V A D+D G NG + YSI        +  F+I  ++GV+ +    + E L  ++++ ++A D     PA   +  T   +DI +D  P F  S Y   V E+ +      V TV A  +        + Y +  G D +LF ++ ++         I L+  LD E +  +TL + A D  S  L+ +  V + V DIND  P+F   SY A+V EN+P    +++     +    +  + F+L L E         F I+  TG IS    LD E   ++   ++ +      P  +  ++ + + D NDN PKF    +N  +    S+G  V  A A DLD   N+ + Y +     + F I+  +G +       ++    S   + + +++        +  S   +++   PP        M   H ++SE+      I ++ A+   K   G++RY + GG   +   +D  +G L + +  LD E   ++E+ +  +D G+     +V +   +VTD NDN PV+EQ  Y   V+          + I  + A DRD      + YRL                           QN   G        E+Y    ++  E +  Y      +   +       +V +++L DK    P  T    + + EN  +   V   R++S+++  G  +    S   +    F I+   G I     +D E Q +Y + V     +    A   I I + DQND  P F++S Y+    E     + V Q  A D+D +G + VI YSL Q   +     F ID   G V+S  AV ++ ++ +        L V A+D  K    +   + I++ D ++  P + +       P D +              + + R+ A D       E  + L+T  NL+  ++  R    G + L+ P+      +  +L   A+DR +    +E  + I V   N   P        +++ E    GS I T+ A D D +     L Y++   ++     V+  TG +++   LD +      +N  V  L          + I + D+NDN P F H     ++ EN P G+ + + HA D DS  N  I Y  L     +  F +++  G +  A   D E +  + L I+A    K P S++    N+ + +L VN+  PQF+       V+E + +G  +  ++A   D G +  V Y ++   N   FR+++ +G + + + LD E      LTV A  K Y S+    T     ++ + D      F+ + +    +T+     +G KVT   A D D    N+  +YS +               +++  F+I+ +TGEI      DREE  TY   +   D G+P  +    V IE+ED NDN P F             +G I + E      M     L   D D P N  PF  +L+  +
Sbjct: 1798 LGGQPRTSRTKVRVTVLDK--NDSPPQFLDTPFVYNVSEDLQIG---HTISTLRAHDPDTLGSVTFLLMDGHDGK-FLLEPSTGKLILNDTLDRETKS---KYELRIRVSDGV--QYTEAYAT-IQVSDTNDNPPLFE----------------DTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYI-LIVQAQDNGQPSLSTT--ITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGID-SNGTIRTRRN---LDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSL---------NPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGD---QNHDFSISEDTGVVRVAKNLNYERL-SRYSLTVRAEDCALENPAGDTAELTINILDI-NDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEG-DSDLFRINASSGD-------IALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNL-LGE-----HMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKL--ELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAAD-GDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPP----QLIAVVKASDRDSGDNGNVIYRL---------------------------QNDFDGTFEITESGEIY-TRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLL-DKNDNPPKFTRLFSLNVTENAEIGSFV--IRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKV--VASDGAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPM-----FSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVR------------GQRIVRVHANDKQDLGTNEMDYSLMTF-NLSSIFSVGR--HDGWITLVKPIQVPPNTR-YELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATD-DDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKA----KNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMA--KNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYT---STISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIIN-------------GNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGL--------NGYISENEPAGTSIM----TLIASDPDLPRNGGPFTYQLIGGK 3695          

HSP 4 Score: 290.812 bits (743), Expect = 1.813e-77
Identity = 511/2138 (23.90%), Postives = 883/2138 (41.30%), Query Frame = 3
Query: 5253 DNSLIFSFTWIDVGSSI---------GTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLF----LTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNS-ILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSR----FASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTF---------PSAPLLQLRVHDPD--LNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFD-GKFETSCNITINSFDNTRNKVLPLEKS-------QVVWEIPENRNDVPD----LVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSALDREERPFVQLLVL--------AKGWDGSYDYINVTVSVTDENDYKPMF-LSEKYEFLV----HTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDI--VSDKSPLFDKSKYSVIVPEDA---LKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSS-SLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEA-------------------CMIHEFWIL---VKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVL--NEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHD--FTHXXXXXXXXXXXXI--KNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVL--IHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLES-ILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNP----LNHIVAMCRISSTEMKGKWSLVPSSSPFDVQND------FEIDSN----YGYIRAKKIMDFETQSQYRINVEYRV-----DNSPLMATRT--ILIDLI------DQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSA-VDYE---ETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPV----DGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQ-IPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILI--NVLDINDNAPRFVHTSIAP-FLENAPHGSVIGKIHAVDADSGINRKIVYRI-LDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCG------------------KPPK------------------SNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNF---------FRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKT-NVTIEIEDKNDNPPEF 11129
            D+  I SF +   G  +         GT++ +++  D D G NG+    I + +  L +F +++   D+ + R +  + +R       LT+V  D G P R   + + +++ D  ++   P  E+S+   V+ E     S +         T +     Y +LS   +  K F +   TG I+T   LDRE I+D V + I  +  DG  +   +   +K+ I D ND AP+F    + N  + E A P ++V L               + A D D+G NG + + +       +   F +D  TG L+    +DRE +  + ++S+  +D+G+P   S     + + + D ND  P+F    Y+  L                  LL +   D D   N  I + + +G E   F +D  +G + +   D P S  +     + + A D G+  +  +  +     ++ ++L   ++       Q+V +  + RN  P+    +V  ++    ++ H     I         I+  +G +     LDREE+   +L +L        A     SY    V +++ D ND  P+F L  + E  +    +  + +E    RV+  D DAG N  + YS+    P   + +F I   +GV+ +Q  P +   G    + + A D G P LSS   + V I  V+D +P+FD + Y   +PE      + F +            I Y I  GN E +F + F   YL      +R    LD E + ++ L +S  D    S S    V+I V+D ND  P F  S+++ S+ EN P +  +  ++ + + +  +  + F+L          +Q F I+   G I      D EA                    M   + +L   V  +G     ++  ++V + D NDN P+F++  ++ TIS  +S+G+ +      D D   N  + Y +   NE    F +D ++G +   +  + E    S  +    V+  D    H + +N S+  V +   ++ P F  +   +SV E     +E+ R  ASD+D+    ++ + +  G   + F +DS+TG+L L K LD E  + + L +  SD G      TVL  + V D NDN P+     +  T I+     G  L++ I+ + A D D     ++ Y                   A+S +   + Q  + G+N   ++  V     ++  E + ++R+  TV++       +  +  +K     ++T  +  I +N P    +N  +   + S++  KG  + V      D  +       +EI S     +   R   I+ F    Q++  V Y++     D +     R+  + I +I       ++  P     S+ +  + E+ P+G+ ++   A+    E +  +          +    F ID +  + S +A +D E   E   + +   A       + T + ++V D ND  P +   P V    + ++I  T           +  L A D D+     S+ FL+ + +   F        +G+++L   LD E   K  +L+   SD + ++  E    I+V D ND+ P+    +    I E    G  +  + A D D   +   L+Y ++      +  + P TG + + A LD E       +V A D      S  I +  NVLD+NDNAP F   S +    EN P  + +  + A D DSG N  I Y I   +  S F ID + G +R    LDRE +  + L + A DC                   + P+                  S+   V I++ DVND  P FI+   +  + E+  I  V+I +KA+ +D G N  + Y M   ++          F L    G L ++  LD EL   Y L + A D+G P  ST + ++I+++D NDN P F    Y  ++ EN  +  + + +V+A D D G N  + YS +             L    H F I+  TG + +    + E    Y   V   D  +   +  T  +TI I D NDN P F
Sbjct:  377 DHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGN-ELGHFRLEE-AADLHIVR-VNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVND--VNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILS--GNELKWFSMDPLTGLIVTTGPLDRE-IRDTVELSISAR--DGGPNPKFAYTQLKVIILDENDEAPQF-SQREQNVTLGEDAPPQTIVAL---------------MTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQY-EISVIARDQGAPTPQSAT-ATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEG-LFQLDARSGAISLR-GDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVR--DRDAGVNSRISYSLTN-NP---NQQFRIGPVTGVLYLQR-PIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGV-FPDGYL-----FVR--APLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLS-------SQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQ-FNLDSATGQLSLGRRLDRE----SQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPI-----FPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSY-------------------AISKQEPQLPQGRHFGIN---TETGVIHTLREIDRESIDTFRL--TVVATDRAQPSERQLSTEK-----LVTVIVEDINDNAPVFVSMNAAILPPKFSTS--KGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHT-----------ISTLRAHDPDTLG---SVTFLLMDGHDGKF---LLEPSTGKLILNDTLDRETKSK-YELRIRVSDGVQYT--EAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDAD-LGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSN-GTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISAN-ETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVL-QVSATDVDEGANGRIRYSIV-------------LGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTF 2384          

HSP 5 Score: 288.5 bits (737), Expect = 9.361e-77
Identity = 424/1694 (25.03%), Postives = 729/1694 (43.03%), Query Frame = 3
Query: 5844 RYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFAS--------YFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPD--LNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFET----SCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKF------YFSHQHP---SIKYILLSEQPKV-EINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYIN---VTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKG--QPALSSFT-DVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS---STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSA-SVSENMPINHEIISISVLLQKVSNSKIVEFSLK--LIEDSSPCSSQHFRINGTTGTISI-KENLDFEACMIHEFWILVKYDGRFSPTNRA--HMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRD-VSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCS--IMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRT-ILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKAGHVTNTT--LTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESL------------HFLITNQNLNPFYAYFRVSESGEVLLLHPLD-AEKILKPLQLKFLASDRLHWSKEEFI-LNIRVIDVNDHAPVCPQ-IPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCS----FKILINVLDINDNAPRFV-HTSIAPFLENAPHGSVIGKIHAVDADSGI-NRKIVYRILDES-KSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAE-VSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYP 10706
            R +S + V I I DVND  P F+           SAN  +++      E ++ +   + + A D DEG+NG I+Y++               F ++   G L +   +DRE+  S++ L+I  +D+G P   ++ +L I I+  DEND  P F+   Y   +       A +LQ+   D D   N  I +SI+ G ++  FSI   TG ++++ N   ++ +  S   + +RA D   E     +  +TIN  D   N+   L+ S  +  + EN       V P   +      Y +   P    ++Y L      +  IN  +G + L   LDRE++    L ++A    GS        V V V D ND  P+F  + Y   V  NL      +  +A D D G N  + +++       +  +F IDS +G I+  +   +E     + + + A D    +P  SS    + V  V+D  P FD + Y+V VPE   K   V   +A+         + YTI+ G D+  FD++     +      + L  K        +T++ISA D       S   L  +L   +  P F   + S  ++SE++     I  +S    K      + +++   ++ DS        R++  +G +S+ ++ LD+E   ++E WI    DG  +P+ R+   + +++ D NDN P   Q  +NA +  E S   L+ +  A+D D+  N  +IY++ N++   F+I +S G I      + E++   + VVE   +     H       +  +  KN  P      F ++V+EN  + S + R+ +SD D        Y        E F ++  +G + +   LDRE++  + L+VV SD G       + I + D NDN P  E ++Y      S      ++  + Q+ A DRD   P   + Y L  P    SI   D  TG V  K +   ++S   + + ++   +  +A    + PLYS         C +N    INI+ D     P    +  +  + ++      +     +  +  G   +  S   F++ + F +  + G+I   K +     ++Y + V       P  +  T ++I +  +N   P F  + Y + + E+ P+GS ++   A D D     ++ YS+   +  +    F +D++ G +     +DY+  +  +L ++  D   H  ++   LTI + DVND       NPPV      E      E  P   +   A   D +S K ++            HF I NQ+            +G +      D  E+ +  LQ+K    D    S E +  L + V+ VN+  P   Q +    + E    G+ +  +QA D+DS  +   + Y L+  S+     ++  TG + V   LDRE  + V   V A +  S + +     +++I++ D ND  P F+ H   +   E AP G+ +  + A+D D    N +  Y I++ + K SF ID  TG +  AS LDRE    ++LVI A D G PP++    V I L DVND+ P F    +   ++E+   G  ++T+ A   D+  N    +YQ+I    +++  ++  SG +      D E++      +   D G P
Sbjct: 2146 RLSSTVKVTILIKDVNDEVPVFI-----------SANETAIM------ENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYL-LNITARDRGEPPQSTESQLLIRIL--DENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKN---LNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLD-SPYLARVMEN------TVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDT-GSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLL----GEHMHRFHIDSETGEISTATTLDREET-SVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTIS-GRDQHYFDINTKTGVVS---TKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDS-------LRVDPNSGLLSVGQDGLDYELTHLYEIWIEAA-DGD-TPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITES-GEIYTRMRLDREEIGDYAFVVE--AVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYS-FSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASD-GAWRAETPITITIQDQNDNAPEFEHSFYS----FSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSI---DPATGEVFSKKAVRFKHSQY-VRSPENMYALTVLATDNGKPPLYS--------ECLVN----INIV-DAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQ---DFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVND-------NPPV--FNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQS------------NGTISSAVSFDYEERRIYTLQIKAKNPDS---SMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDS-GEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKP 3735          

HSP 6 Score: 288.115 bits (736), Expect = 1.098e-76
Identity = 456/1911 (23.86%), Postives = 787/1911 (41.18%), Query Frame = 3
Query: 5760 TVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKID---REVVGSFVD-----LSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPL-------LQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTN---DIPVSGKFPSVVLINIRAFDGKFETS-CNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLS--EQPKVEINEITGSLKLKSALDREERPFVQLLVLAK--GWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFT-DVFVDI--VSDKSPLFDKSKY---------SVIVPEDALKDFIVTTVKAI---SSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEII-------SISVLLQKVSNSKI-VEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPT------NRAHMQVHIVDENDNPPKF-IQPAFNATISL--ESSQGSLVVIAMATDLDT--NSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXI---KNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYG--NKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAF-VDSITGAV-SLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVT-VKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVP-----------------SSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYR--VDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDD-QGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFP--RVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRV-SESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEF----ILNIRVIDVNDHAPVCPQIPDLMIFE--GITPGSVITTLQAYDRDSSAKYNTL-TYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNF--VVHALD--VESKKCSFKILINVLDINDNA-----PRFVHTS--IAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSS----FSIDRDTGIMRVASLLDRERQPEHHLV-IEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASD-----KGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSF 11144
            T  +LDRE      S  + + + DG        + V + I DVNDN P F      N  ++E+A PG+ V               + + A D D G N +I Y  L+     F ++  TGV+S   +++   +  V S         ++  +D GSP+     R  + + + D ND  P     F+     + T     +       + ++  D  LN      I++G E   F ++       +  N   D    GK+   V+   +    +  T+   I +N  ++        E S V+ E+    + V  +         + Q   + Y +LS  E     ++ +TG +     LDRE R  V+L + A+  G +  + Y  + V + DEND  P F   +    +  +   +     + A D D G NG+V +++       Y L+FA+D+ +G +T +    +E +  ++ I + A D+G P   S T  V++++  V+D  P F    Y          + + ++  K+ I+  V A          I Y + +G  E LF LD      + G   +R         KP + L++SA D     S    ++  VL    E+ +    + +      M  +HE          + ++  K +N K        +I+      +Q+FRI+  +G I+    LD E    +   IL       S         +  + + I+D NDN P F +      TISL   ++ G  + ++   D D   NS++ Y + N     F+I   +G +   +    E   P S ++  +++  D     +++     V I    +H P F    +  S+ E   VN+    + A+D D    GR+ Y +I G    +FG+    G L ++  LDRE +  + L V   D G  ++     V+IHV D NDN P     +   T   S          + +L A DRD+     + + L     SQ+  F +D+  G + +L+P            + ++ ++V + A    E+      +A   +     V+   I  L DK KV  I+T     + +N P   + A   ++ +E   + + +                  S +  +    F +DS  G +   + +D E+Q  + + V  +      PL +  +I I ++D+ND  P F  S   + + E  P G+++++ +A D D      + +S+   +  +T   F ID   G +Y    +DYE+     L ++ASD      +TT+  +V  V+D       NPP+     T       E  P    +  ++A D DS    +  + +   +   P   +F + +E+G +  L  +D E I    +L  +A+DR   S+ +     ++ + V D+ND+APV   +   ++      + GS    +Q + +D+ +  N L TY ++  S P  L        +I   P   +F   V +   + + D  V+S++ S ++ I ++           P+F   S       EN P G+ I  + A  A + I   +       S+      F ID   GI+  A+ LDRE  PE + V + A   G  P+++ T V++ +LD NDSPPQF++ P    V+ED +IG  + T++A   D  + +     M      F LE  +G L L   LD E   +Y L +R SD     + Y ++  +       +  +          Y F+IPEN       +G++ A D+D G N+ L+Y  +       W N          F +NP+TG + L    D EE   Y   V   D+G P+ S+   V   + D NDN P F   S+
Sbjct:  224 TTGNLDRESRG---SYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIF-DHSDYNVSLNETALPGTPV---------------VTVMASDNDLGDNSKITY-YLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPR--QDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQ---VHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKM-SQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGG-EGLFQLD-----ARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEM-LECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGD---RAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVLYLQRPIRAE---PGS-LIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFP-DGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAP----QFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLS----SQTQDFTIDTRNGFIKTLRPF-----------DREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVT----DVNDNAP-EFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDT---FHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDD-----NDNPPI--FPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESI-DTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIV--SGPQELFKLQRNTGIITFTP-GPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT-LGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYATIQVSDTNDNPPLFEDTV--------YSFDIPENAQ-RGYQVGQIVARDADLGQNAQLSYGVV-----SDWAN--------DVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSY 2032          

HSP 7 Score: 271.937 bits (694), Expect = 9.874e-72
Identity = 411/1632 (25.18%), Postives = 673/1632 (41.24%), Query Frame = 3
Query: 6657 RAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSALDREE-RPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGK-------KFTIGIKANDKGQPALSSFTDVFVDI--VSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISST-GHTILYTITNGNDEELFDLDFTAAYLQPGP---CVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPI-----FLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKEN--LDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVL--NEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXI---KNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEI---FGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGN---KHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLES-----ILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLK---PSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINV-------EYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYA---IFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDD-QGWVYSVSAVDYEETKLINLVVSASDKA--GHVTNTTLTISVYDVNDEIP------YWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFI-LNIRVIDVNDHAP-VCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTL--------MECSDPYLLVVEPLTGRVIVNAPLDREFSS---------TVNFVVHALDVESK-----KCSFKILINVLDINDNAPRFV----HTSIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSS-FSIDRDTGIMRVASLLDRERQPEHHLVIEASDCG-KPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPA---FSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNS 11264
            + KF +    P  ++ L         + +TG +K    LDRE  R    L+VL+     +Y  I V + V D ND  P F           + +   + +   A D D GENG  +   Y +     D KF + + +      S    E  G         + + I A D G P    +  V V I  V+D  P+FD S Y+V + E AL    V TV A  +  G     T      E  F ++     +       C  +   K     K     + +    S      T V + +LD ND  PI     F      A+V EN  +N  +++ +V ++   +      S++++   S     HFR+        ++ N  LD E    +   ++    G  + T  AH+ + + D ND+ P F +  ++A +S  +  GS V    ATD DT  N+++ Y +L  NE    F +D  +G I      + E        VE  +   D   +     +   V I    +  P F   E ++++ E+    + +  + A+D D+   G + + +    +      F LD+LTG L  ++ LDRE+ S +E+ V+  D G    +   ATV ++V D+NDN P     +Y  ++           E      +L + A D+D      ++YRL S    + +  +D+ +GA+SL+   P+ ++   +  L  +       +       E +   ++       +     +  ++ D ++            Q N+  N  V + ++ ST  K    +       D   +F ID+  G I   + +D E Q+ YR+ +            +S       + I +ID ND  P+F   R +   I + E+  +G ++   +  D+D      I YSL    + +    FRI    G +Y    +  E   LI++ + A+D       +  +L++ + DVND  P      Y T  P        ET    +  F      +   DN        + + I   N    +  F     G + +  PLD E+      L     D    S+   + + I VID ND+AP          I E     + +  L A DRD   +   L++TL        ++  + ++  + P     +V    + E S            N+++    V        +   K+ + V D+NDNAP F+    H +I+   E A  G+ I  +   DAD G+N  + Y +   +++  F++D  TG + +   LDRE Q  HHL++ A D   K P S+  ++ IV+LD ND+ P+F     ++ V E +  G  L+  +A   D GVN++V + +     ++ F ++S++G+L L K LD+E    Y L + ASD G PSLSTT    + VVD NDN P FP    V  I E   + K  I  VTA D DSGLN  ++Y+     P+        L    H F IN +TG I      DRE   T++  V  TD   P+    S++  VT+ +ED NDN P F   +         + I+P +     G    V ++H KD D  +N 
Sbjct:   89 KPKFSYRFNEPPREFTL---------DPVTGEVKTNVVLDREGMRDHYDLVVLSS--QPTYP-IEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENG--VTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENA-VNGTVVA-AVAVKDSDSGLNGRTSVRIV---SGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNEL-KWFSMDPLTGLIVTTGPLDREI----RDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESG--GEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQ------------QRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQ----FRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLP--------ETTKVNTRFFALAATDIDLGDNG------RISYEIIEGNTERMFGVF---PDGYLFVRAPLDREE-RDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRD-IGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTIS---EGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPL-KTPIVTVTADDPDSGLNGKVSYAISKQEPQ--------LPQGRH-FGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMN---------AAILPPKFSTSKGSSTAVMQVHAKDADSSSNG 1637          

HSP 8 Score: 266.929 bits (681), Expect = 2.910e-70
Identity = 486/2057 (23.63%), Postives = 834/2057 (40.54%), Query Frame = 3
Query: 5304 GTLLTSISATDQDYGRNG---QLVFAIKNDSVALNYFEMDQNNGD-----IRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNS-ILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQ------VQSYDGLVSRYNSIISVKIHIADVNDNAP----RFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFA-SYFKIDQYTG--VLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVL--ILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRN------DVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVE--------INEITGSLKLKSALDREERPFVQLLVLAKGWDG---SYDYINVTVSVTDENDYKPMFLSEKYEFLVHT-----NLSKEAQSIR----VKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQS-GPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPL-------FDKSKYSVIVPEDAL--------KDFIVTTVKAISSTGHT-ILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLII-------SATDPSSSLSHSTTVLITVLDINDELPIFL---KSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLD--TNSKLIYKVL----NEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXI---KNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRE------------------RKSMHE----LRVVVSDYG--NKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAF-VDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIIT--CSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILID--LIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLY-QLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGH-----VTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKE---EFILNIRVIDVNDHAPVCPQIPDL-----MIFEGITPGSVITTLQAYDRDSSAKY--NTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSS---TVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPFLENAPH----GSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITE--QNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTD 11051
            GT L   +ATD D G NG   Q      N             +GD     +    +L         L I   D G PPR     V V I D  ++ + P  + S  ++ ++E     + ++  +   +     +   Y +      T   F V   TG I T   ++  Q  ++ S   Q      V + D    R +    V +++ D ND+ P    RF         + E+A  G++V                 +  +D D G NG+    I+S     +F++++     ++ +   +DRE +G + +L++   D+G+P   +   L  +I + D ND  P FEK  Y  VL  + PT      +     D  +N  + + IL+G E ++FS+DP TG + ++T   P+  +    V ++I A DG            F  T+ KV+ L+++    +  +         D P   +        H   +   +  +  P VE        ++ +TG L  +  LDRE+    ++ V+A+             V ++V D ND  P F    Y + +        L KE +  R    V A D D G+N  + Y +        +  F +D+ SG I+++   P+       + + + A D GQ    S  D  V+IV  KS L            Y   + ED          ++  +  VK+ +   ++ I Y I  G+  + F +D  +         I     LD E +  + L I       S+   SS       V I ++D+ND  P+F    +S  + S+ EN  +  EI    V  +    +  + +SL     ++P  +Q FRI   TG + ++  +  E   +    ++    G    +++  + V I D ND+ P F   ++  ++   +   +      ATD+D   N ++ Y+++       + +F      G++ F + P   +           V   D      ++V    + +    ++ P F  + F  S+ EN   ++ +G++ A D D  +   L + +     ++ F +D+  G +   +  DRE                  R SM      L   VSD G     D   V + VTD+NDN P   +A Y VT I    S GT    I  +  +D D      + Y L     +++  F +DS TG +S           LG    +   E++ +   V ++    + +++       N ++ I +L D+    P  T   S +++ E +P    +   R S  +      +V S S  + ++ F IDS  G +   K +D+E  + Y +N+      +P ++T T+L +  ++D ND PPIF ++     I E IPL + ++   A D D      + Y++  Q   +  G  F I+ + G ++++  +D E      L V A+D+A        T   +T+ V D+ND  P +             T  G S      V ++ AKD DS S       L+T + ++     F++  +  ++   P    K     QL   ++D    S+    E  + I            PQ          ++E    G+ I T+ A+   +  +Y    +T T        L  ++   G +   A LDRE       V     AL  + +    K+ + VLD ND+ P+F+ T   PF+ N       G  I  + A D D+     + + ++D     F ++  TG + +   LDRE + ++ L I  SD  +  ++  T   I + D ND+PP F +      + E+ + G  +  I A   D+G NA++SY ++++   + F L   +G LTL  +LD+E  + Y L V+A D G PSLSTT  V   V+D+NDN P F  + Y   + EN  ++   +  V+A D DSG N ++ YS              T   ++  F I+   G I      DRE + TY   V+  D
Sbjct:  172 GTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILD--VNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLA----ETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVV---------------AAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKY-NLTVVAMDQGTPARTTTAHL--IIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLI-VTTG--PLDREIRDTVELSISARDGGPNP-------KFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLES----GGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQ--RRSQQDAIVEIVL-KSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGR-------ITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLT----NNP--NQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFP----DGYL-FVRAPLDRE---ERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTL--SSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVT-ISEGASEGT---HITHVFTQDADEGLNGDVYYSLAKG--NEAGQFNLDSATGQLS-----------LGRRLDRESQEIHHLIV-VAKDAALKHPLSS-------NASITIVVL-DENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLST-TVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSST----AVMQVHAKDADSSSNG-----LVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDT---PFVYNVSEDLQIGHTISTLRAHDPDT--LGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYAT---IQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVV-TVSAKDIDSGNNGLIEYSI-------------TAGDVDSEFGID-SNGTIRTRRNLDREHRSTYTLTVTARD 2105          

HSP 9 Score: 208.764 bits (530), Expect = 1.152e-52
Identity = 494/2301 (21.47%), Postives = 887/2301 (38.55%), Query Frame = 3
Query: 2724 PRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKDIQYRLVNFR---------RVFKIHSRTGWLRLRVNLDREKR-DYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSD--KEPQSFVYTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKST---------CA--FTDFYDLK--VMISDSGVPEQXXXXXXXXXXXXXXXXAPSFI---------NDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSENDKSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQI--DDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRATYMK----LQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLG-QPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLD-REQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSR-FASYFKIDQYTGVLSLAL-KIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDL--NPTILFSILNGKESRFFSIDPTTGWLKISTN----------------DIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDY-INVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSI----RVKAIDLD-AGENGTVIYSIYYVKPFAYDLKFAIDSNSGVI----TIQSGPSKELLGKK--FTIGIKANDKGQPALSSFTDVFVDIVS--DKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTG---HTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPS-SSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVL--NEYYNIFKIDQSSGFI----------RFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDY----GNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDV-SPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSI-----NVTVKINILYDKKKVNPIITCSIMT--IQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQ-------NDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTIL-IDLIDQNDCPPIFDNSRYAI-FISEDIPLGSKVIQCKAYDKDYEG 9278
            P+F    ++  ++ EN  I   I+ + A  A S +I+Y + N           R+F I ++ G L     LDRE   + Y + + A  +    +  T+   + + V D ND+ P F    +   + EDL IG  +  L A D D      + + +   H   F  + STG + L   L   T+ +    ++ +   Q   + A  Q+     +P    P  ++ + +  I EN   G  V  I    +D  +  Q     +S  +N +  F +N + G +   + +D E+ + Y L +  +D     ++  +  VY  V D NDN P+ +   Y + V EN+     ++TV A D D      ++Y I +GD    F    +     + R++DRE  +ST         CA  F  F +L+   +      P +                  S +         ND V VF     T ++    +    I +  V   D D   N  + Y M+  R  ++  S    FS++   G L         D          ++ +N+ A D G P   T S  ++ IR+ L EN   P  +    K Y       S ++  +  IG+ +L +   D  +     +   I   D +  FS+         +       L   SL  + E   LE    +T       +TI I   N N PTF      P    + ++T PP   Y++       + P                L   + Y +   +       LF IN+++GD+ L+ P +      + + + A +  +  +     +++ + D N+  P F     +   Y  T+R    S                                  GT + +  ATD+D G N +L F +  +   ++ F +D   G+I    +L      +  LT++  D     PR +   + + + D  ++ ++P+ + +  ++ V E  S    +   +            +  +S +      F +   TG + T   L  + +  D ++  I + + D      +S   + + I    +  P F      +  +SE   PG ++                 ++A  P +G  G+I Y I         ++D  +G+LS+    +D E+     ++ I   D  +P L S     I + + D ND  P  E+  Y   ++    P   +  ++  D D   N  +++ + N  +  F   +    + ++  +                 +P      SV+L  +   D   + +   ++N  +N       +  +    ++  N N         A + FS ++P  K+          I   +G++ +   LDRE++    L V+A   DG++     +T+++ D+ND  P F    Y F    +  +  QSI    ++ A D D  G N  + YS+    P      F+ID  +G +     ++   S+ +   +  + + + A D G+P L S   V ++IV   +  P F++++Y   +P+DA++   +  V A        + + Y++   N   +F +     +       I LV  +       + L++ ATD      S  T V+I V   N + P F  +SY   V EN P+   I+++         + ++ +S+     S     Q F ++  TG I I++ LD++    +   I V+  G    ++ A + + + D NDNPP F    ++  I      G+ V  A A D D+  N+ + Y  L      + F ++QS+G I          R      I+   P S +  +  L   + H          + +    P F+   FH  VSE   V + +G + A+D D  + GR+ Y ++G  + + F +D+ TG + + + LDRE ++   L V+  +Y    GN  D A V+I + D ND    I+  +Y  + I      GT + ++    A D+DV +  ++  Y +++  L QS   +D  TG +S                T S+L+          E   +Y +    I   +     + TV I  L D     P  T   +   I EN P    + M  I+S        L  +  PF  Q       +   +D N G +R+    D E        +E      P   ++ +L I ++DQND P    +   A+   + D+P   K+   +  D D  G
Sbjct: 1711 PQFEQRSKLSGSVYENEPIGTSILTVTAHLA-SAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYA--IALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT--LGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYATIQVSDTNDNP----PLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDV--FSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTIT-VYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEF-GIDSNGTIRTRRNLDRE-HRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINTVVIAVKAV---DNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRV---VDALDRELRS-----SYLLNITARDRGEPPQSTES--QLLIRI-LDENDNSPVFD---PKQY-------SASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTA-----ELTINILDINDNRPTF---LDSPYLARVMENTVPPNGGYVLTVNAYDADTPP---------------LNSQVRYFLKEGD-----SDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVF-----ELQSYHATVRENLPS----------------------------------GTHVLTPRATDKDEGLNAKLRFNLLGEH--MHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSD--VNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQ--HYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAYMANSHFAMSEDVRPGKMI---------------TKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELT-HLYEIWIEAADGDTPSLRSVTL--ITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEIGSFVIRVTSSDLDLGANAN---------ASYSFS-ENPGEKF---------RIEPQSGNITVAGHLDREQQDEYILKVVAS--DGAWRAETPITITIQDQNDNAPEFEHSFYSF----SFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPM-----FSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGW-------ITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSI-----SGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANL---YVH---------VLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIK--HYYTSTISEAAPVGTKVTTV---KAIDKDVRTQNNQFSYSIINGNLKQSFK-IDVQTGEIS----------------TASRLD---------REETSTYNLVIGAIDTGLPPQTGSATVHIE-LEDVNDNGPTFTPEGLNGYISENEPAGTSI-MTLIASDP-----DLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTRSLHIAVSLFNGDLPSNVKLADVRPNDIDIVG 3789          

HSP 10 Score: 207.223 bits (526), Expect = 2.706e-52
Identity = 359/1456 (24.66%), Postives = 589/1456 (40.45%), Query Frame = 3
Query: 7467 SSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKI----------VEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVH--IVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATD--LDTNSKLIYKVLNEYYNIFKIDQSSGFI----RFN--QVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXI---KNHPPSFVMNEFH-----MSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLK--KTLDRERKSMHELRVVVSDYGN--KHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITC--SIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSP-----FDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPL--MATRTILIDLIDQNDCPPIFDNSRY---------AIFISEDIPLGSKVIQCKAYDKDYEGKDVIFY-------SLYQLDSVETGVSFRIDDQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKES--LHFLITNQNLNPFYAY----------FRV-SESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKE-------EFILNIRVIDVNDHAPVCP----QIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDV--ESKKCSFKILINVLDINDNAPRFVHTSIAPFL-ENAPHGSVIGKIHAVDADSGINRKIVYRILD-ESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFE----LSRE------------------YFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIP-AFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDEC-ILLVAGSLYL---------GVRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPP 11480
            SS  ++   V I VLD+ND  P F + S + S SE+      ++  +     V  + +          V+   +L+  ++P     +    TTG      NLD E+   ++  I  +  G  SP    ++QV+  I+D NDNPP F    +N +++  +  G+ VV  MA+D  L  NSK+ Y  L E  + F ++  +G I    R N  Q  N++        V F V   D         +   V++    +H P      F       +V EN    + +  +   DSD    GR    ++ G +   F L+      +++    LDRE    + L VV  D G   +   A ++I V D+ND+ PV E++ Y   V+     TG+ + SI    A D D     ++ Y ++S    +  + +D +TG +        +         +  +E+   A      P ++Y              +K+ I+ D+    P  +     +T+ E+ P   IVA+   +  +     S+  + +P     + +Q  F +D+  G +  ++ +D E  SQY I+V  R   +P    AT T+ +++ D ND  P F    Y          I + +++     ++   A DKD     +I Y        L+QLD+    +S R D        +           L+VSA D AG         S  D   EI   +K      +E+ E     +  +   +     +  +S+  +E   +    TN   N    Y          FR+ + SG +    PLD E+     +L  LAS     S         + I+NI +ID+ND+APV        P + + E    G  I   +  DRD+    + ++Y+L    +    +  P+TG + +  P+  E  S ++  + A D           + + + D+ND+ P F HTS    L E     +    + A D D G N +I Y I++  ++  F +  D G + V + LDRE +  + L +   D G+P +S++  V I ++D ND+ PQF N      + E+      +  + A+  DIG NAE+S+ + ++   F +++ +G +  ++  D E    +SR                     L    SD G P L     V + V DVNDN P+F   PY   I E        I  V   D+D GLN  + YS        K N     N       ++  TG++ L    DRE Q  +   V   D  +    SS  ++TI + D+NDN PEF Q S    +            L+ +    E+ R    D D          + +N++ V  F +      D   I  + GSLYL            TL +  +D G PSL   V   V V+  ++ PP
Sbjct:  133 SSQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTG------NLDRESRGSYQLNISARDGG--SPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITY-YLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCV-FTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSA-VLSELAPTGSFVASIT---ATDEDTGVNAQVHYDILSGNELKWFS-MDPLTGLIVTTGPLDRE--------IRDTVELSISARDGGPNPKFAY------------TQLKV-IILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQ--FALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGD--------APASMHWKPHYKLLVSARD-AGQRR------SQQDAIVEIVLKSK------LEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQAN-YRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVN-SRISYSLTNNPNQQFRI-GPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPD-GYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGA-SEGTHITHVFTQDADEGLNGDVYYSL------AKGNEAGQFN-------LDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSV------------LETSPTGTELMRFRASDAD----------QGVNSQVV--FSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPP 1487          

HSP 11 Score: 170.244 bits (430), Expect = 4.275e-41
Identity = 298/1202 (24.79%), Postives = 502/1202 (41.76%), Query Frame = 3
Query: 8154 IKNHPPSFVMN---EFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIH--VTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPL-----------YSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMT--IQENNPLNHIVAMCRISSTEM--KGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPL---MATRTILID--------------------LIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSA-VDYEETKLINLVVSASDKA-GH--VTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFIL-NIRVIDVNDHAPVCPQIPDL-MIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYL-----LVVEPLTGRVIVNAPLDREFSSTVNFVVHALDV---ESKKCSFKILINVL--DINDNAPRFV--HTSIAP--FLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLL-----DVNDSPPQF-INIPIKLRVAEDTEIGKVLITIKA--ISDDI-----GVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELS-REYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDEC--ILLVAGSLYLGVR--TLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYF 11516
            + ++ P F ++   E  +S+ EN  V  EI      D D     R+ Y +    + + F +  +TG L L++ +  E  S+  + ++ +D G+    + + +   + D+ND+ PV +   YE ++  +TK           L A D D+    R+ Y ++                                  NT+    V+   +     PL            S R A      S+ V V I+++ D+    P  T S  T  I EN P +  V        ++    + S   SS       DF ID+  G+I+  +  D E   +   N E   ++  L   MA   +L++                    + D ND  P F  + Y + ISE    G+ +      D D      ++YSL + +  E G  F +D      S+   +D E  ++ +L+V A D A  H   +N ++TI V D ND  P +T++     + + ET    +E     + R  A D D     + +  +      + F+     S +G + L  PLD E I     L   ASD    S    +L N+ V+D ND+ P+ P    +  I EGI   + I T+ A D DS      ++Y + +  +P L       +   TG +     +DRE   T    V A D      ++ S + L+ V+  DINDNAP FV  + +I P  F  +    + + ++HA DADS  N  + Y I+   +  F + R+TGI+        +++  + L ++++D     +   + V I ++         S PQF     +   V E+  IG  ++T+ A   S +I      V A  S   +     F +++  G L+   +LD E    EY + V A   G    ++ T V + V+D ND+ PQF   P+V+N+ E+  +   TI  + A+D D+    + + +FL             ++  +  F + P TG++ LN   DRE +  Y+ ++ V+D G+    ++   TI++ D NDNPP F    + F         IP+   +     ++VG++  +D D   N+       L+   VS +      L  +   + L A   Y  V+   L VQ  DNGQPSL   + V  NV+ L++  P  +P++ +   F
Sbjct:  935 LNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQ-FRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVN----TRFFALAATDIDLGDNGRISYEIIE--------------------------------GNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSV-VPVVIHVI-DENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQ----TQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGN--EAG-QFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSS--SEVSVLETSPTGTE-----LMRFRASDADQGVNSQVVFSISAGNRRDTFHID---SITGSLYLHKPLDYEDITS-YTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLN-GKVSYAISK-QEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQV--DRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGH-TISTLRAHDPDT----LGSVTFLL------------MDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSD-GVQY--TEAYATIQVSDTNDNPPLFEDTVYSF--------DIPENAQRG----YQVGQIVARDADLGQNAQ------LSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVF 2037          

HSP 12 Score: 169.859 bits (429), Expect = 6.497e-41
Identity = 234/940 (24.89%), Postives = 406/940 (43.19%), Query Frame = 3
Query: 9009 NDFEIDSNYGYIR-AKKIMDFETQSQYRINVEYRVDNSPLMATRTIL-IDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSAVDYEETKLINLVVSASDKA-GHVTNT-TLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVS-ESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQ------IPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVN-----FVVHALDVESKK----CSFKILINVLDINDNAPRFVHTS-IAPFLENAPHGSVIGKIHAVD-ADSGINRKIVYRILDESKSS-FSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMI--TEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTD------------ELTDECILLVAGSLYLGVRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETI-----IGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLD 11702
            +   +D N G +   +  +D+E    Y I +E    ++P + + T++ +++ D ND  P+ +   Y   + E+      +   KA D+D      + Y L      +   +F I + G +Y+   +D EE      VV A D+   H+T T ++ + + D ND  P +T+   +  + +TE  +  S      V R+++ D D  +   + +    N         FR+  +SG + +   LD E+  + + LK +ASD   W + E  + I + D ND+AP           P+L     +  G +I T    DRD     + ++Y+L + S   +  ++P TG V     +  + S  V      + +  L  ++ K        + IN++D ++N P+F     +AP  ++A  G  I ++HA D  D G N ++ Y ++  + SS FS+ R  G + +   +       + LV+ A+D G PP+S+ T V IV+   N   P+F     ++ V E+  +G  ++T+ A  DD G N  + Y +    E+  F ++  +G + + ++LD++L +EY L +   D GY  LS+   + I + DVNDN P F    Y   IPEN  V      +  A D DS  N+++ Y+FL   P++            HFF +N   G I      D EE+  Y  Q+   +    +  S  N+ + +   N+  P+F QP F F +           E    G    VG +   DKD   +   +   L+ +     F + T+            E  +  +L V    Y  +R      TD  Q          +  I+  N PPE         ++++ TI     +G ++   + + +D     +  ++  + N  LK       FKID  TG I+T   LD
Sbjct: 2750 DSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQN----DFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTR---LFSLNVTENAEIGS-----FVIRVTSSDLDLGANANASYSFSENPG-----EKFRIEPQSGNITVAGHLDREQQDEYI-LKVVASDGA-W-RAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALV-GQIIAT----DRDKQGPNSVISYSLQQPSP--MFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTN-EMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVF-QAHAADKDSPKNAIIHYAFLPSGPDR------------HFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPD-SSMESYANLYVHVLGVNEFYPQFLQPVFHFDV----------SETSAVGT--RVGAVQATDKDSGEDGRVYYL-LVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRG---NDTDEAQ---------VIISIQDGNDPPEF------IKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSII-NGNLKQS-----FKIDVQTGEISTASRLD 3610          

HSP 13 Score: 166.392 bits (420), Expect = 5.922e-40
Identity = 326/1437 (22.69%), Postives = 587/1437 (40.85%), Query Frame = 3
Query: 5304 GTLLTSISATDQDYGR-NGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLS----IRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDF-YLQ----VLILPTFPSAPLLQLRVHDP--DLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDG---KFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSE-QPKVEINEITGSLKLKSALDREERPFVQLLVLA--KGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPE----DALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVL-ITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVL--NEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXX---XXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVI-GGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHD-FATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAF-VDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGK-----WSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNS--PLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASD--KAGHVTNTTLTISVYDVND 9485
            G  + +++A D D    N Q+ + +K     L  F ++ ++GDI + + L   +     LT+V  D G PP     +V VE++D  ++ + P  E       V EN  + S  H L  R++ K       +  ++       F +   TG I T ++LDRE+   +  + +  Q       R +S +++ I ++DVNDN P+F      N  + E  + G  VF            +AL     D D+G+N  + Y I  R   YF I+  TGV+S  L++ +    S  DL+    I   D+G   L S+  L +++        PP+    F Y+      +     P   + ++    P   L   I ++I  G       +DP +G L +  + +    +   +  I I A DG      +   IT+N  D   N  + +E+     E+ E  +    + + +A    S  + ++ Y L ++     EI E +G +  +  LDREE      +V A  +G        +V + + D+ND  P F +  +   V  N    +  IRV + DLD G N    YS +   P     KF I+  SG IT+     +E    ++ + + A+D    A +  T + +   +D +P F+ S YS   PE     AL   I+ T +        I Y++   +   +F +D     +     V     +     +  + L + ATD      +S  ++ I ++D ++  P F ++ Y A + ++      I+ +    ++   +  +++SL     SS      F +    G I++ + +       +E  +     G    ++   + + +  EN + P+F   ++   +      GS ++   ATD DT  N  L Y +   NE  + F +D+ +G I   Q  + + +          + V D  +  +++V++       + ++PP F   E+H  + EN  V + + +  A+D D  K   + Y  +  G D   F ++   G +    + D E + ++ L++   +  +  + +A + +HV  +N+  P   Q  +   V   T + GT + ++    A D+D     R+ Y LV    S    F +D+ TG + +      +  N             ++   V  +   S R   T         V I+I         I      TI E  P+   V   +    +++ +     +S++      +++  F+ID   G I     +D E  S Y + V   +D    P   + T+ I+L D ND  P F       +ISE+ P G+ ++   A D D       F   YQL   +      +D + G V S ++ D E T ++  ++   D  K    +   LTI+V D ND
Sbjct: 2402 GGYVLTVNAYDADTPPLNSQVRYFLKEGDSDL--FRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQD--INDNDPVFELQSYHATVREN--LPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETS-VYHLTLMAQDSSITEPRASS-VNLTISVSDVNDNIPKF-DSTTYNVAVPERISKGEFVF----------GARAL-----DLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLEL-KTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILR-------PPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDY--ELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPV-MEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITE-SGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKF-TRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYS-FSENPGE---KFRIEPQSGNITVAGHLDREQQ-DEYILKVVASDGAWRAETPIT-ITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPS--PMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSS-----IFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQD-FSVDERTGGIVIQQQLDYDLIQE----YHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVS-ETSAVGTRVGAV---QATDKDSGEDGRVYYLLVGS--SNDKGFRIDTNTGLIYVARHLDRETQN-------------RVVLTVMAKNYGSIRGNDT-----DEAQVIISIQDGNDPPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIING----NLKQSFKIDVQTGEISTASRLDREETSTYNL-VIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPF--TYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQND 3752          

HSP 14 Score: 164.851 bits (416), Expect = 1.880e-39
Identity = 220/914 (24.07%), Postives = 378/914 (41.36%), Query Frame = 3
Query: 1566 TFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTKISYYLFDQNK---------LPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGL---VSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRF-LDSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVN-FRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE------YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITA-AIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIIN-KILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHL 4229
            T  + I ++DVN+  PV ++  +   + EN  I   V+ ++A D D  R     YL  + +         LPF L      + +V + LD E ++  + + +   D G P  +S  +   I I D N+  P F  K    +++  A     +    A D+D      I+ SI  +  Q   FSI  ++G + +     +  LS+   +++ ++A D  L         L  +++D N                                       N+P F          + P +  + E +        +T+   D D  P  S+  +    E +  +F   R ++ S DI +   LDRE   +Y +T+   D G P         ++V+DINDN P F L S+    T+ EN      ++  +ATD D   +  +++ L+      F I S TG +     LDRE+   Y + ++A D         ++  LTI V+D+NDN P F   +Y++A+PE +  G F+    A D D  +N+ + Y I G     F  +T TG V    +L   T+      Y ++    D G+ Q+LSS+A+  +    + P    P+      +  A+ E+  PG ++T +   +  K     + Y I+G   G SL R++    + +V     + E ++   I+IE  + +  + + +  + + VTD NDN P+ E+  Y A V E       +  VKA+D D      + Y+ +  D  G F   +      +   +DRE +         Y   V   D GVP    T ++ ++++D         NDN   F R  S   +N          + RVT+ D+D   NA   Y+         + +  E F ++ +SG++
Sbjct: 2150 TVKVTILIKDVNDEVPVFIS-ANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVV-DALDRE-LRSSYLLNITARDRGEP-PQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIV-LGDQNHDFSISEDTGVVRVAKNLNYERLSR---YSLTVRAEDCALENPAGDTAELTINILDIND--------------------------------------NRPTF---------LDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRY-FLKEGDSDLF---RINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYH--ATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSI-TEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGE-QSLSSKAELTVI---LRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSL-RVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYR-LQNDFDGTF-EITESGEIYTRMRLDREEIGD-------YAFVVEAVDQGVPHMTGTASVLLHLLDK--------NDNPPKFTRLFS---LNVTENAEIGSFVIRVTSSDLDLGANANASYS--------FSENPGEKFRIEPQSGNI 2968          

HSP 15 Score: 161.384 bits (407), Expect = 2.113e-38
Identity = 214/849 (25.21%), Postives = 366/849 (43.11%), Query Frame = 3
Query: 1566 TFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTKISYYLFDQN-KLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPC--FSIHPESGTL--SLLCTFKHG--MLSKLTNFTIGLQANDSGL--VSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRF-LDSFQIPMTLPENYDIKKRIVQIKATDADSKD---IQYRLV--NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI--HGIHSDCFHCDTSTGAVHLLCKLSPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRIN-NEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKI-LAEVYIKVTDENDNCPMPE--RAFYKASVAENLQGIHHLITVKATDADM-NKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLS 4046
            T ++ + + D N+ PP      S + V EN EIG  V+ + + D D+     + Y F +N    FR+ E +   + V  +LD E  Q  + ++V+ +D GA  A + I    I I D N+  PEF +     +          +G  IA D D+ G +    S+ S S QQP   FSI P +G +       FKH   + S    + + + A D+G   + S+  +N ++VDA+                              N+P  +E++            +   +P      +++ +G   Q+I    A+  +D   +E  + + +     +FS+ R   H   I +   +      +Y + +   D+G P      R  I V   N + PRF ++S+Q+   +PEN  +   I+ + ATD D+     ++Y +   N R+ F +  RTG + ++  LD +    Y + I   D+ ++  S  A  T+   + D+NDN P+F    Y   +PE+ P+G+F+ Q HA D D   N+ + YA    G     F  + S G +          E R I  ++   K    S ++   +Y   +  N + P   +P+    + E    GT V +++    D      VY +   S+    FRI+ N G I     +DRE +    L +  ++      N    A+V I + D ND    PE  + +Y ++++E       + TVKA D D+  +  +  Y II+G+    F I       ++   +DRE        T  Y+L +   D+G+P Q  +  +H+ + DVNDN P+F  +     N Y+S
Sbjct: 2896 TASVLLHLLDKNDNPPKFTRLFS-LNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRI-EPQSGNITVAGHLDRE-QQDEYILKVVASD-GAWRAETPIT---ITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPN----SVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAH------------------------------NNPPKFEQAE-----------YLAPLP------QDAVRG---QRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGR---HDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQV--IVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTII--LTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFD--YEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND---PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREE-------TSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEG---LNGYIS 3661          

HSP 16 Score: 159.458 bits (402), Expect = 8.064e-38
Identity = 229/942 (24.31%), Postives = 386/942 (40.98%), Query Frame = 3
Query: 9153 LIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLT---ISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRV-SESGEVLLLHPLDAEKILKP---------------------LQLKFLASDR-LHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESK---KCSFKILINVLDINDNAPRFVHTSI-APFLENAPHGSVIGKIHAVDADSGINRKIVYRI-LDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQM------ITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPS--------LSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFE---VG------RLHIKDKD--------GPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETI-IGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLD---SGMYSLNVKVTNVTLSTEKVIFIKI 11777
            + D ND  P+FD++ Y   + E   + ++     A D D      I Y + + +   T   F +   G+++  + +D EE     L VS  D AG  + +++    I V D ND  P +T +     I      D    TF   V +L+A D D     E L F +++Q  +     F + + +G +  L P D E ++K                      + L+   SD  +   +++  + + V DVND+AP   + P  + I EG + G+ IT +   D D     + + Y+L + ++     ++  TG++ +   LDRE     + +V A D   K     +  I I VLD NDNAP F  +S     LE +P G+ + +  A DAD G+N ++V+ I     + +F ID  TG + +   LD E    + L I ASDCG P  S      ++++D ND+PP F +  I  ++ E   +   ++T+ A   D G+N +VSY +      + +   F + + +G +  ++++D E    + LTV A+D+  PS        L T     I              LP  F+  +    S   + +V A D+DS  N ++TY  +    E               F++   TG I     P  +++  Y+  +  TD  + +    + V I I        E + P F             +Q  K +G ++E   +G        H+   +          T S     +L + +     L    EL  E     AG     V    + +   GQP    R +V V V+  ++ PP+   L+  +VY  SE + IG  +   R    D       +TF  +     K       F ++  TG +   + LD      Y L ++V++    TE    I++
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGN---TERMFGVFPDGYLFVRAPLDREERDYYALTVSCRD-AGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPAD----TF---VGKLTAVDRDIGRNAE-LSFTLSSQTQD-----FTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGD-VYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKG---SSTAVMQVHAKDADSSSNGLVTYEIVSGPQE--------------LFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQF-------------EQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDRE-----AGPEEYEVEVYAIAL--GGQPRT-SRTKVRVTVLDKNDSPPQF--LDTPFVYNVSEDLQIGHTISTLRAHDPD---TLGSVTFLLMDGHDGK-------FLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYATIQV 1912          

HSP 17 Score: 140.198 bits (352), Expect = 5.027e-32
Identity = 198/818 (24.21%), Postives = 335/818 (40.95%), Query Frame = 3
Query: 9012 DFEIDSNYGYIRAKKIMDFET-QSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRI-------DDQGWVY--SVSAVDYEETKLINLVVSASDKAG--HVTNTTLTISVYDVNDEIPYWTKNPPV-----DGIEITETCDGCSETFPRV-VYRLSAKDNDSESQKESLHFLITNQN---LNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEE---FILNIRVIDVNDHAPVCPQ--IPD----LMIFEGITPGSVITTLQAYDRDSSAKYNTLT----------YTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALD--VESKKCSFKILINVLDINDNAPRFVHTSIAPFL-ENAPHGSVIGKIHAVDADSGINRKIVYRILDESK-SSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMI--TEQNF---FRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLP--YVFNIPENTLVSKLT--------IGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFL--NFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSG----IIPDQELKKNGD-MFEVGRLHIKDKDGPTNSN 11267
            +F +D   G ++   ++D E  +  Y + V       P+     + I ++D ND  P F     AI  SE    G++++   A D D     V     Y++ +      FR+        D  +++  +   +D E      L +SA D           + +++ DVND       NPP+       + + ET        P   V  + A DND     +  ++L   ++   +NP       +E         + +    K       A D  H S  +     + + ++D NDH P+      PD      + E    G+V+  +   D DS     T            + L E +D ++         V VN  LDRE     N  V A+D    ++  +  ++I+V D+ND+ P F  +  +  L E AP GS +  I A D D+G+N ++ Y IL  ++   FS+D  TG++     LDRE +    L I A D G  PK   T +K+++LD ND  PQF      + + ED     ++  + A   D G N  V++ +    E+ +   F L++L+G LT  + LD E   +Y ++V A D+G P+  + T   + +   + N     F P  Y++++ ++    KL         +  VTA D D G N+++ Y                 +  E  F+++ ++G I L  +       +P YK  VS  D G     S+ +  +EI  K       ++       Q    G    ++ D E ++N     EVG + +K  +G  NS+
Sbjct:  102 EFTLDPVTGEVKTNVVLDREGMRDHYDLVVLSSQPTYPI----EVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVT--DQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVND-------NPPIFDHSDYNVSLNETA------LPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARD--HGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHI---------VRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATA-TVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRL--------------ESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAG--QRRSQQDAIVEIVLK-------SKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSH 865          

HSP 18 Score: 124.02 bits (310), Expect = 3.767e-27
Identity = 155/585 (26.50%), Postives = 257/585 (43.93%), Query Frame = 3
Query: 1587 VQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDIS-RTKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFF-IRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQ--VEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKDIQYRLV------NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI--------HGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKP 3281
            + DVN+  PV  +     ++ E T++      + A D D+    +ISY + + N      G F    + V+  LD E  +R ++ + V   D+G P +RS +    I + D N+  P+F   T   +I   AP D  +G   A  +DRD   N ++S  ++S Q   F+I   +G +  L  F    L K++       + + G +   MA N+ +++A + S +G P   D VK  + V       + +N        N P F            P  + I E +++GT +  +  + AD+       +  + +    E   F++   DS +  + +  RLDRE+ + +H+ I V      K+ +     I   V D NDN P F  S    +++ E       +++ +A+DAD + +  ++V      N R  F I S TG L L   LD E    Y + I ASD      SL+ T    ++V D NDN PIF   +    + E +P+ + +V + A D D   N ++ YAI         G H   F  +T TG +H L ++    +  +RL  V  D  +P
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERM-FGVFPDGYLFVRAPLDRE--ERDYYALTVSCRDAGQP-SRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTA--VDRDIGRNAELSF-TLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEA--SGEDGSLRGSMAGNYMLLEA-TVSDNGIPRLQDKVKVKVIV-------TDVN-------DNAPEF---------LRAPYHVTISEGASEGTHITHVFTQDADEG---LNGDVYYSLAKGNEAGQFNL---DSATGQLSLGRRLDRESQEIHHL-IVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSS-EVSVLETSPTGTELMRFRASDAD-QGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCG--TPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRH---FGINTETGVIHTLREIDRESIDTFRLTVVATDRAQP 1576          

HSP 19 Score: 121.324 bits (303), Expect = 2.626e-26
Identity = 178/727 (24.48%), Postives = 298/727 (40.99%), Query Frame = 3
Query: 1479 KDLNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDIS-RTKISYYLFDQNKLPFRLGEFKRN----VVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEI--ADVNEYKPEFVYKTCQI---TISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHG-MLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETV-DKYHMTI-AVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADS-KDIQYRLVNFR-RVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYA-IHGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDE 3602
            K L+ ED  S   N+T +     SL T  T    + V D N+ PP+  +   V  +KE   +   ++ + A DPD     K+SY +  Q     +   F  N    V+     +D E++   F + V+ TD   P  R +     + +   D+N+  P FV     I     S        +    A+D D      +   I  VS  Q  F +   +G    + TF  G    +   + + L++ D  + S + +                        +++Y+       + I   +   ES+ P F  R      + +   ++  E    GT +  +T   A  + + + +         +   +F I   D+    +  A  LDRE   ++Y + + A+   GQP+    K   + V D ND+PP+FLD+  +   + E+  I   I  ++A D D+   + + L++     F +   TG L L   LDRE +  Y + I  SD   Y  +          V+D NDN P+F    YS  +PE+   G  + Q+ A DADL  N+QL Y  +    +D F  +  TG + L  +L    +  Y LI   +DNG+P +LS+     +Y   +  N   P       ++ + EN    T V ++  +  D      + Y+I+   +  S F I++ G IRT  ++DRE   +Y L +   D  DE
Sbjct: 1445 KPLDYEDITSYTLNITASDCGTPSLST--TVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDT-FRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEI--VSGPQELFKLQRNTG----IITFTPGPQFKQEVRYQLTLKSTDEAVQSERRS------------------------SEVYI-------TIITPGSGGSESSVPQFEQR------SKLSGSVY--ENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDI---DAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTK-VRVTVLDKNDSPPQFLDTPFV-YNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYATIQ-----VSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQP-SLSTT--ITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITA-GDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADE 2109          

HSP 20 Score: 115.161 bits (287), Expect = 2.022e-24
Identity = 138/533 (25.89%), Postives = 228/533 (42.78%), Query Frame = 3
Query: 2382 NIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKD---IQYRLVNF---RRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSD-CFHCDTSTGAVHLLCKLSPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQS--FVYTISGHSNGISLFRIN-NEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTE-LKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQ 3947
            + P F+ N   VI    E    TI   +T+   D D  P      + +    E+  FS+   D  +  IV+  +LD + + +YH+ I V D G           I + D+NDNPP F +  +    +PEN  +   + Q  A D DS     I Y  +     R  F ++   G +   V+ D E+R  Y + I A + D    S+ + A L + V  +N+  P F +  +   + E   +G+ +  + ATD D  ++ ++ Y + G  +D  F  DT+TG +++   L   T+ R++  V          +  D       +      P   +   T+ I E    GT VT+++    D   Q+  F Y+I  + N    F+I+   GEI T S +DRE+  +Y L I   D          A V+I++ D NDN P          ++EN      ++T+ A+D D+ +      Y++I G    + S+     +  S  S DRE        T   +  + + DSG P+Q
Sbjct: 3225 DTPRFSVNSYQVIVPENEPVGSTI---LTVGATDDDTGP-NGMLRYSISGGNERQDFSV---DERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVF-NHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPD---SSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSII-NGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGS-ATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDRE-------MTPILEAIIEVEDSGKPKQ 3737          

HSP 21 Score: 112.849 bits (281), Expect = 8.676e-24
Identity = 213/919 (23.18%), Postives = 355/919 (38.63%), Query Frame = 3
Query: 1785 VIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEF-----VYKTCQ----ITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKM-ALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQ------------GQPKNCIFKRFEIQVEDINDNPPRF-LDSFQIP-MTLPENYDIKKRIVQIKATDADS---KDIQYRLVNF-RRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI--------HGIHSDCFHCDTSTGAVHLLCKLSPLTE-----YRLIAVVKDNGKPQALSSQADFQIYPQKVH---PNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSD-KEPQSFVYTISGHSNGISLFRINNEGEIRTVSSIDRE------------------KEESYWLYIYIEDR-NDEIINKILAEVYIK--VTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWT 4343
            +  +  LD E M + + I V+  D GAP  +S  A   + +ADVN+  P+F     +Y        I + ++   +  + H  A D D DG DN  I     S  +  F +   SG +SL       M  K  ++ + + A D+G   S+  A+   V+ +    L     +    +  +   H+  R+S  N             G+  + + +TN  +  HI  +  +G   Q                                  R D+ S  I  A  LDRE    Y +TI                 GQ   CI     I + D+NDN P F LD    P ++LPEN  + + I   +  D D+     I Y L N   + F+I   TG L L+  +  E      + ++A+D    +  L++  +L++++AD+ND+ P+F   SY  +LPE   + +    L ATD DL DN ++ Y I         G+  D +           L   +PL       Y L    +D G+P   S      + P  +H    N   P       T +I EN    T V  +     D        +T+S  +   ++   N  G I+T+   DRE                  +      Y+ +E   +D  I ++  +V +K  VTD NDN P   RA Y  +++E      H+  V   DAD     ++ Y +  G+  G F++ S     +  R +DRE         + + L V+  D+ +   +++      ++          NDN   F +  S+  ++      T   + R  A D D  +N+ V +++          +  + F +D  +G L+ +      D        I ++ +N+ A D G P++ T
Sbjct:  659 LTTRRPLDREKMSQ-YEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKD-DG-DNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWK-PHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNRE----------VGI--VQVKSTNGKANSHIEYDIIQGDRAQNF--------------------------------RIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQ---CIVN---IAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAG--SPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDGY-----------LFVRAPLDREERDYYALTVSCRDAGQPSRSS------VVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRN--GFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRES-------QEIHHLIVVAKDAALKHPLSSNASITIVVLDE-------NDNAPEFTQ--SSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISA-------GNRRDTFHIDSITGSLYLHKPLDYED--------ITSYTLNITASDCGTPSLST 1471          

HSP 22 Score: 104.76 bits (260), Expect = 2.614e-21
Identity = 187/740 (25.27%), Postives = 306/740 (41.35%), Query Frame = 3
Query: 2604 LDRETV-DKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKD----IQYRLV------NFRRVFKIH--SRTGWLRLRV--NLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL---------SPLTEYRLIAVV--KDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIIT----------AAIRENCLPGTLVTSIRPETSDK--EPQSFVYTISGHSNGISLFRINNEGE---IRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPP--RVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSE-NATDP--------------------KSENDKSKLYLAYLPSDSIN-----IVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYK 4616
            LDRE + D Y + +      QP   I  R  I+V D+NDN P F +   I ++  E+     R++   ATDAD  +     QY +V       FR V   +    T +L L    NLDRE R  Y + I A D     R       + + + D+NDN PIF  + Y+++L E    G+ +V + A+D DL DNS++ Y +       F  +  TG +    ++         S  ++   +  V  +D+G P     + D + Y   V  N    +  +PII+          A + EN + GT+V ++  + SD     ++ V  +SG  N +  FR+    +   +R    +DRE+   Y L +   D+         A + I V D ND+ P+ E++ Y A ++E       + ++ ATD D     ++ Y I+SG+   +FS+     +  +   +DRE         D  +L +   D G   +     + V I+D ND AP F              + +          ++  +TA D D   N +V + + P   R+  L       F++D  +G L    +    D       ++  ++I+V A D GAPT  +   A  T+ L +++ N  DP                    K E +K ++ L    SD  +     I Y    G E L      QLD +  ++ ++    D P S+ W      P YK
Sbjct:  118 LDREGMRDHYDLVVL---SSQPTYPIEVR--IKVLDVNDNSPEFPEP-SIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPR--FGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQ-FTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSP-----RQDGRTY---VTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSG--NELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTP-ARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDRE-------IRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQ----------REQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQ------FALDALTGQL---TTRRPLDRE-----KMSQYEISVIARDQGAPTPQS---ATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLF-----QLDARSGAISLR---GDAPASMHW-----KPHYK 790          

HSP 23 Score: 99.7525 bits (247), Expect = 7.882e-20
Identity = 166/709 (23.41%), Postives = 291/709 (41.04%), Query Frame = 3
Query: 5745 TGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQI-EYVILS-------RFASYFKIDQYTGVLSLAL--KIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKIS-------TNDIPVSGKFPSVVLINIRAFDG--KFETSCNITINSFD-NTRNKVLPLE------KSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGS--LKLKSALDREERPFVQLLVLA--KGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIV--SDKSPLFDKSKYSVIVPEDALKDFIVTTVKAI---SSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSL--SHSTTVLITVLDINDELPIFLKSSYSASVS---ENMPINHEIISISVLLQKVSNSK------IVEFSLKLIEDSSPCSSQHFRINGTTGTISIK 7733
            TG + T   LDRE ++D   + +       L S+    I V+I + DVNDN+P F  P  +    SESA  G+ + L +               A D D G+NG   +Y I++       R  +       T  L L     +DRE  GS+  L+I  +D GSP       L++ + I D ND PP F+   Y   L     P  P++ +   D DL      +    +    F+++P TG +  +         ++  S    S V        G  + +    +T+N  D N  + ++         K   V E   N   V  + +  +    + +  S++ +  +E     + E      +++   LDREE     L V+A  +G        ++ + V D ND++P+F   +Y  ++       +    + A D D G N  V Y I       +   F++D  +G+I + +GP    +     + I A D G     ++T + V I+  +D++P F + + +V + EDA    IV  + A      T  ++ + +   + E L+ L F    L  G    R    LD E    + + + A D  +    S + TV + V D+ND  P F    Y  S++   +++ +  E+    +LL   ++ K      ++E+ L+            F+++  +G IS++
Sbjct:  109 TGEVKTNVVLDREGMRDHYDLVV-------LSSQPTYPIEVRIKVLDVNDNSPEFPEP-SIAISFSESATSGTRLLLDA---------------ATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSY-QLNISARDGGSPPRFGY--LQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGR-TSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKW---FSMDPLTGLI-VTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAP-SVERLYPLQFALDALT-GQLTTRR--PLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLE------SGGEGLFQLDARSGAISLR 776          

HSP 24 Score: 97.4413 bits (241), Expect = 4.065e-19
Identity = 216/934 (23.13%), Postives = 362/934 (38.76%), Query Frame = 3
Query: 1512 ERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDIS-RTKISYYLFDQNKLPFRL----GEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFI--AEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSK--LTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDR-DPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVA-DRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKD---IQYRLVN-FRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKE-PQSFV-YTISGHSNGISLFRIN-NEGEIRTVSSID-------REKEESYWLYIYIEDRND-EIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHL 4229
            E  LT+      S     T  +R+ VQD+N+  PV        TV+EN   G  VL  +A D D     K+ + L  ++   F +    GE      + +E          + + ++  DS     R+   +  I ++DVN+  P+F   T  + +    P  +  G F+  A  LD D  +N  +        Q  F I+ ++G +S     K    S   LT +TI + A D G  S       +V+         RP +L                                      P FA    S   + E+   G ++ K++  +  K            G+  +         R D +S  + V  D LD E    Y + I   D   P         + V D NDN P  ++       + E     + I  +KA+D DS D   + YRL N F   F+I + +G +  R+ LDRE+   Y  V+ A D    + +   TA++ + + D NDN P FT+  +SL + E+  IGSF++++ ++D DL  N+   Y+      + F  +  +G + +   L      EY L  V  D     A  ++    I  Q  + N   P  +    + +  E      LV  I     DK+ P S + Y++   S    +F I+   GE+ +  ++        R  E  Y L +   D     + ++ L  V I + D ++N P  E+A Y A + ++      ++ V A D       E+ Y +++ +    FS+       T  + I   P          Y+L V  +D GVP Q +   + + +   N + P F  ++  V        ++  +    + IL   V A D D   N  +RY++          +  + FSVD ++G +
Sbjct: 2456 EYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSV------YHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAV----PERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLT-YTIVISAMDQGEQSLSSKAELTVIL--------RPPEL-------------------------------------FPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDS-------LRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAP-VMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEI-TESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMT--GTASVLLHLLDKNDNPPKFTR-LFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDG----AWRAETPITITIQDQNDN--APEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPS---PMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECL--VNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPP-------NTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQV--------IVPENEPVGSTILT--VGATDDDTGPNGMLRYSIS-------GGNERQDFSVDERTGGI 3286          

HSP 25 Score: 92.0485 bits (227), Expect = 1.656e-17
Identity = 140/552 (25.36%), Postives = 228/552 (41.30%), Query Frame = 3
Query: 2604 LDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXX--------------------XXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI-HGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQS-FVYTISGHSNGISLFRINN-EGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVY-IKVTDENDNCPM-PERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGD----TWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXX---XXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRY 4148
            LDRE  D Y +T++  D GQP         I V D NDN P+F +S     ++PEN      + ++ A D D   + ++ + L +  + F I +R G+++     DRE          AS  D   R   A                       + +IV D+NDN P F +  Y + + E    G+ +  +   DAD   N  + Y++  G  +  F+ D++TG + L  +L   ++  + LI V KD      LSS A   I    +  N   P   +     ++ E    GT +   R   +D+   S  V++IS   N    F I++  G +     +D E   SY L I   D     ++  +  +Y + V D+NDN P+ P  A  +  + E +     ++TV A D D     ++ Y I   +       +F I++   +  + R IDRE +       D + L V+ +D   P +       +  + V    DNAP F++ N  +     ST        K ++  + +V A D D   N  V Y
Sbjct: 1111 LDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNS-TFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIV--VLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISA-GNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTV--LYNVLVVDDNDNPPIFPSTAIVR-QIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESI-------DTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTS-------KGSSTAVMQVHAKDADSSSNGLVTY 1641          

HSP 26 Score: 89.7373 bits (221), Expect = 1.001e-16
Identity = 143/533 (26.83%), Postives = 218/533 (40.90%), Query Frame = 3
Query: 10179 LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHH-LVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEV-SYQMITEQ--NFFRLESLSG--------NLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFL---------NFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSL---YLGVRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFD-MLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLD 11702
            LE  P G+ +G I           K  YR  +E    F++D  TG ++   +LDRE   +H+ LV+ +S    P       V+I +LDVND+ P+F    I +  +E    G  L+   A   D+G N     Y+++     N FRL + +         +L     LD E    Y L + A D G P       V + ++DVNDN P F    Y  ++ E  L     +  V A D+D G NS +T    Y+L E            EH F +NP+TG I             V     Q +  F V   DHG P    +T VT+ + D ND+ P     SFRF     +   + +  +  NG +  V  + +KD D   N      ++++   +  F  + +E  D  I+ V G L    +G   L V   D G P+      + ++V  +++  P  E     Y    SE        +A +   D     +  + ++ +    LK      +F +D  TG I TT  LD
Sbjct:   74 LEGQPRGTTVGFIPT-------KPKFSYR-FNEPPREFTLDPVTGEVKTNVVLDREGMRDHYDLVVLSSQPTYP-----IEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVV-TVMASDNDLGDNSKIT----YYLAE-----------TEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPII---SFRFFPDGGKVATVDENAV--NGTV--VAAVAVKDSDSGLNGR-TSVRIVSGNELGHF--RLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFE--KSEYSAVLSELAPTGSF-VASITATDEDTGVNAQVHYDILSGNELK------WFSMDPLTGLIVTTGPLD 558          

HSP 27 Score: 85.5001 bits (210), Expect = 1.612e-15
Identity = 86/304 (28.29%), Postives = 142/304 (46.71%), Query Frame = 3
Query: 2424 IREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFE--IQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSK----DIQYRLVN--FRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQ-LRYA-IHGIHSDCFHCDTSTGAVHLLC----KLSPLTEYRLIAVVKDNGKPQALS 3293
            + E SA GT V  +  +  DKD       +   V S  ++      R D+++  I VA  LDRET ++  +T+   + G  +       +  I ++D ND PP F+  +    T+ E   +  ++  +KA D D +       Y ++N   ++ FKI  +TG +     LDRE+   Y +VI A D     ++ +AT  +   + D+NDN P FT    +  + E+ P G+ ++ L A+D DL  N     Y  I G H      D ++G V        +++P+ E   I  V+D+GKP+  S
Sbjct: 3448 VSETSAVGTRVGAV--QATDKDSGEDGRVYYLLVGSSNDKGF----RIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYT-STISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIE--LEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILE--AIIEVEDSGKPKQKS 3739          

HSP 28 Score: 85.1149 bits (209), Expect = 2.429e-15
Identity = 173/736 (23.51%), Postives = 280/736 (38.04%), Query Frame = 3
Query: 1728 YLFDQNKLPFRL----GEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLD--RDG-RDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLT--NFTIGLQANDSGLVS--SKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMR--NIPIFATNIPS--VIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPP----RFLDSFQIPMTLPENYDIKKRIVQIKATDADSK---DIQYRLVNFRRV--FKIHSRTGWLRLRVN--LDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI-HGIHSDCFHCDTSTGAVHLLCKLSPL-TEYR----LIAVVKDNG-KPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQ-SFVYTISGHSNGISLFRINNE---GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPM--PERAFYKAS-------VAENLQGIHHLITVKATDADMNKKTELKYKIISG 3797
            Y F++    F L    GE K NVV     LD E M+  + + VL +    PI         I++ DVN+  PEF   +  I+ S  A    ++    A D D   +G  D  +I   +V  +    +    SG  S L     G L + +  ++ + + A D G       + +N +++D N                                       N PIF     N+ +  T +P   V+ +           KIT   A       E+E  F V + E  ++ +  R +      V +    +  V     T+   D G P+        + + D ND+ P    RF        T+ EN      +  +   D+DS        R+V+   +  F++        +RVN  LDRE+   Y + +VA D     R+ TA   +   V D+ND++P+F K+ YS  L E  P GSF+  + ATD D   N+Q+ Y I  G     F  D  TG   L+    PL  E R    L    +D G  P+   +Q    I  +    N   P   +      + E+  P T+V  +     D+    S  + ++     +   +   +   G++ T   +DREK   Y + +   D+         A V++ V D NDN P   P    Y  +       + + ++    L+ V A+D D      ++Y++ SG
Sbjct:   94 YRFNEPPREFTLDPVTGEVKTNVV-----LDREGMRDHYDLVVLSSQPTYPI------EVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVND--------------------------------------NPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLA-------ETEHQFTV-NPETGVISTTERVNCPQQTNVKSSASQKSCV----FTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIID--VNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTG---LIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDE----NDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESG 759          

HSP 29 Score: 77.7962 bits (190), Expect = 3.330e-13
Identity = 48/138 (34.78%), Postives = 61/138 (44.20%), Query Frame = 3
Query: 13224 YVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHCE 13637
            Y CQC   F+G  C      C  +PC    +C    S F+C+CP    G  C+  +S      PC    +C      S Y    C C    RG  C+   D C+  P  C  G G+C +L  GY+CNCT G  G HCE
Sbjct: 3997 YSCQCTSGFSGEQCSRRQDPCLPNPCHSQVQCRRLGSDFQCMCPANRDGKHCEKERSDVCYSKPCRNGGSCQRSPDGSSY---FCLCRPGFRGNQCESVSDSCRPNP--CLHG-GLCVSLKPGYKCNCTPGRYGRHCE 4128          

HSP 30 Score: 70.0922 bits (170), Expect = 8.272e-11
Identity = 115/514 (22.37%), Postives = 202/514 (39.30%), Query Frame = 3
Query: 4998 NGDLRLISPANAYSNQTFDIIVEARN----KRATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSL----------------------TAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNS-ILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVI-LSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPD--LNPTILFSILNGK----ESRFFSIDPTTG 6437
            +G L + +P +      + + V  R+     R++ + + IH++D N+  P+F  S                                       F+F+ I   +   T +  ++A D+D GRN +L F + + +     F +D  NG I+  R                         ++    + L   VSD G P   ++  V V + D  ++ + P+   +   + + E  S  + I H     +   L     Y +   K +    F +  +TG +     LDRE  Q+I  + I V     L    +S  S+ I + D NDNAP F          ++S++  S++     G +L +        A D D+G N Q+ + I        F ID  TG L L   +D E + S+  L+I   D G+P L +     ++++  D+ND PP F     ++ +        P++ +   DPD  LN  + ++I   +    + R F I+  TG
Sbjct: 1102 DGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNS--------------------------------------TFTFS-IPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQT---QDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTD--VNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSL--AKGNEAGQFNLDSATGQLSLGRRLDRES-QEIHHL-IVVAKDAALKHPLSSNASITIVVLDENDNAPEF----------TQSSSEVSVLETSPTGTELMR------FRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYT-LNITASDCGTPSLSTTVLYNVLVV--DDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETG 1548          

HSP 31 Score: 65.0846 bits (157), Expect = 2.757e-9
Identity = 54/166 (32.53%), Postives = 79/166 (47.59%), Query Frame = 3
Query:  294 VAHYDFQMGIEKPEEEGKITYKI--RDSSEIFNTFEAESKLVGDFFYLRIRTKYTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGII 785
            +A  D  +G     + G+I+Y+I   ++  +F  F           YL +R    A L+RE   +Y LT+      +  G+   S    VVI V+D NDN P F N  F F   ENA   T +G +TA D D G N+E+ + L  S+ T D     F+I+  +G I
Sbjct: 1071 LAATDIDLG-----DNGRISYEIIEGNTERMFGVFPDG--------YLFVR----APLDREERDYYALTVS----CRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTL--SSQTQD-----FTIDTRNGFI 1208          

HSP 32 Score: 63.1586 bits (152), Expect = 9.046e-9
Identity = 43/130 (33.08%), Postives = 67/130 (51.54%), Query Frame = 3
Query:  414 GDFFYLRIRTKYTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKL 803
            GD  YL + T  T +L+RE  G Y L I     ++  G        QV + +LD NDN P+F + ++     E A   T + TV A+D D G NS+I YYL ++       +  F++NP +G+I   +++
Sbjct:  215 GDTSYLHLET--TGNLDRESRGSYQLNIS----ARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAET-------EHQFTVNPETGVISTTERV 331          

HSP 33 Score: 63.1586 bits (152), Expect = 1.087e-8
Identity = 32/84 (38.10%), Postives = 43/84 (51.19%), Query Frame = 3
Query: 13131 ESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQ 13382
            E     +C +  C+NGG C      + +  SY C C+  F G  CE  +  CR +PC+HGG CV  K G+KC C  G  G  C+
Sbjct: 4049 EKERSDVCYSKPCRNGGSC----QRSPDGSSYFCLCRPGFRGNQCESVSDSCRPNPCLHGGLCVSLKPGYKCNCTPGRYGRHCE 4128          

HSP 34 Score: 62.3882 bits (150), Expect = 1.709e-8
Identity = 144/604 (23.84%), Postives = 239/604 (39.57%), Query Frame = 3
Query: 2604 LDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKD---IQYRLVNFRRVFKIHSRTGWLRL--RVNLDRE-----KRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPI-----FTKNSYSLALPEDLPIGSFLVQLHATDAD--LDDNSQLRYAIHGIHSDCFHCDTSTG----AVHLLCKLSPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRINN-EGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVT--DENDNCPMPERAFYKASVAENL--QGIHHLITVKATDADMNKKTELKYKIISGDTWGY---FXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPE-QXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLG 4325
            LDRE+   Y + I+  D G P    + +  + + D+NDNPP F D     ++L E       +V + A+D D  D   I Y L      F ++  TG +    RVN  ++            V      D  +        +T+ + D ND+ PI     F        + E+   G+ +  +   D+D  L+  + +R  + G     F  + +       V+ +     + +Y L  V  D G P A ++ A   I    V  N + P  ++   +A + E    G+ V SI     D    + V+      N +  F ++   G I T   +DRE  ++  L I   D      N   A   +KV   DEND  P   +     ++ E+   Q I  L+T  ATD D      + + +       Y   F++ +     T+ R +DRE +         Y++ V+  D G P  Q  T  + +N+ DVNDN P F   + ++++     + I   +      ++  VTA D D   NA + Y         L +    LF +D +SG +      S+  ++       P +K+ V A D G
Sbjct:  228 LDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIF-DHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRI-VSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTP-ARTTTAHLIIDVNDV--NDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGP---NPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMT--ATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQ-------YEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRH-YIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEY--------RLESGGEGLFQLDARSGAI------SLRGDAPASMHWKPHYKLLVSARDAG 799          

HSP 35 Score: 58.5362 bits (140), Expect = 2.287e-7
Identity = 33/109 (30.28%), Postives = 62/109 (56.88%), Query Frame = 3
Query:  459 LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGII 785
            L+RE IG YNLT+  + +    G    +    ++I V D ND+ P+F    +  +  E A   + + ++TATD D G+N+++ Y +    ++ + +K+ FS++P +G+I
Sbjct:  452 LDREEIGKYNLTVVAMDQ----GTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDI----LSGNELKW-FSMDPLTGLI 551          

HSP 36 Score: 58.5362 bits (140), Expect = 2.425e-7
Identity = 38/116 (32.76%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  456 SLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKL 803
            +L+RE    Y L I     ++  G+   S ++Q++I++LD NDN P+F  + +     ENASI   +  V+ATD DEG N  I Y     +I        FSI+  +G++   + L
Sbjct: 2235 ALDRELRSSYLLNIT----ARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRY-----SIVLGDQNHDFSISEDTGVVRVAKNL 2341          

HSP 37 Score: 55.0694 bits (131), Expect = 3.113e-6
Identity = 102/427 (23.89%), Postives = 154/427 (36.07%), Query Frame = 3
Query: 1512 ERNLTIAVAMNDSLETKKTFTLRISVQD-----------------VNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTKISYYLF--DQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSV-IAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLD-RDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGL--VSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNP 2723
            + N TI+ A++   E ++ +TL+I  ++                 VNEF P  +       V E + +G  V  +QA D D       YYL     N   FR+ +    ++ V  +LD ET Q R  + V+  + G+        A   I I D N+  PEF+      TIS  AP   K+    A D D R   +    SI + + +Q  F I  ++G +S          S   N  IG  A D+GL   +    ++  + D N    +  P  L                      N Y   N+P                          GT +  +T+  +D D       F + +   + +   S+   D +S  +      DRE        I V D G+PK        I V D NDNP
Sbjct: 3387 QSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRI-DTNTGLIYVARHLDRET-QNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQ-SFKIDVQTGEISTASRLDREETSTY-NLVIG--AIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGL----------------------NGYISENEP-------------------------AGTSI--MTLIASDPDLPRNGGPFTYQLIGGKHKSWLSV---DRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNP 3754          
BLAST of Ft-2 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 358.221 bits (918), Expect = 5.487e-98
Identity = 503/2035 (24.72%), Postives = 857/2035 (42.11%), Query Frame = 3
Query: 5478 LTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVN-SILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDRE--QIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPR----FLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKI---DQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPD--LNPTILFSILNGKE--SRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGK---FETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPS------IKYIL---LSEQPKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQS-----IRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSG--------VITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVS--DKSPLFDKSKYSVIVPEDALKDFIVTTVKAISS-TGHT--ILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVV--------------EFQVLVHDFTHXXXXXXXXXXXXI---KNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGN--KHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVK---INILYDKKKVNPIITCS--IMTIQENNPLNHIVA----------MCRISSTE----MKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINV---EYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQL-----DSVETGVS-FRIDDQGWVYSVSA-VDYEETKLINLVVSASDKAGHVT-----NTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRV-SESGEVLLLH--PLDAEKILKPLQLKFLASDRLHWSKE--EFILNIRVIDVNDH--APVCPQ-IPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALD-----------VESKKCS--------------FKILINVLDINDNAPRFVHTSIAPFLENAPHGSVIGKIHAV---DADSGINRKIVYRILDES-KSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKP-PKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNF-FRLESLSGNLTLIKKLDFELSREYFLTVRASDKG-YPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPP--EFAQPSFRFLIQ 11159
            L I   D G PP   R  + V I  + ++ + P   +S+    V EN +V  S+L      +        +Y +   +    ++F +   TG I    +LD E  ++ ++V     V + D       +   V I + DVNDN P     FL     +  ISESA PG  V                 I+  DPD         V L+    +F +   D    ++ + L +DRE+V ++  LS+   DKG+P L + +   I + I D ND PP+FE+D Y   ++    P   +LQ+  HD D  LN  + +S+    E  +++F IDP TG +   ++   +  +   V  + + A DG      ++  + +   D   N+ +  ++S     + EN        + R     S   P       + Y +        + E+   +G + +   LD E R   +  VLA    G      + + +TD ND +P+F   +Y+  +  +    +Q+     + V A D D G  G V Y I           F ID ++G        ++++++ P   L        I A D G    ++   VF+ I+    + P+F+K++Y+  V ED  +  +V +V A S    H   + Y+I +G+ +  F ++  +         IR+   LD+E K    L I AT     +   T V I V D+ND  P F  S    SV E+  +   + +     +   +S  V +SL  +++S       F I+  +G + + ++LD+E+   H   +     G  S +    + V + D NDNPP F +  ++  +S   S  + ++   A+DLDT  N+++ Y++++       +D  +  I  + V     + P+SG +              +  VL  D         +   V +    ++ P F  +++   + EN    S +G + ASD D  +   +RY ++    S  F +  +TG +  ++ LDRE + +++L V   D G   +     V IHV+D+NDN P I     +V  +   +  GT    ++++ A DRD      + Y +V    S          G  S+ P+        G+  T+       +     E  +Y   +A +        TV+   + +L D     P  T S  +  ++E+  L H+V           + R S  E    ++  ++L P +    ++  F+ID + G +   +++D E QS++R+ +   +    N+P  +  T+ I++ D ND  P +      + +SE  P+G+ +    A D D      + Y L +      +S E  +S FR+D      S+ A +D+E  +   L+V A D++ +VT     + T+ + + D ND  P++  +P   G +        +     VV  + A D DS    + L + IT  N       FR+ S++G + L+   P   E + K  +   +   + H   E  +  LN+ +I    H   P   Q +    I E +  GS +  + A     +   N L+Y +       L  V+   G +      DRE  ++    V+  D           V  ++ S                I I V D+NDN+P F   S   +  + P  S  G IH V   D D G N  ++Y I   +  + FSID  +G +  A  LDRE+   + L I+ASD G+P  +    N+ I + D ND+ P+F        V ED  +G  ++ I A+  D+GVNA + Y +  E  + F ++  SG +T + KLD EL   Y   V A+D G Y   S T  V I V+D+NDN P F   PY+  +P   +    T+ KV A D+D G N+ + YS             +  + +   FRINP TG +  +     E       +V   D G P  SS   + + I +     P   F   ++R +++
Sbjct:  254 LLIEALDGGTPPL--RGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELV-----VVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSD-DASPKISESAQPGEFVAR---------------ISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYT-LSVVATDKGTPPLHASK--SIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSH---IDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPI-FDQSFYNVSVAENE------PVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGI---FRIDRSTGEIFVVRPDMLSVRTQPMHML-------NISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGN-------IRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL--VKESG---KGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDA-----GVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS--FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGT---EVVRVRAVDRDHGQNASITYSIVKGRDSDG-------HGLFSIDPTS-------GVIRTR-------VVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVL-DLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDL-IEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFV-SPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQ-LTYEITGGNGE---GRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENAN-LSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSC--YGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPA-LIQPGQTLLKVQALDADLGANAEIVYSL-----------NAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLK 2176          

HSP 2 Score: 346.28 bits (887), Expect = 2.505e-94
Identity = 412/1588 (25.94%), Postives = 685/1588 (43.14%), Query Frame = 3
Query: 6699 YILLSE---QPKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSN-------------SGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDI--VSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHT---ILYTIT--NGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSS-LSHSTTVLITVLDINDELP----IFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTIS-IKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQV--HIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVL---NEYYNIFKIDQSSGFI--------RFNQVPNIEKLLPSSGVVEFQ------VLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEI-FGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTK-STGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAV-SLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATT---VISCSINVTVKINILYDKKKVNPIITCSIMT--IQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVS-FRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKA--GHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITET------------CDGCSETFPRVVYRL--SAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDR---LHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVES--KKCSFKILINVLDINDNAPRFV--HTSIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSS----FSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGV----------NAEVSYQM--ITE---QNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFL--PYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHG---IPAFSSKTNVTIEIEDKNDNPPEFAQP 11138
            YI+++E   +  + I+  TG ++ K  LDRE R    L+ +      S   I V V+V DEND  P F           N  +E +   + A DLD     T  Y+I  V     D  F + S+             SG +  ++ P   LL       I+A D G P L  F  V + I  V+D  P+F++S+Y   VPE+A     V  V A  +       + Y I     + E++F +D       P    I +   LD+ETK  H L++ A D     L  +  V I V D+ND  P    IFL    S  +SE+      +  ISV     S ++    ++ L          HF +     +I  +  +L  +  ++  + + V    + +P   A   +   I D NDNPP+F Q  ++A +   +  G+ V+  +A D D   NS L Y +      +   F+ID  +G I            VP +  +    GV          V +HD               + ++ P F  + +++SV+EN  V   I ++ ASD D      + Y +  GF     F + S +G + +   LD ER+S +E  V+ +D G     A + + +TD+NDN PV     Y+V++  S K S+  +   I+ + A D D     ++ YR+V+      I  +D  TG +  ++P  ++                      V  +P++   I+ T    +  + +  V ++I+ D  +  PI   +     ++E+ P   +V     +S ++  +  +  S    D    F I++N G IR  K +D E +SQ  +N++  +   P+     + I++ D ND  P F+ S   I + E   LG+ +    A+DKD      + YSL +    E+G   F ID + G +     +DYE ++   L+V+A+D       TN T+ + V DVND  P + K+     + ++E+             D  +    R+ YR+  +  DN + S        I++ +++  +  F    SG + L  PLD E   +  QL  LA+D       +K   I  +RV+D ND+ P   +   +  I E +  GSV+  + A D D   +   + Y+L+  +  +   V P+TG +    PLDRE     + VV A D  +  +     + I+V D+NDNAP        +    E  P G+ + ++ AVD D G N  I Y I+    S     FSID  +G++R   +LD E +  + L + ASD G PP+  +  +++ +LD+ND+ P F +  +  RV ED  +G V+ +I  I     V          +  V+Y +  +T+   +  F ++  SGNL + + LD E+  E+ L +RA D    +   ++ + +++   + N     +   P    + E T V  + I   TA D+D+G N  L Y  + + P+   +    ++     FR++  TG + L    D E    Y   V   D          +   V + I D ND+ P F  P
Sbjct:  111 YIIVAEAGVETDLAIDRATGEIRTKVKLDRETRASYSLVAIPL----SGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNI--VSGNVND-AFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLL-------IEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRID-------PRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISV-HDPDSKTEYANVNVTL-----NGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHD---------------VNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGN-EAGIFRIDRSTGEIFVVRPDMLS----------------------VRTQPMHMLNISATDGGNLRSNADAVVFLSII-DAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVK----ESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDE--YSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNS--------ISSSDVSQHFGIF--PNSGWIYLRAPLDRETRDR-YQLTVLATDNGTPAAHAKTRVI--VRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLD-LGENAAIRYSLLPINSSFQ--VHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTI-IHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMS----LFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSP 1605          

HSP 3 Score: 336.265 bits (861), Expect = 2.481e-91
Identity = 484/1968 (24.59%), Postives = 807/1968 (41.01%), Query Frame = 3
Query: 5727 FGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPD-EGKNGQIEYVILSRFASYFKIDQYT---GVLSLALKI----DREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFS-ILNGKES---RFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNK------VLPLEKSQVVWEIPENRNDVPDLVL--PRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKS------------ALDREERPFVQLLVLA--KGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSG------PSKELLGKKFTIGIKANDKGQPALSSFTDVFVDI--VSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS---STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISI--KENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLV--VIAMATDLDTNSKLIYKVLN-EYYNIFKIDQSSGFIRFNQ----------VPNIEKLL---PSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYG--NKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLK-----------PSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSI--MTIQENNPLNHIVAMCRISSTEMKG----KWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRT-ILIDLIDQND-CPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTT--LTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSE----SQKESLHFLITNQNLNPFY-----AYFRVS-ESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEE---FILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSA----KYNTLTY--TLMECSDPY--LLVVEPLTGRVIVNAPLDREFSSTVNFVVHALD-----VESKKCSFKILINVLDINDNAPRFVH------TSIAPFLENAPH-GSVIGKIHAVDADSGINRKIVYRILD-ESKSSFSIDRDTGIMRVASLL-----DRERQPEHHLVIEASDCGKP-PKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXX---------------------XFLP---YVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIP-AFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVD 11165
              + R+TG I T   LDRE       + I +   +         I V + + D NDNAP F               P + + ++   E   + +K  ++ A D D E  N Q   ++       F++  +    GVL L L+I    DRE    +  L I   D G+P L  +  + + I I+D ND  P F +  Y   +         +LQ+   D D +   L    +N ++S   + F IDP TG + I+      + +   +V++     +   ET+  ++I   D   N+       L  + S  + E  +    V  + +  P +K  +++ +             V +N   G   L +             LDRE      L V+A  KG    +   ++ + +TD ND  P F  + Y   V          ++V A D D G N  + YS+    P  +   F ID  +G+IT +S       P  +L        + A D G P LSS   V V I  V+D  P+FD+S Y+V V E+      +  V A          + YTI  G  + L + +  +A  +     I + G+LD+E +  +   + ATD    LS +  + + + D+ND  P+F    Y  S+ E+   + +  S  ++    ++     F        +   +  FRI+ +TG I +   + L      +H   I     G       A + + I+D    PP F +  +N  +  +  +G++V  VIA + D+   S + Y + + +    F I+ +SG IR  +          + NI+  L   P  G  +  + V D               + ++ P F  +   +SV E+  + + +    A D D    G++ Y ++      +F +D+ +G L+L + LD E    H L V  +D G  +     T+L+ V D+NDN PV E+  Y V V  S          I+Q++A D D     R+ YR+V        A VD++T ++S               WI   + L     +   + YQ+     +         T        V V++    D    +P    S     I+EN     +V +   S  ++      ++SL+P      + + F++    G I  ++ +D E +  Y + VE R   +P+ + R  + I + D ND  P I D     + + E+ P G++V++ +A D+D+     I YS+ +    +    F ID   G + +   +D+EE  +  L V+ASD       T   L + V D+ND  P +T +  V    + E           VV  +S  +  ++    S +ES   L     LNP       A F +   SG +++   LD E +    +L+  A D    +  +     + I V DVND+AP  PQ P DL + E    G++I    A D D+      +Y  + Y   L E  +    L  ++ LTG + + APLD E       +V ALD      E  + S  + + +LD ND+AP FV        + + F+ +A   G V+  I AVD DSG N ++ Y I     +  F I+  TGI+ +   L     D E+    +L+I A D G+P PK +  N+ +++   +++PP+F+    +  + E+   G  ++ + A S     NA +SY++      + F ++   G +T   + D E    Y L V   D    S  +++ V  Q    +                            F P   Y  ++PEN+      I  V A D D G N+ L YS              T  ++ + F I+  +GE+    + DRE+   Y  Q+  +D G P +     N+TI +ED+NDN P F    +   +Q D
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRN---------IRVLVTVKDENDNAPTF---------------PQTSMHIEFP-ENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGY-SLLIEALDGGTPPL--RGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVN-------------VTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAET-PETHAQWFQIDPQTGLITTRSHIDCETEPVPQLT-------VVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGF-KHLTEFEVRSASGE-----ICIAGELDFERRSSYEFPVLATD-RGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVED---------------VNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINA----QIIQVNASDLDTGNNARITYRIVD-------AGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPL----DRETRDRYQLTVLATDN-------GTPAAHAKTRVIVRV---LDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP------INSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLV--FRVREDA-----ALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDRE-VQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENS--EPGVIHTVVASDLDEGPNADLIYSI-------------TGGNLGNKFSIDSSSGELSARPL-DREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQED 1964          

HSP 4 Score: 309.686 bits (792), Expect = 2.872e-83
Identity = 492/1943 (25.32%), Postives = 812/1943 (41.79%), Query Frame = 3
Query: 5772 LDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFA---SYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPK----FEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTI--LFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGK---FETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYIL---LSEQPKV-----EINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVT----VSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPE------DALKDFIVTTVKAISSTGH--TILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHS-TTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFS-PTNRAHMQVHIV--DENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNS--KLIYKVLNEY-YNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDF---THXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVI-GGFD-----------SEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGN--KHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPS---SSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYR-VDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKV-----------IQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKAG----HVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLIT-----NQNLNPFYAYFRV-SESGEVLLLHPLDAEK------ILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAP--VCP-----QIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTG-----RVIVNAPLDREFSSTVNFVVHALD---VESKKCSFKILINVLDINDNAPRFVHTSI-APFLENAPHGSVIGKIHAVDADSGINRKIVYRI-LDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPK------------------SN-----ITNVKIVLLDVNDSPPQF-INIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQ--NFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYP-SLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKT-NVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKK 11201
            LDRE         + +++ DG        ++V I I DVNDN P F    +    + E+A  G+ V               L + A D D  +NG +EY I  R +     F+ID  TG + +   +D E      +L +  +D G   L +   + I +   D ND  P     F  D     +     P   + ++ VHDPD       +   LNG +  F ++      + +    +P+  +  S   +++ A D        S +I +   D   N   P E  Q ++    N  +V D      +     +   +   L   L+E P+      +I+  TG +  +S +D E  P  QL V+A+  DG    ++ T    V++ D ND +P+F    Y   V  N       ++V A D D G N  V Y+I   + F +  +F + S SG I I +G         +   + A D+G  + ++   + +  V+D  P+F   +Y V + E       A    IV  V      G+   + Y I  GN+  +F +D +      G   +     L   T+P H L ISATD  +  S++   V ++++D     PIF K+ Y+  V E++P    + S+      V++   V +S+      S     +F I   +G I I + LD EA    +  +L+        P    H QV+I   D NDN P+F       ++   +  G+ +  A A D D+ S  ++ Y ++ E    +F ID  SG +  +Q  + E    SS      V   D    + S    + V+   + ++PP F  +E+ ++VSE+ ++N++I ++ ASD D     R+ Y ++  G D           S+ FG+   +G + L+  LDRE +  ++L V+ +D G    H    V++ V D NDN P  +++ YE  +  + +  G+ +  +    A D D+     + Y L+  P++ S   V  +TG +S +               +   E+Y +  +  ++        T V S  + V + ++ + D           +++++E  P    V   R    +     S+  S       D    F ID   G IR + ++D E +S YR+ V      N P    R + ++++D ND  P F +S     + ED  LG  V           +   + ++ +E   V  Y+L  L       +F ID   G +     +D E      L + A D         +  T+ I V DVND  P W ++P +D ++++E     +     +++  +A D D+ +  +  + LI      N++     + FR+ S +G + L  PLD E       I++ L      ++RL  S     + +R++D NDHAP  V P     +   L I +    G V+  + A D DS      LTY +   +      +   TG     + +  A  D E     N ++ A D    E KK S  + + V   ++N PRF+     A  LEN P GS + ++ A       N  + Y I    +   F +D   GI+      DRE Q  + L +   D  +                     SN     +  + I + DVND+ P+F       L V E++E G V+ T+ A   D G NA++ Y +      N F ++S SG L+  + LD E    Y L ++ASD+G P S      + I V D NDN P+F    Y  ++ E+  +    + +++A D+D G+N+ L YS      E +W            F I+ ++G I      DRE Q +Y F V  TD G     S T  V I + D NDN P F +  + ++ QV  + I P Q L K
Sbjct:  244 LDRETTP---GYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIF-NQSRYFATVPENATVGTSV---------------LQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFET-KELHELVVVAKDHGEQPLETTAFVSIRVT--DVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHF-ALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDN---PPEFEQDLYHA--NVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVAR--DGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIG--EGFKHLTEFEVRSASGEICI-AGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRST-----GEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIY-----SGDPDGYFSIETNSGNIRIAKPLDHEA----KSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYE----SSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRR-GSVVGVVT---ASDLDLGENAAIRYSLL--PINSSFQ-VHPVTGEISTREPL-----------DRELRELYDLVVEARDQ-------GTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVT-YTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDP-ID-LQVSEATPVGT-----IIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTS---VTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDS-GDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVV-QISAVDADLGVNARLVYSLAN---ETQWQ-----------FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFER--YPYIGQVP-ALIQPGQTLLK 2078          

HSP 5 Score: 301.982 bits (772), Expect = 5.908e-81
Identity = 475/2010 (23.63%), Postives = 797/2010 (39.65%), Query Frame = 3
Query: 5307 TLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQR-SLTAIRNR-LLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHEN----TSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFA-SYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDL--NPTILFSILNGKE------------SRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDG---KFETSCNITINSFDNTRNKVLPLEKSQVVWEIPEN--RNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKSALDREERPFVQLLVLAK--GWDGSYDYINVTVSVTDENDYKPMFLSEKYEFL-VHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIV--SDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTI----------------LYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSS---LSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSL----KLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVK-YDGRFSPTNRAHMQV----HIVDENDNPPKFIQPAFNAT------ISLESSQGSLVVIAMATDLDT--NSKLIYKVLN-EYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVE----FQVLVHDFTHXXXXXXXXX------XXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDY-------------------------GNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMT--IQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINV------EYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSET------FPRVVYRLSAKDND-------------SESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHW----------------------SKEEFILN------IRVI----------------------DVNDHAPVCPQIPDLM-IFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEP-LTGRVIVNAPLDREFSSTVNFVVHALD--VESKKCSFKILINVLDINDNAPRFVHTSIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESK------SSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFIN---------IPIKLRVAEDTEIGKVLITIKAI-SDDIGVNAEVSYQMITEQNFFRLESLSGNLTL-IKKLDFELSR--EYFLTVRASDKGYPSLSTTT 10724
            T + ++ ATD DYG  GQ+ + I   + A   F +D++ G+I V R  + ++R + +  L I  +D G       +VV + I D       P  E+++ +  V E+    T V S++      +        +Y + S  P     F +  ++G I     LD E    ++   + +Q+  G    Y     V I + DVNDNAP F   + +   + ESA  G+ ++                 +A D D G +GQ+ Y ++       F ID  +G L L+  +D E       L +   D G P L +   L I++ ++D ND PP FEKD Y   +      +A ++Q+   D D   N  I + I++               S+ F I P +GW+ +     P+  +      + + A D           + +   D   N     +KS+  + I EN  R  V  +V   A      ++ +I+Y LL      +++ +TG +  +  LDRE R    L+V A+  G       + V + V+D ND  P     + + + V        + +RV+A+D D G+N ++ YSI   +       F+ID  SGVI  +     E     + +G+ A+D G P   +   + V+++  +D  P F  S     V EDA    +V ++  I      +                L  +T    E  FD+D  +  L     V RL   LD E +    L I A D ++S    S + TV I V D+ND  P + +      VSE  P+   I + +        +  +++ L      + +S   +   FR++  TG +S++  LDFEA  + E+ ++V+  D   + T R    V     I+D ND+ P F+ P  +        IS  +  G +V   +A D D+  N +L Y++        F+I+  +G I       ++ L P++  VE    F +++    H        +           N+PP F+   +  ++ EN    S + ++ A      +   L Y +  G  +++F +D   G +  +   DRE ++ + L V V D                          G   D AT+ I V D+NDN P           +      G     I  + A D D  P   + Y +    L    + +DS +G +S +P    Q+S             Y +  Q  +      R       C+I + V+     D+    P    S  T  +QE+ PL   V        ++     LV S +  + Q  F ID   G I     +D E Q+ Y   V       Y V +    AT  + I+++D ND  PIF+   Y   +   I  G  +++ +A D D      I YSL   +S      FRI+   G + +  ++  E  KL++L V A DK                         NPP   + + E   G +        F    YR+  K+N              S+ +++ + F     N +   +   +S    V   H LD ++   P          LH+                      +   F L       IRV+                      D ND++P   Q   +  + EG   G+ +  + A+D D+ +    L Y +++ +     V+EP  +G V  N  LDRE        + A D  V     +  I + ++D+NDN P F   ++    E    G+VI  I A D D+     + YR+  ES       S F++DR +G + +   LD E Q E+ L + ASD     ++ +T   + + D ND+ P F+          +P    ++E   +   L+T+ A  +D  G N++V Y +   Q  F +   +G +++ + +L   +S   +YF+ + A D G P+L ++T
Sbjct:  737 TPIVAVVATDPDYGNFGQVSYRIVAGNEA-GIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAM--QRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSP---VRYSIYSGDPD--GYFSIETNSGNIRIAKPLDHEAKSQVL---LNIQATLGEPPVYGHT-QVNIEVEDVNDNAPEFEASM-VRISVPESAELGAPLY---------------AAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHT-LIVTATDGGVPSLSTN--LTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRA---PLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDP-KFQKSKYEFRIEENLRRGSVVGVVT--ASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEER-SIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNL----VVARL---LDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEA--VQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIEL-----VKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV----IHTVVASDLDEGPNADLIYSITGGNLGNKFS-IDSSSGELSARPLDREQHSR------------YTLQIQASDRGQPKSRQG----HCNITIFVE-----DQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLA-NETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRS----ATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSA-VSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKG------------------------NPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNAR-LRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLT---VRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSST 2632          

HSP 6 Score: 260.381 bits (664), Expect = 2.463e-68
Identity = 332/1286 (25.82%), Postives = 567/1286 (44.09%), Query Frame = 3
Query: 8169 PSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDS-------LTGALLLKKTLDRERKSMHELRVVVSDYGNK--HDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAF-VDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSS-SPFDVQNDFEIDSNYGYIRAKKI-MDFETQSQYRINVEYRVDNSP-LMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVS-FRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTI--SVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPV-CPQIPDLMIFEGITPGSV-----ITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVES-------KKCSFKILINVLDINDNAPRFVHTSIAPFL-ENAPHGSVIGKIHAVDADSGINRKIVYRILD-ESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITE--QNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVD-RSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAE--TVSPFLVKTDELTDECILLVAGSLYLGVRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLD---SGMYSLNVKVT---NVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKPNIFFARRLDLKLIHFLKSV 11897
            P+F     H+   EN     +   + A D D   +   RY+++ G  ++ F L S       L   L +   LDRE    + L +   D G      F TV I + D+NDN P+  Q+ Y  TV        T   S+LQ++A D D      ++Y +      +   F +D  TGA+     +IN+  +     TK   E+  +A    E+PL +    +  ++   +    IN+++     +P I+ S             VA   +   + K +++ V  + +  D         N  Y+    + +D E  S Y ++V      +P L A+++I + + D ND PP F+   Y   + E    G+ V+Q  A+D+D      + YSL +  + ET    F+ID Q G + + S +D E   +  L V A D      ++T T+  +++DVND  P + ++     + + E     +E   R + ++SA D D       +++ I  +       +   S SGE+ +   LD E+     +   LA+DR   S    I  +++ DVND+ PV  P+   + + E     S      I  + A D D    +  ++Y ++  ++  +  ++  TG + V  P   +  S     +H L++ +             + ++++D     P F       ++ E+ P G+V+G + A   D      + Y I   +    FSI+ ++G +R+A  LD E + +  L I+A+  G+PP    T V I + DVND+ P+F    +++ V E  E+G  L    A   D G + +V+Y ++ E  +  F +++ SG+L L + LD+E S+ + L V A+D G PSLST   +++ V DVNDN P F    Y  N+ E+  ++   I +V A D D+G N+ +TY  +    +   N+ S+ +  +HF  I P +G I+L    DRE +  Y+  V  TD+G PA  +KT V + + D NDN P+F +  + F I+ + R G +       + D+ E     I+    P NS+ FQ   +  E  T  P   +  EL D                L V+  D G P    RV V ++V  +++  PEI       V    E   G E+   R + RD       +T+  V     +    +  F ID  +G I T  +LD     +Y L V  +   N    T +++ ++++ L  +        + +    ++ F  R D  L H + S+
Sbjct:  172 PTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATV----PENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAI-----YINKALDF---ETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQP-------GEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAE--TPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQS--FYNVSVAE-----NEPVGRCILKVSASDPDC-GVNAMVNYTI-GEGFKHLTEFEVRSASGEICIAGELDFER-RSSYEFPVLATDRGGLSTTAMI-KMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDY-GNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRP---DMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQII-QVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHF-GIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGE--NAAIRYSLLPINSS-FQVHPVTGEISTREPLDRELRELYD----------------LVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNAS-ITYSIVKG---RDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDN--------RPTFTSSSLVFRVREDAALGHVVGSI 1387          

HSP 7 Score: 234.187 bits (596), Expect = 1.929e-60
Identity = 511/2144 (23.83%), Postives = 833/2144 (38.85%), Query Frame = 3
Query: 5304 GTLLTSISATDQDYGRNGQLVFAI-KNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNS-ILHCXXXXXXXXXXXXAQYVVL-SIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYD--GLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEY-VILSRFASYFKIDQYTGVLSLALKIDREVVGS--FVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRV---HDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITIN-SFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQH-------PSIKYILLSEQPK--VEINEITGSLKLKSALDREERPFVQLLVLA--KGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIY---------YVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIV--SDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS---STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSL-SHSTTVLITVLDINDELP-IFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHM-QVHIVDENDNPPKFIQPAF----NATISLESSQGSLVVIAMATDLDTNS-KLIYKVLNEYYNI-----------FKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIK-------NHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDS---------EIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNK-----HDFATVLIHVTDINDNIP--VIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSIN------VTVKINILYDKKKVNP---IITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSS-PFDVQND-FEIDSNYGYIRAKKIMDFETQSQYRINVEYR------------------------VDNSPLMATRTILIDLIDQNDCPPIFD-NSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSAVDYEETKLINLVVSASDKA------GHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFP--RVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASD--RLHWSKEEFILNIRVIDVNDHAPVCPQIPDL-MIFEGITPGSVITTLQAYDRDSSAKYNTLTYTL--MECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVL--DINDNAP--RFVHTSIAPFL-ENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSS-FSIDRDTGIMRV--ASLLDRER-------------------------------------------------QP-EHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMI--TEQNFFRLE-SLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHF--FRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEF--AQPSFRFLI 11156
            GT +  + A D+D G N  L +++ +       +F++D   G I  +  +      +  LT+V  D G PP  + + V V I D  ++ + P  ++S  ++ V EN  V   IL          +     Y +    K  T   F V  ++G I     LD E+     S +  V + D  GL    ++   +K+ + DVNDN P F  P +    + ES    S           + S   + + A DPD G  GQ+ Y ++    A  F+ID+ TG +   ++ D   V +     L+I   D G+  L S     + + I D    PP FEK  Y    +    P   ++   +    D      + +SI +G    +FSI+  +G ++I+    P+  +  S VL+NI+A  G+     +  +N   ++  +     E S V   +PE+     +L  P    Y +H H         + Y L+ E  K    I+  +G L L   LD E      L+V A   G       + + V V D ND  P+F  ++Y   V  + S  AQ I+V A DLD G N  + Y I           +        F I  NSG I +++   +E    ++ + + A D G PA  + T V V ++  +D  P F KSKY   + E+  +  +V  V A          I Y++   N         ++  + P    I     LD E +  + L++ A D  + + S    V I V D+ND  P I        SV E  P   E++ +  + +    +  + +S+    DS       F I+ T+G I  +  LD E   I+   +    DG   P     M +V ++D NDN P F   +         +L    GS+  I    D+  NS +  ++ L   Y +           F ID+ SG    N V  + +LL      EF++ +     +   N   + +++K       ++ P +  +   + VSE   V + I    A+D+D    G L+Y +I  F            +F +DSLTGAL L+  LD E    + L V   D  +          TV + + D ND+ P  V   +    T  L         E +  + A D D     ++ Y                ITG         N      +N+    +E+ +      E+     R    + +           ++ ++++      NP   +      TI EN P    V   ++++  + G  +   S   P  V ND F +D   G I  +   D E+Q+ Y + V  R                          N       TI I + D ND  P F   S Y + + E+   G  VI         EG +     +Y +     G  F ID      S   +D E+     L + ASD+       GH     +TI V D ND  P +         ++++      E  P    V ++SA D D       ++ L         + +    +SG +  +  LD E +        LA+D  R         + I V+D+ND+ P+  + P +  +   I PG  +  +QA D D  A    + Y+L     +      + P TG +  +  L  E    ++  V A D  +   S   LI +L  +     P  RF + +    L EN+P G+ + ++ A+ +D G  +K+ +     ++    S+D  +G +RV    LLD +R                                                 QP E  +V+ A     P  ++   + I L D ND+ P+F        V+E    G  +  + A   D G NA + Y ++     N F +E + SG +     LD E+   Y L + A+D+G P ++ T  + +Q+VDVNDN P           P N LV+     ++ A  +    N + TY  L +    +    ST++ IE+   F ++  +G++ L    D E Q  Y+  V  +D    A  ++T +T+ + D+NDN P F   QP   F I
Sbjct:  520 GTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHD--VNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLT--EFEVRSASGEICIAGELDFERRS---SYEFPVLATDRGGL----STTAMIKMQLTDVNDNRPVFY-PREYKVSLRESPKASS----------QASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEI-FVVRPDMLSVRTQPMHMLNISATDGGN--LRSNADAVVFLSIIDAMQRPPIFEKARY-NYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAK---PLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPES----AELGAP---LYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETR-DRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPIN---------SSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSD--GHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAAS-DGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSG----NLV--VARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYE---------------ITGG--------NGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFV--LQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG--VIHTVVASDLDEGPNADL--IYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHC---NITIFVEDQNDNAPRF---------KLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQ----WQFAIDGQSGLITTVGKLDRE-LQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAE-IVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQP---------TFPPNNLVTVSEATELGAVITSISANDVDTYPALTY----RLGAESTVD-IENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD---AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAI 2543          

HSP 8 Score: 219.935 bits (559), Expect = 3.475e-56
Identity = 486/2084 (23.32%), Postives = 836/2084 (40.12%), Query Frame = 3
Query: 5298 SIGTLLTSISATDQDYGRNGQLVFAIKNDSV-----------ALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXA-QYVVLSIKPSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVIL----SRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSI----------LNGKESRF------FSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNK-------VLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQH------------PSIKYILLSEQPKV-----------EINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDY-------INVTVSVTDENDYKPMFLSE-----KYEFLVHTNLSKEAQSI-RVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSG--PSKELL--GKKFTIGIKANDKGQPALSSFT---DVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGH---TILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPS--SSLSHST----------------------TVLITVLDINDELPIFLKSS-YSASVSENMP--INHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWIL-VKYDGRFSPTNR---AHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVV--IAMATDLDTNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXX----XIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEI---FGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIH--VTDINDNIPVIEQAYYEVTVILSTKS-TGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLK------------PSWINQNSNLGL---------------NNTKSKLEVYQIAFQVCEEPLYSYRI---ATTVISCSINVTVKINI-LYDKKKVNPIITCS--IMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNY-GYIRAKKIMDFETQSQYRINVEYRVDNSPLM-ATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSV--ETGVSFRIDD-QGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIP-YWTKNPPVDGI---EITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVL-----LLHPL--------------DAEK-ILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIV-NAPLDREFSSTVNFVV-----HA---LDVESKKCSFKILINVLDINDNAPRFVHTSI--APFLENAPHGSVIGKIHAVDAD--SGINRKIVYRILDES-KSSFSIDRDTGIMRVASLLDRERQPE-HHLVIEASDCG-KPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMI------TEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLP------YVFNIPEN-TLVSKLTIGKVTAYDSDSGLNSMLTYSF 10892
            SI   +  ++A+D D G N ++ + I +  V              +F +  N+G I ++  L         LT++ +D G P    ++ V V + D   + + P+ ++S+ +  + EN    S++  +           A +Y +L I  S    F V   TG I T   LDRE ++++   D+ V++ D      ++ + V+IH++DVNDNAP    P +    + E   PG+ V               + + A D D G+N  I Y I+    S     F ID  +GV+   + +D E   S   L +   D G+P   +   L + ++  D ND                PTF S+ L+  RV +      ++ SI           N  E  F      ++++P T  L  +  DI       S  L+  R  D + ++   + I + D T +         + +E + V    PE   D  DL +  A    +  H              ++Y L+   P++            ++ +TG+L L++ LD E     + L++ +  D S +        + V + + D ND+ P F+S      K   L  ++ ++  + +  + A+D D+G+NG + Y I        + +F I+S +G+I +     P+ E +  G +F + I A D GQP     +    + V    +  P F ++ Y   + E+      V  V A S  G     + Y I  G   +LF +D+     Q G  +I   G+ D E++  + L +   D +  S+LS S                       T+ ITV D+ND  P F   S Y  SV EN    + H +++    L +  N+ ++ +S+     +       F I+ ++G +S +  LD E    H  + L ++   R  P +R    ++ + + D+NDN P+F    +  ++  ++  G+ VV   A+  DL  N++L+Y + NE    F ID  SG I    V  +++ L +S    F VL  D     V + +V        I ++ P F    +   V         + ++ A D+D      + Y  +   +S +   F ++  TGAL   ++L  E   +  L VV  D GN    +  LI   + +     PV+        V+L   S +GT L  ++ L +  R    R ++ +   +      I  +DS++G + +             PS    +    L               N+T+S+  +   +F +        R+   A T  +  +    ++ I L D+   +P  +    + T+ E N     VA      ++      L       +  N F I+  + G +R   ++D E +  Y++ +    +  P M  T TI + ++D ND  P F  +   + +SE   LG+ +    A D D      + Y L    +V  E    F +D   G +     +DYE  +   L V ASD A H   T LT+ V D ND  P +  + PP        I+E  +  S  F   +  ++A D DSE     + ++I      P    F V  S  V+      L P               DA K  LK   L  + ++     + +F+ N     +++ AP+               GSV+  L           + L  +L   +       E L  + IV   PLDRE +      +     H    +   +      ++I +LD NDN P F  ++   A   E AP    I ++ A+DAD  +  N ++VY I   + +  F+ID  TG++ V + LD +   + + L+I A D   + P  ++   ++ L D ND+ P+F        +AE+  +G  +    A   D G   +++Y +       +    FR++S SG +T     D+E  + Y + + ASD G        G    V    +   +  F P      Y F +P    L     +G+VTA DSDSG +  + Y  
Sbjct: 1050 SINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDA--NDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS----FQVHPVTGEISTREPLDRE-LREL--YDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEV---------------VRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEER-SIYRLGVAASDGGNPPRETVRMLRVEVL--DLNDN--------------RPTFTSSSLV-FRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDI----DRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEA--VQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGN---GEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDW-----QRG--IITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASD--LDEGPNADLI-YSI-----TGGNLGNKFSIDSSSGELSARP-LDREQ---HSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLI--TTVGKLDRELQAS--YNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYS-LNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGR----RQKVQFSFGAGN-EDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD-AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFD--LLTVNATDADSEGNNSKVIYII-----EPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPL---------------GSVVLQL---------GQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG--------GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL 3010          

HSP 9 Score: 162.54 bits (410), Expect = 9.745e-39
Identity = 358/1591 (22.50%), Postives = 637/1591 (40.04%), Query Frame = 3
Query: 4977 LFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRA-------TYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAI-----RNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTG---KLFGVTRSTGCIITVSSLDREQ---------IQD------IVSMDIQVQ-SYDGLVSRYNS----IISVKIHIADVNDNAPRFLGPLKLNGI-ISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVIL-SRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDL--NPTILFSILNGKESRFFSIDPTTGWL-KISTNDIPVSGKFPSVVLINIRAFD-GKFE---TSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSE----QPKVEINEITGSLKLKSALDREERPFVQLLVLAKGW----DGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQ----------SGPSKELLGK-----------------------------------------KFTIGIKANDKGQPALSSFTDVFVDI--VSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHT---ILYTITNGNDEELFDLDFTAAYLQPG-PCVIRLVGKLDYETKPFHTLIISATDPS-SSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQ---PAFNATI-SLESSQGSLVV-----IAMATDLDT---NSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPS---FVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSD-YG-------NKHDFATVLIHVTDINDNIPVIEQ-AYYEVTVILSTKSTGTTLESILQLHAKDRDV--SPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVC----EEPLYSYRIATTVISCSINVTVKINILYDKKKVNPI--ITCSIMTIQENNPLNHIVAMCRISSTEMKG-----KWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNS--RYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSL 9302
            LF ++S  G L L +P +  + Q + +IV+A ++ +       T + +++ ILD N+  P F VS   S     +L                                +I   + IG ++  I A D+D G NGQL + I   +     F ++   G I + +SL        +     L I   D GQ P   +S + + +  +   ++ P+  ++     + EN    S +    L+ + K L  A+   LS +   G    LF V    G I T    DRE          ++D      + S  ++ Q S D +    N     + ++ I + DVNDN+P F  P    G+ + E++ PG +                  + A D DEG N  + Y I      + F ID  +G LS A  +DRE    +  L I+  D+G PK   Q    I I +ED+ND  P+F+   Y   +         ++Q+   D DL  N  +++S+ N  + + F+ID  +G +  +   D  +   +  +VL    A D G++E    +  + IN  D   N+ +  E+   + ++P        L+  +A       +  I Y L +E      K  IN  TG+L    +L  E    + L V+A+        S   I + +    +      F +E Y  ++  N     + ++V A+  D G    V +S         D   ++DS SG I +           S PS   L +                                         +  + + A     P L+S+ ++ +++   +D SP F + ++   V E   K   V  V A  S   +   + Y I +GN +  F        ++P    ++R    LD E +  + L I ATD     ++ + T+ + ++D+ND  P F  ++   +VSE   +   I SIS     V     + + L         +   F ++  +G + +K  LD+E    +E  ++       +   R  + V + DENDN P F+    PA+ A + ++     SL V        ATD D+   NSK+IY ++      F +  S+G +  N +  ++  + SSG    +++  D     + + ++  V   ++      F+ N++   +SE   + S + ++     D++        +I G +   F L   + A++L K LDRER  +++LR+V+S  +G       N     +V+I + D NDN P+ ++ A YE  +            SI QL A D D   +P   + Y + S    + +  +D +TG +     ++N   +       S  + Y++  + C    + PL           CS+    ++  L+D+    P   +T  +  + EN P+   V     S  + KG      +S+ P+ S       F +DS  G + +  + D+E + +Y + +    D     A+  + +++  +++  P F     R+ +  +  +P G  V Q  A D D      + Y L
Sbjct: 1541 LFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHF-VSPNSSGGKTASL--------------------------------FISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGN-GEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQ-PEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFV----LQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFR-PGSCYGLSVPENSEPGVI----------------HTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYT-LQIQASDRGQPK-SRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ-FAIDGQSGLITTVGKLDRELQASYNFMVL----ATDGGRYEVRSATVPVQINVLDINDNRPI-FERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSF---GAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAF-------VIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISA--NDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEA---RTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIY-IIEPAQEGFSVHPSNGVVSVN-MSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQS------LAIIAGNEESAFELLQ-SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEI----SELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGN-DEHMFTIDLVTGVL-----FVNNRLDY-----DSGAKSYELIIRACDSHHQRPL-----------CSLQ-PFRLE-LHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLD-KGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMEL-LASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL 3010          

HSP 10 Score: 160.229 bits (404), Expect = 4.152e-38
Identity = 244/975 (25.03%), Postives = 392/975 (40.21%), Query Frame = 3
Query: 1521 LTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISR-TKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFV-YKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASV----SFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMA--LNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKIT--MKTADKDRDPYESEF-----VFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCD---QGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADS---KDIQYRLVNF-----------RRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDF-YNRSXXXXXXXXXXVADINDNKPIFTK------NSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDC-FHCDTSTGAVHLLCKLSPLTE-------YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPET-SDKEPQSFVYTI-SGHSNGISLFRIN-NEGEIRTVSSIDREKEESYWLYIYIEDRN----------------DEIINKI------LAEVYIKVTDENDNCP-MPERAFYKASVAENLQ-GIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSG 4223
            LT+    N +        + + V D N+  P    +     ++EN   G  V ++ A D D+     I Y L   N   F++      +   +E LD E ++  + + V   D G P+ RS      I ++DVN+  PE    +   +++  + P   ++    A  +DRD   N  I+ + V    S     FSI P SG +       H    + + + +G+ A+D G    +    L   V+D N                                       N+P F         T+   V  +RE++A G +V  I+   + AD  R+  E  F      + +    + ++ +    D HS ++VVA  LDRE   ++ + I   D      P++      +I+V D+NDN P +     I + + E   +   I    ATDAD+    D+QYRL+ +             +F++ S TG L L+  LD E    Y +++ A D        L  + T+ + + D ND+ P F         + SL + +   IG  +  + A D D  DN QL Y I G + +  F  ++ TG + L+  L P TE       + LI   KD+G+P+   S  +  +  Q  H N   P   + +  A I EN   G+ V  +  ++    E  +  Y I +G +N   LF ++   G I T    DRE + SY L +Y+ D N                D I +        +A +YI V D NDN P     + Y  SV EN + G+ H  TV A+D D     +L Y I  G+    F    +     S R +DRE           Y L++  SD G P+           ++         NDN   F     T  +       T+++  +++AVD D  +NA + Y++     AN    T   F++D +SG
Sbjct: 1121 LTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINS-SFQVHPVTGEIS-TREPLDRE-LRELYDLVVEARDQGTPV-RSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRA--VDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDH---EERSIYRLGVAASDGGNPPRETVRMLRVEVLDLND--------------------------------------NRPTF---------TSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAIT-VKIEVADVNDNAPEWPQD-PIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNP--PRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAN--DLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIH--TVVASDLDEGPNADLIYSITGGNLGNKF-SIDSSSGELSARPLDREQHSR-------YTLQIQASDRGQPKSRQGHCNITIFVEDQ-------NDNAPRFKLSKYTGSVQEDAPLGTSVV--QISAVDADLGVNARLVYSL-----AN---ETQWQFAIDGQSG 2006          

HSP 11 Score: 157.147 bits (396), Expect = 4.089e-37
Identity = 314/1380 (22.75%), Postives = 563/1380 (40.80%), Query Frame = 3
Query: 4926 PIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRA---TYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNS-ILHCXXXXXXXXXXXXAQYVVL---------SIKPS-TGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKF---EKDFYLQVLILPTFPSAPLLQLRVHDPD--LNPTILFSILNGKES---RFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGK---FETSCNITINSFDNTRNKVLPLEKSQVVWEIPENR--NDVPDLVLP--------RAKFYFSHQHPSIKYIL--LSE---QPKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYD----YINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLK------FAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSF-TDVFVDI----VSDKSPLF-----DKSKYSVIVPEDALK-DFIVTTVKAI---SSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKL-----DYETKPFHTLIISATD---PSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVL-LQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFS------------------PTNRAHMQVHIV-----DENDNPPKFIQPAFNATISL-ESSQGSLVVIAMATDLDT--NSKLIYKVL-NEYYNIFKIDQSSGFI-----------RFN-QVPNIEKLLPSS--GVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGN---KHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAF-VDSITGAVSLKPSWINQNSNL 8711
            P+ YSI  S DP      F I +N+G++R+  P +  +     + ++A         + ++ I + D N+  PEF  S                        M ++S+                  + +G  L +  A D+D G +GQ+ +++  +S     F +D  +G + + + L    ++   L +  +D G P       + V+++D  ++ + P  E+ +  + V E+ S+N+ I+        T       Y ++         SI  S   + FG+  ++G I   + LDRE         + V + D      ++   V + + D NDN P+F    K    I E+   GS+V                V+ A D D G+N  I Y +L    S F++   TG +S    +DRE+     DL +  +D+G+P  +   R+ + I + D ND  P+    ++D        P  P   ++++R  D D   N +I +SI+ G++S     FSIDPT+G ++     + +  +  S+  + + A DG     ET   + +   D   N+      S +V+ + E+     V   + P        R     S +   + Y L  L++   +   +I+  +G+L +   LDRE +   +L + A     S +     I V + V D ND  P +  +  +  V              A D D G NG + Y +    P   + +      F +DS +G +++Q+    E + +++ + ++A D+         T V V +     +D +P F        K + +   DA +   +V  + A+   S     + Y IT GN E  F ++           +I LV  L     D E      LII A D   P    S S  + + V   ++  P FL++ Y A++ EN+P    ++ ++   L    N+ +        E  +  ++  F ++   G I+ +   D E+   +   + V+   R S                   +N  H  V  +     D NDN P+F +P     +S+ E+S+  ++   +A+DLD   N+ LIY +      N F ID SSG +           R+  Q+   ++  P S  G     + V D                 ++ P F ++++  SV E+  + + + +I A D+D     RL Y +      + F +D  +G +     LDRE ++ +   V+ +D G    +     V I+V DINDN P+ E+  Y +  + +    G TL   L++ A D D+     + Y L +   + S  F ++  TGA+S   S  +++  L
Sbjct:  861 PVRYSI-YSGDP---DGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEAS------------------------MVRISVPE---------------SAELGAPLYAAHAHDKDSGSSGQVTYSLVKES-GKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQD--VNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRD---RYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKS-KYEFRIEENLRRGSVVG---------------VVTASDLDLGENAAIRYSLLP-INSSFQVHPVTGEISTREPLDRELR-ELYDLVVEARDQGTP--VRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQP--PGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTR---VVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPT-FTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAV-QEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTG-------IIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKS-SLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLS------YEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF-RPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVED---------------QNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ-FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPY-IGQVPALIQPGQTL---LKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKL 2129          

HSP 12 Score: 129.798 bits (325), Expect = 6.716e-29
Identity = 141/534 (26.40%), Postives = 241/534 (45.13%), Query Frame = 3
Query: 2421 HIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSK---DIQYRLV--NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI--HGIH-----------SDCFHCDTSTGAVHLLCKLSPLT--EYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSD-KEPQSFVYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPM---PERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISG---DTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVP 3941
            +++E+  +GT+V  +   + D     + S   + ++S +    FSI   +++S +I +A  LD E   +  + I     G+P      +  I+VED+NDN P F  S  + +++PE+ ++   +    A D DS     + Y LV  + + +F I +R+G L L  +LD E    + +++ A+D      SL+   T+ + V D+NDN P+F K+ YS+ + E   I + ++Q++A+D D  +N+++ Y I   G+            S  F    ++G ++L   L   T   Y+L  +  DNG P A    A  ++  + +  N   P  ++      I EN   G++V  +     D  E  +  Y++   ++   +  +   GEI T   +DRE  E Y L +   D+    +      V I V+D NDN P    P+      SV E       ++ V+A D D  +   + Y I+ G   D  G FSI  T  +  +   +D E           Y L V  SD G P
Sbjct:  835 YVKEDIPRGTVVGSVIAASGDV---AHRSPVRYSIYSGDPDGYFSI---ETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASM-VRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGV--PSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAA---HAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVT--GEISTREPLDRELRELYDLVVEARDQGTP-VRSARVPVRIHVSDVNDNAPEIADPQEDV--VSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERS-------IYRLGVAASDGGNP 1343          

HSP 13 Score: 121.709 bits (304), Expect = 1.734e-26
Identity = 246/1002 (24.55%), Postives = 415/1002 (41.42%), Query Frame = 3
Query: 1497 DFGSPERNLTIAVAMNDSLET----KKTFTLRISVQDVNEFPPVVMNNGSV------ITVKENTEIGETVLIIQAYDPDIS-RTKISYYLFDQN-KLPFRLGEFKRNVVIVKENLDA-ETMQR--RFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLL--CTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRS-LSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGM-----RNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPK----NCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRR-VFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYN-RSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDC---FHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTI-SGHSNGI-SLFRINNEGEIR---------------TVSSIDREKEESYWL------------------------YIYIEDRNDEIINKILA------------EVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXX-XXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHL 4229
            DF + +  L I  A++ S       + + T+R+ + D N+  P  ++  S       + + + T IGE V  I A D D     +++Y +   N +  FR+      + +VK    A E +++  RF + +   D G P  +    +  + +   +   P F+    + TI    P    +    A+ L   G +N     A++S++ P        G  + L    ++ G+++    F    QA+          L   V DAN +S LS   ++            Q + DS  +  N        I+        N P F       + + E S  G I    T+  +D D  P  ++ ++ +        FSI   DS S ++  A  LDRE   +Y + I   D+GQPK    +C    F   VED NDN PRF  S +   ++ E+  +   +VQI A DAD   +  + Y L N  +  F I  ++G +     LDRE +  Y  +++A+D   Y  RS T    +   V DINDN+PIF +  Y   +P  +  G  L+++ A DADL  N+++ Y+++  +S     F  + STGA+     L+  +     L  V +D G P   SS    ++   +      +   +       ++EN   GT +  +    SD   Q   ++  +G+ +GI SL  ++  GEIR               ++S++ R +   Y                          +     + +EI   ++A            E+ I++ DENDN P   +  + A+V+E       +  V A D+D      L+Y I+ G+    F I      I  +   +DRE         D Y LK++ +D GVP+   T  I V I+DVNDN P+F  +N+   +   +TEL           +I  ++A D+D     T R   +    + ++   + +F++D  SG L
Sbjct: 1558 DFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLH--GAEN-----ANLSYEIPA-------GVANDLFHVDWQRGIITTRGQFDRESQAS--------YVLPVYVRDANRQSTLSSSAVR-----------KQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVI---HTVVASDLDEGP-NADLIYSITGGNLGNKFSI---DSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIF---VEDQNDNAPRFKLS-KYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQIN--VLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQ-SSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLS--GEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDRE-------IRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSE--ATEL---------GAVITSISANDVDTYPALTYRLGAE----STVDIENMSIFALDRYSGKL 2487          

HSP 14 Score: 114.775 bits (286), Expect = 2.389e-24
Identity = 183/803 (22.79%), Postives = 320/803 (39.85%), Query Frame = 3
Query: 1575 LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYD--PDISRTKISYYLFDQNKLPFRLGEFKRNVV-------------IVKENLDAETMQR-RFFIRVL-VTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISI--------ASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQAND-SGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESA-KGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQP---KNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATD---ADSKDIQYRLVN--FRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDV---------------------DFYNRSXXXXXXXXXXVADINDNKPIFTKNS-YSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIH-SDCFHCDTSTGAVHLLCKLSPL-----TEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQS-FVYTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKI 3788
            LR+ V D+N+  P   ++  V  V+E+  +G  V  I   +   D+ R  +    F+  ++ + L    ++++             +V   LD E     R  IR L  T S  P + ++    +IE+ADVN+  PE+      + +S   P    I +F A D D     ++Q  +         S       F +   +G LSL           +  + + +QA D S  V+ ++  + +V             +L  +  + + PH  +       PN+       +F + +       +  ++ + E+S   G +  +IT           E  F     +   ++V S+                D E   ++++ I   D GQP   K+ +     + V+  ++NPPRFL +     T+ EN      ++Q+ A     A++ ++ Y +       +F +  + G +  R   DRE +  Y + +   D                      D  N      AT+ I V D+NDN P F   S Y L++PE+   G  +  + A+D D   N+ L Y+I G +  + F  D+S+G +       PL     + Y L     D G+P++     +  I+ +  + N   P  K    T +++E+   GT V  I    +D    +  VY+++  +     F I+ + G I TV  +DRE + SY   +   D     +      V I V D NDN P+ ER  Y   V   +Q    L+ V+A DAD+    E+ Y +
Sbjct: 1351 LRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEES-FEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITV--KIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLD---FEAVQEYLLIVQALDQSSNVTERLQTSVTV-------------RLRILDANDHAPHFVS-------PNSSGGKTASLF-ISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNG-------EGRFRINSQTGIIELVKSLPPATE-----------DVEKGGRFNLIIGAKDHGQPEPKKSSL--NLHLIVQGSHNNPPRFLQAV-YRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL----SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDN--APRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQW--QFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSL 2096          

HSP 15 Score: 113.62 bits (283), Expect = 4.951e-24
Identity = 163/689 (23.66%), Postives = 282/689 (40.93%), Query Frame = 3
Query: 2409 PSVIHIREESAKGTIVQKITMKTADKDRDP---YESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFE------IQVEDINDNPPRFLD-----SFQIPMTLPENYDIKKRIVQIKATDADSKD---IQYRLV--NFRRVFKIHSRTGWLRLRVNL-----DREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI-HGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQ--------------------IYPQKVHPNRYIPSLKEPIITA-AIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAP 4331
            P  + + E +  GTI+   T   AD   +    Y     F   +E ++   S+ R DS +  + +   LD E V +Y + +   DQ    + + +R +      +++ D ND+ P F+           + + +   I + +  I A D DS D   + Y +   N    F+I+S+TG + L  +L     D EK   + ++I A D         ++  L +IV   ++N P F +  Y   + E++P GSF++Q+ A      +N+ L Y I  G+ +D FH D   G +    +    ++  Y L   V+D  +   LSS A  +                    IY      N   P  +       ++ EN  PG + T +  +  +      +Y+I+G + G      ++ GE+ +   +DRE+   Y L I   DR      +    + I V D+NDN P  + + Y  SV E+      ++ + A DAD+     L Y + +   W  F+I     + T+   +DRE   S       Y+  V+ +D G  E  +        +         INDN  +F RY     +         +L  +V A+D D   NA + Y++        N++    F ++  +G L A+ S +    S++G +      + V A D G P
Sbjct: 1489 PIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQ---SSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKD-HGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQW-QFAIDGQSGLITTVGKLDRELQAS-------YNFMVLATDGGRYEVRSATVPVQINVLD-------INDNRPIFERYPYIGQVPALIQPGQTLL--KVQALDADLGANAEIVYSLNAE-----NSAVSAKFRINPSTGALSASQSLA----SESGKL----LHLEVVARDKGNP 2142          

HSP 16 Score: 113.235 bits (282), Expect = 8.048e-24
Identity = 195/744 (26.21%), Postives = 338/744 (45.43%), Query Frame = 3
Query: 9081 QYRINVEYRVDNSPLMATRT-ILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDD--QGWVYSVSAVDYEETKLINLVVSASDKA-GHVTNT-TLTISVYDVNDEIPYWTKNPPVD-------GIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPV--CPQIPDLM--------IFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVN-APLDREFSSTVNFVVHALDVESKKCSFK--ILINVLDINDNA---PRFVHTSI-APFLENAPHGSVIGKIH--AVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPP------KSNITNVKIVLLDVNDSPPQFINIPIKLRVAE-DTEIGKV------LITIKAISDDI--GVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFEL-SREYFLTVRASDKGYPS-LSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLP--EQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLI 11156
            + R+ +  R  ++P +A+   ++I+L D+ND  P F   ++   +SE    G+ V Q  A+D D      + Y +   +      +F I+    G V +   +D E   +  L + A+D+    +T T T+ + + DVND  P +  N  V        G  IT       +T+P + YRL A+              +  +N++  +A  R   SG+++L   LD E + +  +L  +ASD  H ++   +L +RV D ND+APV    Q P           I E ++    + T+ A D DS    + + Y +    + +   V P  G V VN + L    SS+ ++ V  +  ++ K + K   L+ V   NDN     +F+     A   E AP GSV+ ++   A+D    I       I    +S+F + +   I+ V   LDRER   + L +  S    PP       S+  +V I +LD ND      N PI  R A+ + EI ++      +  ++AI  D     N+EV Y + +  +++ F ++ ++G L +  +LD++  ++ Y L +RA D  +   L +     +++ D NDN P+FP   YV  + EN  V   ++ +  A D D G    L YS +   P  E  W            FR++ ++G +   FV D E++  Y  ++  +D G     +   V +EIE +++  P+F + ++RF++
Sbjct: 2287 EIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDN---AFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAEST------------VDIENMS-IFALDRY--SGKLVLKRRLDYE-LQQEYELDVIASDAAHEART--VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGF--SVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRV-QANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAI-------IAGNEESAFELLQSKAIVLVKP-LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDAND------NFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGS-SVFRAHASDLDKGPFGQLNYS-IGPAPSDESSWK----------MFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG--GKKASVAVRVEIESRDEFTPQFTERTYRFVL 2978          

HSP 17 Score: 110.153 bits (274), Expect = 5.810e-23
Identity = 153/561 (27.27%), Postives = 256/561 (45.63%), Query Frame = 3
Query: 2568 DSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPEN--YDIKKRIVQIKATDADSKDIQ-YRLV--NFRRVFKIHS---RTGWLRLRVN----LDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSD---CFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPII----TAAIRENCLPGTLVT--SIRPETSDKEPQSFVYTISGHSNGISLFRINNEGEIRTVS-SIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKII----SGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGR----VTAVDIDYDLNATVRYTM 4154
            D  + +I    +LDRET   Y + +A+   G  +N    R  + V+D NDN P F  +  + +  PEN   ++K+ ++  +  D +  + Q Y +V  N    F++ S   R G L L +     LDRE    Y ++I A  +D     L    T+ I + D+NDN+PIF ++ Y   +PE+  +G+ ++Q++A+D D D+N  + YAI+   SD    F  D  TGA+++   L   T+  + L+ V KD+G+ Q L + A   I    V+ N+  P++    +    +  I E+  PG  V   S+    S  E  +   T++G     +L   +N   +  V   +DRE   +Y L +   D+    ++   + +++++TD NDN P  E+  Y A+V E       ++ V A D D    + L Y +     +   W      +    + S    + EP+           L V+  D GVP   +T  + V I D        +NDN  +F++        Y+     N  +GR    V+A D D  +NA V YT+
Sbjct:  126 DRATGEIRTKVKLDRETRASYSL-VAIPLSG--RNI---RVLVTVKDENDNAPTFPQT-SMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEA--LDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGE-QPLETTAFVSIRVTDVNDNQ--PTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKS-IFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQ---------LTVVARDGGVPPLSSTATVLVTIHD--------VNDNEPIFDQSF------YNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTI 650          

HSP 18 Score: 109.383 bits (272), Expect = 9.366e-23
Identity = 186/774 (24.03%), Postives = 321/774 (41.47%), Query Frame = 3
Query: 6231 EIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDL--NPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDG---KFETSCNITINSFD-NTRNKVLPLEKSQVVWEIPE--------NRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEI--------TGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINV-TVSVTDENDYKPMFLSEK----YEFL-----VHTNLSKEAQSIRVKAIDLDA-GENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSG---PSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKS--PLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTIL---YTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSS-------SLSHSTTVLITVLDINDELPIFLKSS-YSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQH-FRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSP--TNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVL-----NEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNH-PPSFVMNEFHMSVSENFTVNSE--IGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTL 8366
            E++I +EDEND  PKF +  ++  +         + Q+   D D   N  + + I++G     F I+P   +  I   +I +  +   +  + I A D    +   +  I +   D N      P      V E  E        + NDV               +P++ Y L +E   V+I  +        +G L LK  LD E +   +L V+A   D +++   V TV V DEND  P+FL+++    +  L     +  +LS +   + V A D D+ G N  VIY I   +       F++  ++GV+++      P+    G  F + I A D G+PAL S T + V    + S    F +++Y   + E A    +V  +      G   L     I  GN+E  F+L  + A        I LV  LD E    + L +  + P         + S   +V+IT+LD ND  PIF +S+ Y A +SE  P+ + I  +  +     N+   E    ++ D +  + +H F I+  TG + +   LD+++       I+   D        +    ++ + DENDN PKF    +   ++     GS V  A A+DLD     +L Y +         + +F++D  SG +    V + E+        + ++L  D      +      +  ++   P F    +   +     +     +G++ A+DSD    GR+ Y +        F ++  +GA+L+K+ L
Sbjct: 2307 ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPA--FSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDV-------------DTYPALTYRLGAES-TVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIAS--DAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQE-----GFSVHPSNGVVSVNMSRLQPAVSSSGDYF-VRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL------GQDALDQSLAIIAGNEESAFELLQSKA--------IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSE----VVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQ----RQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH--FKVNRSSGAVLIKRKL 3032          

HSP 19 Score: 103.605 bits (257), Expect = 5.352e-21
Identity = 116/443 (26.19%), Postives = 207/443 (46.73%), Query Frame = 3
Query: 2550 FSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLV----NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI-HGI-HSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNR-------YIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRIN-NEGEIRTVSS--IDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYF 3815
            F++   D+    ++V   LDRE V  Y +++   D+G P     K   +++ D+NDNPP F         + E  D    ++Q+ A D D   +  + Y L        + F+I  +TG +  R ++D E      + +VA D      S TAT  +T  + D+NDN+PIF ++ Y++++ E+ P+G  ++++ A+D D   N+ + Y I  G  H   F   +++G + +  +L     + Y    +  D G    LS+ A  ++    V+ NR       Y  SL+E    A+ + +  P   V +  P+  +    S+   ++G+  GI  FRI+ + GEI  V    +    +  + L I   D  + + +   A V++ + D     P+ E+A Y   V E++     + +V A   D+  ++ ++Y I SGD  GYF
Sbjct:  444 FALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVM-EVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVT--IHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG---GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRES-PKASSQASSTPIVAVVATDPDYGNFGQVSY-RIVAGNEAGI--FRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN-LRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYF 875          

HSP 20 Score: 98.9821 bits (245), Expect = 1.415e-19
Identity = 262/1207 (21.71%), Postives = 469/1207 (38.86%), Query Frame = 3
Query: 1137 LKLRAIFSPISTPAISVTIEAKDLSLNPKTSSTHLTIPLGNLRNINLLSVPEFVSVSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXF---RWIPDLEGTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIAVAMNDS---LETKKTFTLRISVQDVNEFPPVV----MNNGSVITVKENTEIGETVLIIQAYDPDISRTKISYYLFDQNKLPFRLGEFKRN----VVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASV-SFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDS---TINHPNNYEESNKPIFGMR--NIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKR-------------IVQIKATDADSKD---IQYRLV--NFRRVFKIHSRTGWLRLRVNLDREKRDYYPI-VIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDC-FHCDTSTGAVHLLCKLSPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRIN-NEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKII------------SGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSE-NATDPKSENDKSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQI-----DDADGPFSV 4580
            L++       +TP  S+ IEA D    P      + I + ++ +   +        ++PENA V +SV  L+ + + ++ +    + +   R   D E  + ++  +              A DF + E +  + VA +     LET    ++R++  DVN+  P +    +++ +   + E+ + GE V  I  +DPD S+T+ +      N          R+    +VIV   LD E +   + + V+ TD G P   +  + + + I DVN+  PEF        +   A     +   +A D D      +  S+A         F I P+                             +GL++++     S +D  +  +     +L  V  D  VP  ++  +   TI+  N+    N+PIF     N+ + A N P              V +  +K +  D D   +  V     E  + +       S S +I +A  LD E    Y   +   D+G          ++Q+ D+NDN P F          P  Y +  R             IV + ATD D  +   + YR+V  N   +F+I   TG + + V  D       P+ ++  S  D  N    A A + + + D     PIF K  Y+  + ED+P G+ +  + A   D+   S +RY+I+    D  F  +T++G + +   L    + +++  ++       +       I  + V+ N   P  +  ++  ++ E+   G  + +      D      V       +G  LF I+   G +     +D E  + + L +   D     ++  L  + + V D NDN P+ E+  Y  +V+E+      +I V A+D D      + Y+I+            S D   +F I            +DRE         D Y L V+ +D+G P       + V ++D ND      ND  F  ++Y   E      L+  ++ +G VTA D+D   NA +RY++ P     +N+S    F V   +G +    +    D           + + V A D G P    R P    +R+++S+ N   P+         +A    D +++  ++  G+E++ +  VD+   +  S+   I      D  G FS+
Sbjct:  238 LQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSV--LQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYIN-------KALDFETKELHELVVVAKDHGEQPLETTAFVSIRVT--DVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPD-SKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSN-YTLSVVATDKGTPPLHASKSIF-LRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQ-----------------------------TGLITTR-----SHIDCETEPVP----QLTVVARDGGVPPLSSTATVLVTIHDVND----NEPIFDQSFYNVSV-AENEP--------------VGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEF-EVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAM--IKMQLTDVNDNRPVFY---------PREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFV-VRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDN--APEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLT-ILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRE-------TRDRYQLTVLATDNGTPAAHAKTRVIVRVLDAND------NDPKFQKSKY---EFRIEENLRRGSV-VGVVTASDLDLGENAAIRYSLLP-----INSS----FQVHPVTGEIS---TREPLDRELR-----ELYDLVVEARDQGTPVRSARVP----VRIHVSDVNDNAPE---------IADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSI 1310          

HSP 21 Score: 98.9821 bits (245), Expect = 1.427e-19
Identity = 178/783 (22.73%), Postives = 316/783 (40.36%), Query Frame = 3
Query: 8169 PSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLD-SLTGALLLKKTLDRERKSMHELRVVVSDYG--NKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESIL-QLHAKDRDVSPRHRMDYRLVSPPL----SQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKV----NP----IITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLV-----PSSSPFDVQ-NDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTIL-IDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSAVDYEETKLINLVVSASDKAG--------HVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKES-LHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHW----SKEEFILNIRVIDVNDHAPVCPQIPDLMIFEGITP-GSVITTLQAYDRDSSAKYNTLTYTLMEC----SDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTS---IAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASD 10385
            P F   +F  +VSE     + + ++ A DSD     RLRYH++ G     F ++ + +G +     LDRE + +++L+++ +D G       AT+ + + D+NDN P            L T S  T L +++  + A D D  P   + YRL +       + SI  +D  +G + LK     +         + + E+  IA     E       A TV+      TV++N   D   V     P     I  +I  I E+  ++  +     +  + +G  S V     P+   F V  ++  +  N   ++        +   Y + +  +    P + + T+L +   D       F  ++Y   ISE  PLGS V+Q         G+D +  SL  +   E   +F +     +  V  +D E   L  L +  S   G          +  ++ I++ D ND  P + ++   +  EI+E            + +L A D D E+   S + + IT+ N    +    V+  G + + + LD +   K  +L   A D  H     S + F L +   D ND+ P  P    +       P GS +    A D D    +  L Y++       S   +  V+  +G V      D E     +  + A D+  KK S  + + +   ++  P+F   +   + P     P G V+G++ A D+DSG + ++VY+ L    S F ++R +G + +   L  +   + +L ++  D
Sbjct: 2320 PKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNN------LVTVSEATELGAVITSISANDVDTYPA--LTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYE--------LQQEYELDVIASDAAHE-------ARTVL------TVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPA----VSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL--------GQDALDQSLAIIAGNEES-AFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEA-EISELA-----PLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVT--GVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELH--DENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDK-GPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQ-LSAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRD 3048          

HSP 22 Score: 93.9745 bits (232), Expect = 4.278e-18
Identity = 119/435 (27.36%), Postives = 192/435 (44.14%), Query Frame = 3
Query: 2604 LDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADS-KDIQYRL-------VNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKN---SYSLALP------EDLPIGSFLVQLHATDADLD-DNSQLRYAIHGIHSDCFHCDTSTGAVHL-LCKLSPLT----EYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRINNEGEIRTVSSIDREKEESYWLYIYIEDRND-----EIINKILAEVYIKVTDENDNCPMPER-AFYKASVAENLQGIHHLITVKATDADMNK--KTELKYKIISGDTWGYF 3815
            LDRE  D Y + I   D+G P+        +Q+ D+NDN P F  +  +  T+ E  ++   I  I A D D+   + YRL       +    +F +   +G L L+  LD E +  Y + ++ASD     R+      LT+ V D NDN P+F      +Y   LP      E L +   L+ ++ATDAD + +NS++ Y I     + F    S G V + + +L P      +Y +  + KD GKP AL S    ++        R      +    A I E    G++V  +  +  D+     +  I+G  N  S F +     I  V  +DRE+ + Y L + +   +       + +     V I + D NDN P+ +R A Y+A ++E     + +  ++A DAD      +E+ Y I SG+    F
Sbjct: 2386 LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV--TVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART-----VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQ-EGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKP-ALKSSTLLRVQANDNGSGRS--QFLQNQYRAQISEAAPLGSVVLQLGQDALDQS----LAIIAG--NEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMF 2803          

HSP 23 Score: 88.1965 bits (217), Expect = 2.424e-16
Identity = 147/589 (24.96%), Postives = 240/589 (40.75%), Query Frame = 3
Query: 1566 TFTLRISVQDVNE----FPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTKISYYLFDQNKLP------FRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQI---------TISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSV---VDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCD-QGQPKNCIFKRFE-----IQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSK-----DIQYRLV--NFRRVFKIHSRTGWLRLRVNLDREK-RDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSD-----CFHCDTSTGAV 3209
            T T+R+ + DVN+    FPP   NN  ++TV E TE+G  +  I A D D +   ++Y L  ++ +       F L  +   +V+ K  LD E +Q+ + + V+ +D+ A  AR+V+    + + D N+  P F+ +              IS     D  +    A D D +G ++  I I  +   Q  FS+HP +G +S+  +     +S   ++ + + A D+G    K AL  S    V AN    SGR   L                      N Y                         I E +  G++V ++     D+            + +  E+  F + ++ +    IV+   LDRE  D Y + + +    G P              I + D NDN P F  S +    + E   ++  I Q++A DAD +     ++ Y +   N   +F I   TG L +   LD +     Y ++I A D   + R L +     + + D NDN+P F    Y   L E+ P+GS + + HA+D D     QL Y+I    SD      F  D+ +G V
Sbjct: 2411 TATIRVQIVDVNDNQPTFPP---NN--LVTVSEATELGAVITSISANDVD-TYPALTYRLGAESTVDIENMSIFALDRYSGKLVL-KRRLDYE-LQQEYELDVIASDA-AHEARTVLT---VRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYI--IEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAG----KPALKSSTLLRVQANDNG-SGRSQFLQ---------------------NQYR----------------------AQISEAAPLGSVVLQLGQDALDQS---------LAIIAGNEESAFELLQSKA----IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACD-SHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLV 2923          

HSP 24 Score: 70.4774 bits (171), Expect = 5.661e-11
Identity = 159/697 (22.81%), Postives = 289/697 (41.46%), Query Frame = 3
Query: 6744 TGSLKLKSALDREERPFVQLLVLA--KGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFA---YDLK----FAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLF---DKSKYSVIVP------EDALKDFIVTTVKAIS--STGHT--ILYTITNGNDEELFDL-------DFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKY------DGRFSPTNRAHMQVHIVDENDNPPKFIQPA-FNATIS----LESSQGSLVVIAMATDLDTNSKLIYKVLNEY-YNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDF-THXXXXXXXXXXXXIKNH-----PPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSE----IFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLK 8681
            +G ++    LDRE R   +L ++A  +G         + V + D ND +P F           NL   +++  + A+      N    Y     +  A    D++    FA+D  SG + ++     EL  +++ + + A+D    A +  T V V+  +D +P+F       Y  I+P      E    DF + TV A    S G+   ++Y I     +E F +           + LQP      +    DY  +     II+      +L  ST + +   D       FL++ Y A +SE  P+       SV+LQ   ++  ++ SL +I  +   +   F +  +   + +K  LD E   +++  +++ +          + ++   + + I+D NDN P F + A + A IS    L  S   L  I    +   NS+++Y + +    ++F ID  +G +  N      +L   SG   +++++    +H      S+    ++ H      P F + E+   ++EN  V S + R  ASD DK  FG+L Y +      E    +F +DS +G +      D E++  +++ ++ SD G K     V + +   ++  P   +  Y    +L           + Q+ A D D  P  R+ Y+L +P    S   V+  +GAV +K
Sbjct: 2377 SGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPP--------NNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQ-QEYELDVIASDAAHEARTVLT-VRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA--QEGFSVHPSNGVVSVNMSRLQPA-----VSSSGDYFVR-----IIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLG------SVVLQLGQDA--LDQSLAIIAGNEESA---FELLQSKAIVLVKP-LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNN-----RLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYR--FVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAP---HSHFKVNRSSGAVLIK 3029          

HSP 25 Score: 67.781 bits (164), Expect = 3.885e-10
Identity = 70/265 (26.42%), Postives = 120/265 (45.28%), Query Frame = 3
Query: 3015 DINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAI-HGIHSDCFHCDTSTGAV---HLLCKLSPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSN----GISLFRINN-EGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPM----PERAFYK-----ASVAENLQGIHHLITVKATDAD 3755
            D NDN P F++  +   + E    G+F+ Q+HA D+D   N++LRY I  G H + F  + +   +   +++        Y+L  +  D G PQ ++  A  ++  Q V  N   P+   P     + E    G ++TSI     D  P +  Y +   S      +S+F ++   G++     +D E ++ Y L +   D   E    +     ++V DENDN P+       A++      + ++E+L     L+TV ATDAD
Sbjct: 2314 DENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQ-MTGTATIRV--QIVDVNDNQPTFP-PNNLVTVSEATELGAVITSISANDVDTYP-ALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLT----VRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDAD 2569          

HSP 26 Score: 62.7734 bits (151), Expect = 1.309e-8
Identity = 53/174 (30.46%), Postives = 81/174 (46.55%), Query Frame = 3
Query:  342 GKITYKIRDSS--EIFNTFEAE--SKLVGDF-----FYLRIRTKYTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGII-------YPVQKLFDFV 815
             +ITY+I D+    + N+  +   S+  G F      YLR      A L+RE    Y LT+     +   G      KT+V+++VLD NDN P F    +EF  +EN    + +G VTA+D D G N+ I Y L         +   F ++P +G I         +++L+D V
Sbjct: 1069 ARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLR------APLDRETRDRYQLTVL----ATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSL-------LPINSSFQVHPVTGEISTREPLDRELRELYDLV 1225          

HSP 27 Score: 55.4546 bits (132), Expect = 2.076e-6
Identity = 36/115 (31.30%), Postives = 59/115 (51.30%), Query Frame = 3
Query:  459 LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKL 803
            L+RE+   Y L IQ     +   + +  C   + I V D+NDN P F    +    QE+A + T +  ++A DAD G+N+ + Y L      ++  ++ F+I+  SG+I  V KL
Sbjct: 1909 LDREQHSRYTLQIQASDRGQPKSR-QGHCN--ITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSL------ANETQWQFAIDGQSGLITTVGKL 2014          
BLAST of Ft-2 vs. Ensembl Zebrafish
Match: fat1a (FAT atypical cadherin 1a [Source:ZFIN;Acc:ZDB-GENE-050425-1])

HSP 1 Score: 1132.47 bits (2928), Expect = 0.000e+0
Identity = 1210/4565 (26.51%), Postives = 2029/4565 (44.45%), Query Frame = 3
Query:  237 FTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTKYTAS--LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVKYLSKYFDPDFNDYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNVFLTPTGELNRYVLKLRAIFSPISTPAISVTIEAKDLSLNPKTSST---HLTIPLGNLRNINLLSVPEFVS----VSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLEGTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDI--YVPHQTTRDSTINHPNNYEESNKPIFGM-RNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDADSKD---IQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFX-XXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSENDKSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSL-VNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNK----RATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIK-PSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFA-SYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPT--ILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLK-LKSALDREERPFVQLLVLAKGWDGSYD--YINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVL--NEYYNIFKIDQSSG--FIRFNQVPNIEKL-----------LPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRER--KSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAF-VDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSI-MTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQND-FEIDSNYGYIRAKKIMDFETQSQYRINVEYR--VDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSL----YQLDSVETGVSFRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIPDLMIFEGITP-GSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPF----LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPK-SNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMI--TEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRTLWV---QVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNV---TYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKP----------------NIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGARNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNY--GCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHCEI 13640
            FT+ +YN  IY++   + YV     +MGI   +   +I YKI  S +  N F+AE   +GDF +LRIRTK  +S  LNRE    Y LT++ + E  S  +     +T+V I+VLD ND  P+F    +     EN +I T +  V ATDAD G N E +Y   +           FS++P SG++    KL D+    +   +I A+ RG          S + L++ V   N HAP I+   L+        D  +A +TV D D+  N       + +   P        T  G     +  ++ +         ++T++AKD    P+ SS    H+  P   +        P+F+     V++ E A +++ V +    + +      LK  FR   D +  +++N      SG++  +  L+A+     E    + V  +D     K     I V DVN   P         ++ EN   G +VL ++A D D      ++Y + + N  PF +  F   V+   E LD E M R + ++V  +D G+P  R V     I + ++N+ KP F    C  T+    P D  +G  I     +D D    ++  I + +     F ++P SG LSL  T   G  +K++  ++ + A+D    +  M LN +VV A+      +P+++ CV   +   +  +  + S ++  +  E+  +    + R  P FA   PSVI ++E+   G  +  ++   +D     +  + V+ +   + +  F I   D  S  + V   LDRET D Y + I V D G P+    +  ++++ D NDN P+FL +++ + ++  E+  +   ++Q++A D D  D   ++Y ++     F I + TG + ++  LDRE +  + + I A D       L +T  L I + D+NDN P F   +Y + + EDLPIG+ ++ L A D D+  +SQ+RY++       F  D  +GAV ++  L    +  Y L A  KD GKP +LSS    ++    V+ N Y P     +    I+E+   GT V  I  +  DK     + Y+I   S G+ +F I+ + G IRT   +D E    YWL +Y  DR    ++  + EVYI+V D NDN P      Y  SV E+      +I ++A D D     +L YKI SG+  G+FS    TG ++T+ R +DRE         D + L++ +SD GVP +  TV + V ++D NDN+P F+ + V+     +  +      LK   +   RV A D D   NA + Y+++              F ++ K+G +++   SS  D        I T K    A D G P   T      T RL++      PK E     L     P  + +++  + + S +L +  ++ +D      E+   ++D  F V   K SG+        ++VA +L   Q     L +   +    V   V I +   N + P F+ P  E   +++ + T P   +     R+  T+                 D    + Y++ +S DP +++K F ++   G L      +  +     + V  R++    +   +++ +++ DTN+  P F         Y+  +   A + S+VL                                   +SA D+D G+N +++++I++ +VA N F +D   G I V + L         LT+  SD G PP       AV+I      +++P+  E +    V E     + +  +   S +        V   IK  +    F +  ++G ++T S LD E I     + IQ  +  GL S      ++ IH+ D NDNAP F+   +  G++SES+   S+V        L+K    LVI A D D   N ++ Y I+  FA +YF ID  TG +    ++D E    F   S+++ D G P+  +++   + I I D NDCPP+F +D Y   +++PT+    ++ +   D D  P   + +SI+ G     F +DP TG + I         +  S   + +R  DG+F  +  + IN  +N  + +   ++S   + +PEN ++   L +  A    +  +  + Y +L+   +  I+  +G L    +  DREE+    ++V     D S D  ++ VTV + D ND  P+F++  Y+ LV  +   +    +V A+D D  EN  + Y +  +       +F   S  G I++     K+ +  +F I + A D G+PALSS  +V + +V+   P+F+K+ YS+ +PE+      +  ++A  S G  I+YTIT G+    F ++F          VI++V  LD+ET P + L + ATD  +       V I + D+ND  P+F    Y+AS+SE   I   ++ +S       N+K++ +  +++ED    S  +F I+  TGTI     LD E    H   I     G  + ++   + + ++D NDN P F Q  + AT+S  + +G  V    A+D D   + KL + +L  NE  N F +D ++G   I  ++ P++E L             SS +V+  V+  +F                 H P+F   ++ + + EN  V + +    A+D D   +GRL YH++     + F + S  G +   ++LDRE   + +  + ++  D G K  F TV + +TDINDN P    A Y V V  S  S GTT   IL++ A D D      + Y + +   +    F +   +G +  K S I      GL N   ++  + +  +    P  S             V V + IL  +  V   I       I+E+  L   + + +  S +    +SLV  ++P   Q++ F +D + G ++  K +D E+   Y++ ++ +   + S +++   I I + D ND  P+F+++ Y  F+ E++P G+ VIQ KA D D      + Y+L       D VE    F I+ + GW+ ++  +D E      + V A+D+   V     T     V         NPP    EI +      +    V+  LS  D D+E   + + + IT  +    +A        +V +  PLD E+    L L   A+D    +K   ++ ++V+D ND++P+C +   +      +P G +I  + A D D  +    ++Y L+     +   ++  TG +    PLDRE        V ALD   + C  ++ I V D+NDN P+F   +  P+     EN    + + +++A D D+G N +I+Y +LD +   FSI+ +TG++R+   LDRE Q  + L  +A+D G P   S+ T V + +LD+ND+PP F        VAED  +G  ++ I A S D     E++Y +I   E+  FR++  +G + +I+ LD+E + E++LTV A+D G PSLS    V I + DVNDN P F    Y   I E+  + K T+  V A D+D   ++ + +S +        N  S        F I+P  GE+ +  + DRE+   Y   V  +D+G PA SS   + +++ D NDNPP F+Q ++  +IQ        +Q +  +     V +L + D+D   N  PF   ++       F      +T + +L+ A +L    +  ++   QVTD+G+P L     V+V +I  S  PP I PL++   T    +S  ++GK      +   D+   +D LT+    + +  S  N+  F +    G +     LD+G Y LN+ VT+   +    + I +   T   + ++  ++ S++ P                NI   RR D++L+    +  AS    ++                             + R  +P          +   E  + K +A V  I+ +T           V++   +C     C    CQ TI +        +    ++F++      + CLC    EG  C I    C   PC     C  DPT S  + C CPE K  +  ER S+                      F+G G+  + L E  N   M++    R     A +M  +     SIL  +N  G++    D  + P +    S   ++DG+WH V L + G       +  +V+D +     +    +   + + ++  G       R  +    ++++  + GC++ ++ N ++LP  Q+       +  VL + +    GCS +     C +  C NGG CL           Y C+C   F G +CE+  S C  +PC++GG C+     F C C    +G RCQ G  C+   NPC     CI+          VC+C    +G  C  DVDEC   P  C  G G C N +  + CNC+ GY G HCE+
Sbjct:   32 FTQSVYNATIYENSAAKTYV-ESPVKMGIYITDPTWEIRYKIV-SGDNENLFKAEDYHLGDFSFLRIRTKGGSSAILNREVRDHYILTVKAM-EKNSNAE----ARTRVRIQVLDTNDLRPLFSPTAYSISLPENTAIRTSVAKVMATDADIGTNGEYYYSFREWTDM-------FSVHPTSGVVTLTGKL-DYSETKQYELEILAVDRGMKLYGSSGFSSMAKLTVRVDQANDHAPVITAVTLAA--SETDKDPTYAVVTVEDNDQGANGEIASLSV-VAGDPLQQFKAMRTSPGSKEYQIKAVKQVDWDSQPFGYNLTLQAKDKGNPPQFSSAKVIHVMSPHFKV------GPPKFIQAIYRVNVSEFAPLHTPVVM----VTAVPKYPQLKYAFRHRLD-KNHFAIN----PDSGLITTAAPLHADSVNKYE----LEVVTSDKKAVTKVI---IDVIDVNNNGPEFKQTSYKASLDENMPTGTSVLTVKATDLDSGENGYVTYSIANVNSQPFVIDYFS-GVISSSETLDYELMPRIYTLKVRASDWGSPYRREVETQVTIMLNNLNDNKPLFENVDCDATV----PRDHGVGDQITTVSAIDADELQLVRYRIKAGN-DLNVFEMNPSSGVLSLKQTLSEGEAAKVSYHSLQIIASDGEHETQPMFLNITVVTAH------KPVQVKCVDTGVASMLAEKLLQGSKVHTQSEPEDHFQDFHSVNRVAPQFADTFPSVIEVKEDLPVGARIVHLSASDSDSG---FNGKLVYVISGGDAESRFII---DMDSGWLKVFAPLDRETTDHYTLNITVYDLGIPQKSSSRLLDVKILDANDNSPQFLKETYSVEIS--ESSTVGTEVIQVEAKDKDLGDNGVVRYSILADTDQFAIDTETGIVTVKKPLDREVQPVFVLKIAARDQATAEPQLVSTVLLKITLEDVNDNPPKFIPPNYHVRVREDLPIGTVIMWLEAHDPDVGPSSQVRYSLIDSGDGKFEVDKLSGAVRIVQNLDYEKKQVYSLTAKAKDKGKPISLSSSCHIEVEVVDVNENLYRPLFPSFVDKGFIKEDVPIGTSVMKITAQDEDKGRDGEIRYSIRDGS-GLGIFTIDEDTGVIRTQELLDHETVPHYWLTVYATDRGVVPLSSFV-EVYIEVQDVNDNAPQTSEPVYYPSVMESSPKDVSIIQIEAFDPDTKSSEKLSYKITSGNPQGFFSINQKTGLVTTTSRKLDREQ-------QDEHILEITVSDQGVPAKSTTVRVIVKVLDENDNSPQFM-EKVYKIKLPVREKPEKERALKRDPVY--RVIASDKDEGPNAEISYSIE-------EGDEQGKFFIEPKTGMVYSKKLSSAVD------YDILTIK----AVDNGRPQKST------TCRLHIE---WIPKPEPSTVPLVFDE-PFYTFSVMESDTV-SHMLGVISLEPVDTP-VWFEITGGNSDSRFEV--GKASGT--------MIVAQALDAEQKSHYNLTVNATDGTRSVSTQVLIKVIDTNNHRPQFSKPKYE---VDVSEDTPPETEVL----RITATD----------------QDEKNKLTYTLLSSTDPFSLRK-FRLDPGTGVLYTAERLDHETMHQHTLTVMVRDQDIPVKRNLVRVIVNVQDTNDNAPWF-----SGAPYVGRVFESAATGSAVLQ----------------------------------VSALDKDKGQNAEIIYSIESGNVA-NSFAIDPVLGTITVAKELDRNNKNRFELTVKASDKGTPPL--SGTAAVDITVTISDNAIPKFAEKEFSAEVSETVLPGAFVSLVTANSQSS-------VFYQIKDGNVNGAFDINPNSGVVVTHSVLDYETIPSY-KLTIQGTNMAGLASN----TTLLIHLKDENDNAPVFIQD-QFAGMVSESSPVNSVV--------LTKDNTPLVIRALDTDRDANSRLVYQIVEPFAHNYFAIDSSTGAIRTISELDYEQRSVF-RFSVQVHDMGIPRHFAEKAANVTIEILDVNDCPPQFSQDLYETTVLVPTYKGVEVITVNASDADSGPNSRLFYSIVEGNIGEKFKMDPVTGVITIQN-----VTQLRSRYELRVRVSDGRFSKTSLVKINVRENKESTLRFTQESYKAF-VPENSSEKKTLAVIAA--VGNQVNEPLFYTILNPDKRFTISRTSGVLSSTGTPFDREEQGVFDIVVEVTRDDKSPDVAHVLVTVIIEDVNDNPPVFVNLPYQALVQVDADVDHIITKVTAVDADINENAEINYHLQELN------EFVQISTDGEISLTKKLDKDSVNTEFIITVVARDGGEPALSSSVEVPILVVNKAMPVFEKAFYSLEIPENIQLLTPIVHIQANDSEGPRIVYTITEGDPLNQFTINFNTG-------VIQVVKTLDFETHPAYKLSVRATDSLTGAKAEVFVDIILEDVNDNPPVFHTKLYNASLSEASVIGTSVLEVSATDADTGNNKVLFY--QIVEDKDK-SFDYFSIDRDTGTIWTTRMLDHEEKPSHRLLIRAVDGGVPALSSEVMVLIDVMDLNDNTPVFSQNVYEATVSELAPRGHFVTQVQASDADISDSGKLEFSILSGNEGQN-FAMDPNTGALVISNHRKPHMESLYNINVSVSDGVFRSSAIVKVNVISANF-----------------HNPTFNQVDYVVELLENSPVGTLVAEAQATDDDSGTYGRLTYHIVNDIAKDKFSI-SENGEIFTLESLDRENALEKVIPISLIAKDGGGKVGFCTVNVILTDINDNAPQFRAADYRVNV-ASDVSRGTT---ILKIAASDMDEGSNADITYSIETDADNVEENFEIHQFSGVIVTKESLI------GLEN---QMYTFLVRAKDGGNPTKSSV-----------VPVYVKILAPEVPVPKFIESHYRFAIEEDLSLGSEIDVIQAES-DQPVFYSLVKGNTPESNQDEVFVVDPSSGSLKLDKKLDHESTKWYQLTLQAQSEYEGSKVVSAVDISIQVKDVNDNRPLFESNPYEAFVVENLPGGTSVIQVKATDLDSGTNGHVVYNLDPNQETRDIVEL---FAINSESGWITTLKELDRETRNKYTVSVLATDRGDKVQLMASTRVDVTVV----DVNDNPPKFTAEIYKGTVSEDDPPGGVIAILSTTDLDTEENNKQISYFITGGDPLGQFAIEHTQGEWKVSVRKPLDREEKDNYL-LNITATDGTFTAKA--VVEVKVLDANDNSPICEKSFYMESVPEDSPAGRLILQVSATDADIRSNAQ-ISYELLGPGSEH-FSIDSETGELKTLLPLDREEEEVHKMKVRALDGGGRFCEAEVEITVEDVNDNPPQF---TTDPYTFTVFENTEINTPVARLYASDLDTGANAEILYSLLDSADGVFSIEEETGVVRLDRPLDRELQSLYTLRAQATDRGSPRHLSSHTTVSVSILDINDNPPVFERREYTATVAEDIPVGTQVLRIHAASRDTEAGTEITYAIINGNERGAFRVDPQTGGVFVIEPLDYETAHEFYLTVEATDGGTPSLSDLATVNINLTDVNDNSPVFNQDIYSAVISEDAELGK-TVLTVMADDADGPSSNQVRFSII------DGNQGSP-------FTIDPVRGEVKVARLLDREKTSGYTLTVLASDNGSPARSSSATINVDVSDINDNPPIFSQANYSIIIQ-------ENQPIGAS-----VLQLTVSDRDASHNGPPFTFSIIRGNEGDFF-----RITPQGVLVSAATLSRQTQEFYLLQAQVTDSGRPPLVSTAFVSVRLIEESIYPPSILPLDIFITTATDEYSGGVLGK------IHATDQD-VYDTLTYSLAPDSSSTSE-NSGLFSVSPADGKLVARGNLDAGQYVLNITVTDGRFTAAARVNIHVRQATAQALDNSIAVRFSAIAPEEFIGDYWRNFLRALRNIAGVRRGDVQLVSLQPAADASGDLEVLLA---------------------------LERSGSP----------FQPQEVLYRKLNASVGVIEEMT-------GVRIVRVMKKLCAGLD-CPLSFCQETIALETGAVSA-YSTARISFVTPRHMRTAKCLC----EGAECSILSKLCEGSPCPDGMECVEDPTHSK-YRCICPEGKQEECSERQSLT---------------------FSGNGYARYRLMENENKEEMKLSLRLRTFSTHATVMYAKGTDY-SILEIVN--GRLQYKFDCGSGPGVVSVHSTQ-VSDGQWHTVSLEVDG------NYARLVLDQVHAASGTAPGTLRTLNLDTSMYFGGH----VRPASGSGRLVMN-GLRGCLEGIVFNGRELPLSQV-----RGAHSVLEELVEAAPGCSLAPPIQGCTSNPCTNGGTCLALP-----NGGYFCKCTAAFMGTHCEVTISPCASNPCLYGGTCIPRGGDFYCQCRGQYSGQRCQLGPYCTD--NPCKNSGKCIDS-----LDGPVCECEPGFQGERCLSDVDECLKNP--CGNG-GHCQNTYGSFSCNCSNGYSGQHCEL 4168          

HSP 2 Score: 212.616 bits (540), Expect = 9.707e-54
Identity = 324/1364 (23.75%), Postives = 565/1364 (41.42%), Query Frame = 3
Query: 7206 PLFDKSKYSVIVPED-ALKDFIVTTVKA---ISSTGHTILYTITNGNDEELF--------DLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWIL-----VKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNSKL--IYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVH--DFTHXXXXXXXXXXXXIKNH----PPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCE-EPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIM--------------------DFETQSQYRINVEYRVDNSPLM------ATRTILIDLIDQND---------------------CPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKD--YEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKA--GHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPL-QLKFLASDRLHWSKE---EFILNIRVIDVNDHAP-VCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVE---SKKCSFKILINVLDINDNA-----PRFVHTSIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSS-FSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLI-KKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNI-------PENTLVSKLT-IGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIF 10988
            PLF +S Y+  + E+ A K ++ + VK    I+     I Y I +G++E LF        D  F     + G   I     L+ E +  + L + A + +S+    T V I VLD ND  P+F  ++YS S+ EN  I   +  +      +  +    +S +   D        F ++ T+G +++   LD+     +E  IL     +K  G    ++ A + V +   ND+ P        A+   +      VV     D   N ++  +  V  +    FK  ++S   +  Q+  ++++   S    + + +   D  +    + +     +  H    PP F+   + ++VSE   +++ +  + A      K+ +L+Y      D   F ++  +G +     L  +  + +EL VV SD   K     V+I V D+N+N P  +Q  Y+ + +     TGT   S+L + A D D      + Y         SIA V+S    +      I+ +  L   + +    +Y +  +  +    Y   + T        VT+ +N L D K +   + C     +++   + I  +  I + E++     + + +  +V   FE++ + G +  K+ +                    + ETQ  + +N+     + P+          ++L + + Q                        P   D     I + ED+P+G++++   A D D  + GK V     Y +   +    F ID D GW+   + +D E T    L ++  D       ++  L + + D ND  P + K      +EI+E     S T    V ++ AKD D        + ++ + +      +   +E+G V +  PLD E  ++P+  LK  A D+     +     +L I + DVND+ P   P    + + E +  G+VI  L+A+D D     + + Y+L++  D     V+ L+G V +   LD E     +    A D     S   S  I + V+D+N+N      P FV        E+ P G+ + KI A D D G + +I Y I D S    F+ID DTG++R   LLD E  P + L + A+D G  P S+   V I + DVND+ PQ         V E +     +I I+A   D   + ++SY++ +   Q FF +   +G +T   +KLD E   E+ L +  SD+G P+ STT    + V  +++N     F+  V+ I       PE     K   + +V A D D G N+ ++YS      + K             F I PKTG ++
Sbjct:   30 PLFTQSVYNATIYENSAAKTYVESPVKMGIYITDPTWEIRYKIVSGDNENLFKAEDYHLGDFSFLRIRTKGGSSAI-----LNREVRDHYILTVKAMEKNSNAEARTRVRIQVLDTNDLRPLFSPTAYSISLPENTAIRTSVAKVMATDADIGTNGEYYYSFREWTD-------MFSVHPTSGVVTLTGKLDYSETKQYELEILAVDRGMKLYGSSGFSSMAKLTVRVDQANDHAPVITAVTLAAS-ETDKDPTYAVVTVEDNDQGANGEIASLSVVAGDPLQQFKAMRTSPGSKEYQIKAVKQVDWDSQPFGYNLTLQAKDKGNPPQFSSAKVIHVMSPHFKVGPPKFIQAIYRVNVSEFAPLHTPVVMVTAVP----KYPQLKYAFRHRLDKNHFAINPDSGLITTAAPLHADSVNKYELEVVTSD---KKAVTKVIIDVIDVNNNGPEFKQTSYKAS-LDENMPTGT---SVLTVKATDLDSGENGYVTY---------SIANVNSQPFVIDYFSGVISSSETL---DYELMPRIYTLKVRASDWGSPYRREVET-------QVTIMLNNLNDNKPLFENVDCDATVPRDHGVGDQITTVSAIDADELQLVRYRIKAGNDLNV---FEMNPSSGVLSLKQTLSEGEAAKVSYHSLQIIASDGEHETQPMF-LNITVVTAHKPVQVKCVDTGVASMLAEKLLQGSKVHTQSEPEDHFQDFHSVNRVAPQFADTFPSVIEVKEDLPVGARIVHLSASDSDSGFNGKLV-----YVISGGDAESRFIIDMDSGWLKVFAPLDRETTDHYTLNITVYDLGIPQKSSSRLLDVKILDANDNSPQFLKE--TYSVEISE-----SSTVGTEVIQVEAKDKDLGDNGVVRYSILADTD-----QFAIDTETGIVTVKKPLDRE--VQPVFVLKIAARDQATAEPQLVSTVLLKITLEDVNDNPPKFIPPNYHVRVREDLPIGTVIMWLEAHDPDVGPS-SQVRYSLIDSGDGK-FEVDKLSGAVRIVQNLDYEKKQVYSLTAKAKDKGKPISLSSSCHIEVEVVDVNENLYRPLFPSFVDKGF--IKEDVPIGTSVMKITAQDEDKGRDGEIRYSIRDGSGLGIFTIDEDTGVIRTQELLDHETVPHYWLTVYATDRGVVPLSSFVEVYIEVQDVNDNAPQTSEPVYYPSVMESSPKDVSIIQIEAFDPDTKSSEKLSYKITSGNPQGFFSINQKTGLVTTTSRKLDREQQDEHILEITVSDQGVPAKSTTV--RVIVKVLDENDNSPQFMEKVYKIKLPVREKPEKERALKRDPVYRVIASDKDEGPNAEISYSIEEGDEQGK-------------FFIEPKTGMVY 1308          
BLAST of Ft-2 vs. Ensembl Zebrafish
Match: fat1a (FAT atypical cadherin 1a [Source:ZFIN;Acc:ZDB-GENE-050425-1])

HSP 1 Score: 1132.09 bits (2927), Expect = 0.000e+0
Identity = 1209/4574 (26.43%), Postives = 2027/4574 (44.32%), Query Frame = 3
Query:  237 FTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTKYTAS--LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVKYLSKYFDPDFNDYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNVFLTPTGELNRYVLKLRAIFSPISTPAISVTIEAKDLSLNPKTSST---HLTIPLGNLRNINLLSVPEFVS----VSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLEGTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDI--YVPHQTTRDSTINHPNNYEESNKPIFGM-RNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDADSKD---IQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFX-XXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTM---------WTRSPAEVTIRLYLSENATDPKSENDKSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSL-VNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNK----RATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIK-PSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFA-SYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPT--ILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLK-LKSALDREERPFVQLLVLAKGWDGSYD--YINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVL--NEYYNIFKIDQSSG--FIRFNQVPNIEKL-----------LPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRER--KSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAF-VDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSI-MTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQND-FEIDSNYGYIRAKKIMDFETQSQYRINVEYR--VDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSL----YQLDSVETGVSFRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIPDLMIFEGITP-GSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPF----LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPK-SNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMI--TEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRTLWV---QVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNV---TYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKP----------------NIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGARNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNY--GCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHCEI 13640
            FT+ +YN  IY++   + YV     +MGI   +   +I YKI  S +  N F+AE   +GDF +LRIRTK  +S  LNRE    Y LT++ + E  S  +     +T+V I+VLD ND  P+F    +     EN +I T +  V ATDAD G N E +Y   +           FS++P SG++    KL D+    +   +I A+ RG          S + L++ V   N HAP I+   L+   + D  D  +A +TV D D+  N       + +   P        T  G     +  ++ +         ++T++AKD    P+ SS    H+  P   +        P+F+     V++ E A +++ V +    + +      LK  FR   D +  +++N      SG++  +  L+A+     E    + V  +D     K     I V DVN   P         ++ EN   G +VL ++A D D      ++Y + + N  PF +  F   V+   E LD E M R + ++V  +D G+P  R V     I + ++N+ KP F    C  T+    P D  +G  I     +D D    ++  I + +     F ++P SG LSL  T   G  +K++  ++ + A+D    +  M LN +VV A+      +P+++ CV   +   +  +  + S ++  +  E+  +    + R  P FA   PSVI ++E+   G  +  ++   +D     +  + V+ +   + +  F I   D  S  + V   LDRET D Y + I V D G P+    +  ++++ D NDN P+FL +++ + ++  E+  +   ++Q++A D D  D   ++Y ++     F I + TG + ++  LDRE +  + + I A D       L +T  L I + D+NDN P F   +Y + + EDLPIG+ ++ L A D D+  +SQ+RY++       F  D  +GAV ++  L    +  Y L A  KD GKP +LSS    ++    V+ N Y P     +    I+E+   GT V  I  +  DK     + Y+I   S G+ +F I+ + G IRT   +D E    YWL +Y  DR    ++  + EVYI+V D NDN P      Y  SV E+      +I ++A D D     +L YKI SG+  G+FS    TG ++T+ R +DRE         D + L++ +SD GVP +  TV + V ++D NDN+P F+ + V+     +  +      LK   +   RV A D D   NA + Y+++              F ++ K+G +++   SS  D        I T K    A D G P           W   P   T+ L             D+     + + SD++         S +L +  ++ +D      E+   ++D  F V   K SG+        ++VA +L   Q     L +   +    V   V I +   N + P F+ P  E   +++ + T P   +     R+  T+                 D    + Y++ +S DP +++K F ++   G L      +  +     + V  R++    +   +++ +++ DTN+  P F         Y+  +   A + S+VL                                   +SA D+D G+N +++++I++ +VA N F +D   G I V + L         LT+  SD G PP       AV+I      +++P+  E +    V E     + +  +   S +        V   IK  +    F +  ++G ++T S LD E I     + IQ  +  GL S      ++ IH+ D NDNAP F+   +  G++SES+   S+V        L+K    LVI A D D   N ++ Y I+  FA +YF ID  TG +    ++D E    F   S+++ D G P+  +++   + I I D NDCPP+F +D Y   +++PT+    ++ +   D D  P   + +SI+ G     F +DP TG + I         +  S   + +R  DG+F  +  + IN  +N  + +   ++S   + +PEN ++   L +  A    +  +  + Y +L+   +  I+  +G L    +  DREE+    ++V     D S D  ++ VTV + D ND  P+F++  Y+ LV  +   +    +V A+D D  EN  + Y +  +       +F   S  G I++     K+ +  +F I + A D G+PALSS  +V + +V+   P+F+K+ YS+ +PE+      +  ++A  S G  I+YTIT G+    F ++F          VI++V  LD+ET P + L + ATD  +       V I + D+ND  P+F    Y+AS+SE   I   ++ +S       N+K++ +  +++ED    S  +F I+  TGTI     LD E    H   I     G  + ++   + + ++D NDN P F Q  + AT+S  + +G  V    A+D D   + KL + +L  NE  N F +D ++G   I  ++ P++E L             SS +V+  V+  +F                 H P+F   ++ + + EN  V + +    A+D D   +GRL YH++     + F + S  G +   ++LDRE   + +  + ++  D G K  F TV + +TDINDN P    A Y V V  S  S GTT   IL++ A D D      + Y + +   +    F +   +G +  K S I      GL N   ++  + +  +    P  S             V V + IL  +  V   I       I+E+  L   + + +  S +    +SLV  ++P   Q++ F +D + G ++  K +D E+   Y++ ++ +   + S +++   I I + D ND  P+F+++ Y  F+ E++P G+ VIQ KA D D      + Y+L       D VE    F I+ + GW+ ++  +D E      + V A+D+   V     T     V         NPP    EI +      +    V+  LS  D D+E   + + + IT  +    +A        +V +  PLD E+    L L   A+D    +K   ++ ++V+D ND++P+C +   +      +P G +I  + A D D  +    ++Y L+     +   ++  TG +    PLDRE        V ALD   + C  ++ I V D+NDN P+F   +  P+     EN    + + +++A D D+G N +I+Y +LD +   FSI+ +TG++R+   LDRE Q  + L  +A+D G P   S+ T V + +LD+ND+PP F        VAED  +G  ++ I A S D     E++Y +I   E+  FR++  +G + +I+ LD+E + E++LTV A+D G PSLS    V I + DVNDN P F    Y   I E+  + K T+  V A D+D   ++ + +S +        N  S        F I+P  GE+ +  + DRE+   Y   V  +D+G PA SS   + +++ D NDNPP F+Q ++  +IQ        +Q +  +     V +L + D+D   N  PF   ++       F      +T + +L+ A +L    +  ++   QVTD+G+P L     V+V +I  S  PP I PL++   T    +S  ++GK      +   D+   +D LT+    + +  S  N+  F +    G +     LD+G Y LN+ VT+   +    + I +   T   + ++  ++ S++ P                NI   RR D++L+    +  AS    ++                             + R  +P          +   E  + K +A V  I+ +T           V++   +C     C    CQ TI +        +    ++F++      + CLC    EG  C I    C   PC     C  DPT S  + C CPE K  +  ER S+                      F+G G+  + L E  N   M++    R     A +M  +     SIL  +N  G++    D  + P +    S   ++DG+WH V L + G       +  +V+D +     +    +   + + ++  G       R  +    ++++  + GC++ ++ N ++LP  Q+       +  VL + +    GCS +     C +  C NGG CL           Y C+C   F G +CE+  S C  +PC++GG C+     F C C    +G RCQ G  C+   NPC     CI+          VC+C    +G  C  DVDEC   P  C  G G C N +  + CNC+ GY G HCE+
Sbjct:   32 FTQSVYNATIYENSAAKTYV-ESPVKMGIYITDPTWEIRYKIV-SGDNENLFKAEDYHLGDFSFLRIRTKGGSSAILNREVRDHYILTVKAM-EKNSNAE----ARTRVRIQVLDTNDLRPLFSPTAYSISLPENTAIRTSVAKVMATDADIGTNGEYYYSFREWTDM-------FSVHPTSGVVTLTGKL-DYSETKQYELEILAVDRGMKLYGSSGFSSMAKLTVRVDQANEHAPVITAVTLAAS-ETD-KDPTYAVVTVEDNDQGANGEIASLSV-VAGDPLQQFKAMRTSPGSKEYQIKAVKQVDWDSQPFGYNLTLQAKDKGNPPQFSSAKVIHVMSPHFKV------GPPKFIQAIYRVNVSEFAPLHTPVVM----VTAVPKYPQLKYAFRHRLD-KNHFAIN----PDSGLITTAAPLHADSVNKYE----LEVVTSDKKAVTKVI---IDVIDVNNNGPEFKQTSYKASLDENMPTGTSVLTVKATDLDSGENGYVTYSIANVNSQPFVIDYFS-GVISSSETLDYELMPRIYTLKVRASDWGSPYRREVETQVTIMLNNLNDNKPLFENVDCDATV----PRDHGVGDQITTVSAIDADELQLVRYRIKAGN-DLNVFEMNPSSGVLSLKQTLSEGEAAKVSYHSLQIIASDGEHETQPMFLNITVVTAH------KPVQVKCVDTGVASMLAEKLLQGSKVHTQSEPEDHFQDFHSVNRVAPQFADTFPSVIEVKEDLPVGARIVHLSASDSDSG---FNGKLVYVISGGDAESRFII---DMDSGWLKVFAPLDRETTDHYTLNITVYDLGIPQKSSSRLLDVKILDANDNSPQFLKETYSVEIS--ESSTVGTEVIQVEAKDKDLGDNGVVRYSILADTDQFAIDTETGIVTVKKPLDREVQPVFVLKIAARDQATAEPQLVSTVLLKITLEDVNDNPPKFIPPNYHVRVREDLPIGTVIMWLEAHDPDVGPSSQVRYSLIDSGDGKFEVDKLSGAVRIVQNLDYEKKQVYSLTAKAKDKGKPISLSSSCHIEVEVVDVNENLYRPLFPSFVDKGFIKEDVPIGTSVMKITAQDEDKGRDGEIRYSIRDGS-GLGIFTIDEDTGVIRTQELLDHETVPHYWLTVYATDRGVVPLSSFV-EVYIEVQDVNDNAPQTSEPVYYPSVMESSPKDVSIIQIEAFDPDTKSSEKLSYKITSGNPQGFFSINQKTGLVTTTSRKLDREQ-------QDEHILEITVSDQGVPAKSTTVRVIVKVLDENDNSPQFM-EKVYKIKLPVREKPEKERALKRDPVY--RVIASDKDEGPNAEISYSIE-------EGDEQGKFFIEPKTGMVYSKKLSSAVD------YDILTIK----AVDNGRPQKSATCRLHIEWIPKPEPSTVPLVF-----------DEPFYTFSVMESDTV---------SHMLGVISLEPVDTP-VWFEITGGNSDSRFEV--GKASGT--------MIVAQALDAEQKSHYNLTVNATDGTRSVSTQVLIKVIDTNNHRPQFSKPKYE---VDVSEDTPPETEVL----RITATD----------------QDEKNKLTYTLLSSTDPFSLRK-FRLDPGTGVLYTAERLDHETMHQHTLTVMVRDQDIPVKRNLVRVIVNVQDTNDNAPWF-----SGAPYVGRVFESAATGSAVLQ----------------------------------VSALDKDKGQNAEIIYSIESGNVA-NSFAIDPVLGTITVAKELDRNNKNRFELTVKASDKGTPPL--SGTAAVDITVTISDNAIPKFAEKEFSAEVSETVLPGAFVSLVTANSQSS-------VFYQIKDGNVNGAFDINPNSGVVVTHSVLDYETIPSY-KLTIQGTNMAGLASN----TTLLIHLKDENDNAPVFIQD-QFAGMVSESSPVNSVV--------LTKDNTPLVIRALDTDRDANSRLVYQIVEPFAHNYFAIDSSTGAIRTISELDYEQRSVF-RFSVQVHDMGIPRHFAEKAANVTIEILDVNDCPPQFSQDLYETTVLVPTYKGVEVITVNASDADSGPNSRLFYSIVEGNIGEKFKMDPVTGVITIQN-----VTQLRSRYELRVRVSDGRFSKTSLVKINVRENKESTLRFTQESYKAF-VPENSSEKKTLAVIAA--VGNQVNEPLFYTILNPDKRFTISRTSGVLSSTGTPFDREEQGVFDIVVEVTRDDKSPDVAHVLVTVIIEDVNDNPPVFVNLPYQALVQVDADVDHIITKVTAVDADINENAEINYHLQELN------EFVQISTDGEISLTKKLDKDSVNTEFIITVVARDGGEPALSSSVEVPILVVNKAMPVFEKAFYSLEIPENIQLLTPIVHIQANDSEGPRIVYTITEGDPLNQFTINFNTG-------VIQVVKTLDFETHPAYKLSVRATDSLTGAKAEVFVDIILEDVNDNPPVFHTKLYNASLSEASVIGTSVLEVSATDADTGNNKVLFY--QIVEDKDK-SFDYFSIDRDTGTIWTTRMLDHEEKPSHRLLIRAVDGGVPALSSEVMVLIDVMDLNDNTPVFSQNVYEATVSELAPRGHFVTQVQASDADISDSGKLEFSILSGNEGQN-FAMDPNTGALVISNHRKPHMESLYNINVSVSDGVFRSSAIVKVNVISANF-----------------HNPTFNQVDYVVELLENSPVGTLVAEAQATDDDSGTYGRLTYHIVNDIAKDKFSI-SENGEIFTLESLDRENALEKVIPISLIAKDGGGKVGFCTVNVILTDINDNAPQFRAADYRVNV-ASDVSRGTT---ILKIAASDMDEGSNADITYSIETDADNVEENFEIHQFSGVIVTKESLI------GLEN---QMYTFLVRAKDGGNPTKSSV-----------VPVYVKILAPEVPVPKFIESHYRFAIEEDLSLGSEIDVIQAES-DQPVFYSLVKGNTPESNQDEVFVVDPSSGSLKLDKKLDHESTKWYQLTLQAQSEYEGSKVVSAVDISIQVKDVNDNRPLFESNPYEAFVVENLPGGTSVIQVKATDLDSGTNGHVVYNLDPNQETRDIVEL---FAINSESGWITTLKELDRETRNKYTVSVLATDRGDKVQLMASTRVDVTVV----DVNDNPPKFTAEIYKGTVSEDDPPGGVIAILSTTDLDTEENNKQISYFITGGDPLGQFAIEHTQGEWKVSVRKPLDREEKDNYL-LNITATDGTFTAKA--VVEVKVLDANDNSPICEKSFYMESVPEDSPAGRLILQVSATDADIRSNAQ-ISYELLGPGSEH-FSIDSETGELKTLLPLDREEEEVHKMKVRALDGGGRFCEAEVEITVEDVNDNPPQF---TTDPYTFTVFENTEINTPVARLYASDLDTGANAEILYSLLDSADGVFSIEEETGVVRLDRPLDRELQSLYTLRAQATDRGSPRHLSSHTTVSVSILDINDNPPVFERREYTATVAEDIPVGTQVLRIHAASRDTEAGTEITYAIINGNERGAFRVDPQTGGVFVIEPLDYETAHEFYLTVEATDGGTPSLSDLATVNINLTDVNDNSPVFNQDIYSAVISEDAELGK-TVLTVMADDADGPSSNQVRFSII------DGNQGSP-------FTIDPVRGEVKVARLLDREKTSGYTLTVLASDNGSPARSSSATINVDVSDINDNPPIFSQANYSIIIQ-------ENQPIGAS-----VLQLTVSDRDASHNGPPFTFSIIRGNEGDFF-----RITPQGVLVSAATLSRQTQEFYLLQAQVTDSGRPPLVSTAFVSVRLIEESIYPPSILPLDIFITTATDEYSGGVLGK------IHATDQD-VYDTLTYSLAPDSSSTSE-NSGLFSVSPADGKLVARGNLDAGQYVLNITVTDGRFTAAARVNIHVRQATAQALDNSIAVRFSAIAPEEFIGDYWRNFLRALRNIAGVRRGDVQLVSLQPAADASGDLEVLLA---------------------------LERSGSP----------FQPQEVLYRKLNASVGVIEEMT-------GVRIVRVMKKLCAGLD-CPLSFCQETIALETGAVSA-YSTARISFVTPRHMRTAKCLC----EGAECSILSKLCEGSPCPDGMECVEDPTHSK-YRCICPEGKQEECSERQSLT---------------------FSGNGYARYRLMENENKEEMKLSLRLRTFSTHATVMYAKGTDY-SILEIVN--GRLQYKFDCGSGPGVVSVHSTQ-VSDGQWHTVSLEVDG------NYARLVLDQVHAASGTAPGTLRTLNLDTSMYFGGH----VRPASGSGRLVMN-GLRGCLEGIVFNGRELPLSQV-----RGAHSVLEELVEAAPGCSLAPPIQGCTSNPCTNGGTCLALP-----NGGYFCKCTAAFMGTHCEVTISPCASNPCLYGGTCIPRGGDFYCQCRGQYSGQRCQLGPYCTD--NPCKNSGKCIDS-----LDGPVCECEPGFQGERCLSDVDECLKNP--CGNG-GHCQNTYGSFSCNCSNGYSGQHCEL 4168          

HSP 2 Score: 210.69 bits (535), Expect = 3.242e-53
Identity = 323/1364 (23.68%), Postives = 565/1364 (41.42%), Query Frame = 3
Query: 7206 PLFDKSKYSVIVPED-ALKDFIVTTVKA---ISSTGHTILYTITNGNDEELF--------DLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWIL-----VKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNSKL--IYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVH--DFTHXXXXXXXXXXXXIKNH----PPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCE-EPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIM--------------------DFETQSQYRINVEYRVDNSPLM------ATRTILIDLIDQND---------------------CPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKD--YEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKA--GHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPL-QLKFLASDRLHWSKE---EFILNIRVIDVNDHAP-VCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVE---SKKCSFKILINVLDINDNA-----PRFVHTSIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSS-FSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLI-KKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNI-------PENTLVSKLT-IGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIF 10988
            PLF +S Y+  + E+ A K ++ + VK    I+     I Y I +G++E LF        D  F     + G   I     L+ E +  + L + A + +S+    T V I VLD ND  P+F  ++YS S+ EN  I   +  +      +  +    +S +   D        F ++ T+G +++   LD+     +E  IL     +K  G    ++ A + V +   N++ P        A+   +      VV     D   N ++  +  V  +    FK  ++S   +  Q+  ++++   S    + + +   D  +    + +     +  H    PP F+   + ++VSE   +++ +  + A      K+ +L+Y      D   F ++  +G +     L  +  + +EL VV SD   K     V+I V D+N+N P  +Q  Y+ + +     TGT   S+L + A D D      + Y         SIA V+S    +      I+ +  L   + +    +Y +  +  +    Y   + T        VT+ +N L D K +   + C     +++   + I  +  I + E++     + + +  +V   FE++ + G +  K+ +                    + ETQ  + +N+     + P+          ++L + + Q                        P   D     I + ED+P+G++++   A D D  + GK V     Y +   +    F ID D GW+   + +D E T    L ++  D       ++  L + + D ND  P + K      +EI+E     S T    V ++ AKD D        + ++ + +      +   +E+G V +  PLD E  ++P+  LK  A D+     +     +L I + DVND+ P   P    + + E +  G+VI  L+A+D D     + + Y+L++  D     V+ L+G V +   LD E     +    A D     S   S  I + V+D+N+N      P FV        E+ P G+ + KI A D D G + +I Y I D S    F+ID DTG++R   LLD E  P + L + A+D G  P S+   V I + DVND+ PQ         V E +     +I I+A   D   + ++SY++ +   Q FF +   +G +T   +KLD E   E+ L +  SD+G P+ STT    + V  +++N     F+  V+ I       PE     K   + +V A D D G N+ ++YS      + K             F I PKTG ++
Sbjct:   30 PLFTQSVYNATIYENSAAKTYVESPVKMGIYITDPTWEIRYKIVSGDNENLFKAEDYHLGDFSFLRIRTKGGSSAI-----LNREVRDHYILTVKAMEKNSNAEARTRVRIQVLDTNDLRPLFSPTAYSISLPENTAIRTSVAKVMATDADIGTNGEYYYSFREWTD-------MFSVHPTSGVVTLTGKLDYSETKQYELEILAVDRGMKLYGSSGFSSMAKLTVRVDQANEHAPVITAVTLAAS-ETDKDPTYAVVTVEDNDQGANGEIASLSVVAGDPLQQFKAMRTSPGSKEYQIKAVKQVDWDSQPFGYNLTLQAKDKGNPPQFSSAKVIHVMSPHFKVGPPKFIQAIYRVNVSEFAPLHTPVVMVTAVP----KYPQLKYAFRHRLDKNHFAINPDSGLITTAAPLHADSVNKYELEVVTSD---KKAVTKVIIDVIDVNNNGPEFKQTSYKAS-LDENMPTGT---SVLTVKATDLDSGENGYVTY---------SIANVNSQPFVIDYFSGVISSSETL---DYELMPRIYTLKVRASDWGSPYRREVET-------QVTIMLNNLNDNKPLFENVDCDATVPRDHGVGDQITTVSAIDADELQLVRYRIKAGNDLNV---FEMNPSSGVLSLKQTLSEGEAAKVSYHSLQIIASDGEHETQPMF-LNITVVTAHKPVQVKCVDTGVASMLAEKLLQGSKVHTQSEPEDHFQDFHSVNRVAPQFADTFPSVIEVKEDLPVGARIVHLSASDSDSGFNGKLV-----YVISGGDAESRFIIDMDSGWLKVFAPLDRETTDHYTLNITVYDLGIPQKSSSRLLDVKILDANDNSPQFLKE--TYSVEISE-----SSTVGTEVIQVEAKDKDLGDNGVVRYSILADTD-----QFAIDTETGIVTVKKPLDRE--VQPVFVLKIAARDQATAEPQLVSTVLLKITLEDVNDNPPKFIPPNYHVRVREDLPIGTVIMWLEAHDPDVGPS-SQVRYSLIDSGDGK-FEVDKLSGAVRIVQNLDYEKKQVYSLTAKAKDKGKPISLSSSCHIEVEVVDVNENLYRPLFPSFVDKGF--IKEDVPIGTSVMKITAQDEDKGRDGEIRYSIRDGSGLGIFTIDEDTGVIRTQELLDHETVPHYWLTVYATDRGVVPLSSFVEVYIEVQDVNDNAPQTSEPVYYPSVMESSPKDVSIIQIEAFDPDTKSSEKLSYKITSGNPQGFFSINQKTGLVTTTSRKLDREQQDEHILEITVSDQGVPAKSTTV--RVIVKVLDENDNSPQFMEKVYKIKLPVREKPEKERALKRDPVYRVIASDKDEGPNAEISYSIEEGDEQGK-------------FFIEPKTGMVY 1308          
BLAST of Ft-2 vs. Ensembl Zebrafish
Match: fat1a (FAT atypical cadherin 1a [Source:ZFIN;Acc:ZDB-GENE-050425-1])

HSP 1 Score: 1126.69 bits (2913), Expect = 0.000e+0
Identity = 1206/4570 (26.39%), Postives = 2022/4570 (44.25%), Query Frame = 3
Query:  237 FTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTKYTAS--LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVKYLSKYFDPDFNDYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNVFLTPTGELNRYVLKLRAIFSPISTPAISVTIEAKDLSLNPKTSST---HLTIPLGNLRNINLLSVPEFVS----VSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLEGTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDI--YVPHQTTRDSTINHPNNYEESNKPIFGM-RNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDADSKD---IQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFX-XXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSENDKSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSL-VNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNK----RATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIK-PSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFA-SYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPT--ILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLK-LKSALDREERPFVQLLVLAKGWDGSYD--YINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVL--NEYYNIFKIDQSSG--FIRFNQVPNIEKL-----------LPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRER--KSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAF-VDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSI-MTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQND-FEIDSNYGYIRAKKIMDFETQSQYRINVEYR--VDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSL----YQLDSVETGVSFRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIPDLMIFEGITP-GSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPF----LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPK-SNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMI--TEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRTLWV---QVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNV---TYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKP----------------NIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILI-----DINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGARNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNY--GCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHCEI 13640
            FT+ +YN  IY++   + YV     +MGI   +   +I YKI  S +  N F+AE   +GDF +LRIRTK  +S  LNRE    Y LT++ + E  S  +     +T+V I+VLD ND  P+F    +     EN +I T +  V ATDAD G N E +Y   +           FS++P SG++    KL D+    +   +I A+ RG          S + L++ V   N HAP I+   L+        D  +A +TV D D+  N       + +   P        T  G     +  ++ +         ++T++AKD    P+ SS    H+  P   +        P+F+     V++ E A +++ V +    + +      LK  FR   D +  +++N  S   +        L+A+     E    + V  +D     K     I V DVN   P         ++ EN   G +VL ++A D D      ++Y + + N  PF +  F   V+   E LD E M R + ++V  +D G+P  R V     I + ++N+ KP F    C  T+    P D  +G  I     +D D    ++  I + +     F ++P SG LSL  T   G  +K++  ++ + A+D    +  M LN +VV A+      +P+++ CV   +   +  +  + S ++  +  E+  +    + R  P FA   PSVI ++E+   G  +  ++   +D     +  + V+ +   + +  F I   D  S  + V   LDRET D Y + I V D G P+    +  ++++ D NDN P+FL +++ + ++  E+  +   ++Q++A D D  D   ++Y ++     F I + TG + ++  LDRE +  + + I A D       L +T  L I + D+NDN P F   +Y + + EDLPIG+ ++ L A D D+  +SQ+RY++       F  D  +GAV ++  L    +  Y L A  KD GKP +LSS    ++    V+ N Y P     +    I+E+   GT V  I  +  DK     + Y+I   S G+ +F I+ + G IRT   +D E    YWL +Y  DR    ++  + EVYI+V D NDN P      Y  SV E+      +I ++A D D     +L YKI SG+  G+FS    TG ++T+ R +DRE         D + L++ +SD GVP +  TV + V ++D NDN+P F+ + V+     +  +      LK   +   RV A D D   NA + Y+++              F ++ K+G +++   SS  D        I T K    A D G P   T      T RL++      PK E     L     P  + +++  + + S +L +  ++ +D      E+   ++D  F V   K SG+        ++VA +L   Q     L +   +    V   V I +   N + P F+ P  E   +++ + T P   +     R+  T+                 D    + Y++ +S DP +++K F ++   G L      +  +     + V  R++    +   +++ +++ DTN+  P F         Y+  +   A + S+VL                                   +SA D+D G+N +++++I++ +VA N F +D   G I V + L         LT+  SD G PP       AV+I      +++P+  E +    V E     + +  +   S +        V   IK  +    F +  ++G ++T S LD E I     + IQ  +  GL S      ++ IH+ D NDNAP F+   +  G++SES+   S+V        L+K    LVI A D D   N ++ Y I+  FA +YF ID  TG +    ++D E    F   S+++ D G P+  +++   + I I D NDCPP+F +D Y   +++PT+    ++ +   D D  P   + +SI+ G     F +DP TG + I         +  S   + +R  DG+F  +  + IN  +N  + +   ++S   + +PEN ++   L +  A    +  +  + Y +L+   +  I+  +G L    +  DREE+    ++V     D S D  ++ VTV + D ND  P+F++  Y+ LV  +   +    +V A+D D  EN  + Y +  +       +F   S  G I++     K+ +  +F I + A D G+PALSS  +V + +V+   P+F+K+ YS+ +PE+      +  ++A  S G  I+YTIT G+    F ++F          VI++V  LD+ET P + L + ATD  +       V I + D+ND  P+F    Y+AS+SE   I   ++ +S       N+K++ +  +++ED    S  +F I+  TGTI     LD E    H   I     G  + ++   + + ++D NDN P F Q  + AT+S  + +G  V    A+D D   + KL + +L  NE  N F +D ++G   I  ++ P++E L             SS +V+  V+  +F                 H P+F   ++ + + EN  V + +    A+D D   +GRL YH++     + F + S  G +   ++LDRE   + +  + ++  D G K  F TV + +TDINDN P    A Y V V  S  S GTT   IL++ A D D      + Y + +   +    F +   +G +  K S I      GL N   ++  + +  +    P  S             V V + IL  +  V   I       I+E+  L   + + +  S +    +SLV  ++P   Q++ F +D + G ++  K +D E+   Y++ ++ +   + S +++   I I + D ND  P+F+++ Y  F+ E++P G+ VIQ KA D D      + Y+L       D VE    F I+ + GW+ ++  +D E      + V A+D+   V     T     V         NPP    EI +      +    V+  LS  D D+E   + + + IT  +    +A        +V +  PLD E+    L L   A+D    +K   ++ ++V+D ND++P+C +   +      +P G +I  + A D D  +    ++Y L+     +   ++  TG +    PLDRE        V ALD   + C  ++ I V D+NDN P+F   +  P+     EN    + + +++A D D+G N +I+Y +LD +   FSI+ +TG++R+   LDRE Q  + L  +A+D G P   S+ T V + +LD+ND+PP F        VAED  +G  ++ I A S D     E++Y +I   E+  FR++  +G + +I+ LD+E + E++LTV A+D G PSLS    V I + DVNDN P F    Y   I E+  + K T+  V A D+D   ++ + +S +        N  S        F I+P  GE+ +  + DRE+   Y   V  +D+G PA SS   + +++ D NDNPP F+Q ++  +IQ        +Q +  +     V +L + D+D   N  PF   ++       F      +T + +L+ A +L    +  ++   QVTD+G+P L     V+V +I  S  PP I PL++   T    +S  ++GK      +   D+   +D LT+    + +  S  N+  F +    G +     LD+G Y LN+ VT+   +    + I +   T   + ++  ++ S++ P                NI   RR D++L+    +  AS    ++                             + R  +P          +   E  + K +A V  I+ +T           V++   +C     C    CQ TI +        +    ++F++      + CLC    EG  C I    C   PC     C  DPT S  + C CPE K  +  ER S+                      F+G G+  + L E  N   M++    R     A     +   +   ++        SDG  ++S  H T            ++DG+WH V L + G       +  +V+D +     +    +   + + ++  G       R  +    ++++  + GC++ ++ N ++LP  Q+       +  VL + +    GCS +     C +  C NGG CL           Y C+C   F G +CE+  S C  +PC++GG C+     F C C    +G RCQ G  C+   NPC     CI+          VC+C    +G  C  DVDEC   P  C  G G C N +  + CNC+ GY G HCE+
Sbjct:   32 FTQSVYNATIYENSAAKTYV-ESPVKMGIYITDPTWEIRYKIV-SGDNENLFKAEDYHLGDFSFLRIRTKGGSSAILNREVRDHYILTVKAM-EKNSNAE----ARTRVRIQVLDTNDLRPLFSPTAYSISLPENTAIRTSVAKVMATDADIGTNGEYYYSFREWTDM-------FSVHPTSGVVTLTGKL-DYSETKQYELEILAVDRGMKLYGSSGFSSMAKLTVRVDQANDHAPVITAVTLAA--SETDKDPTYAVVTVEDNDQGANGEIASLSV-VAGDPLQQFKAMRTSPGSKEYQIKAVKQVDWDSQPFGYNLTLQAKDKGNPPQFSSAKVIHVMSPHFKV------GPPKFIQAIYRVNVSEFAPLHTPVVM----VTAVPKYPQLKYAFRHRLD-KNHFAINPDSGLITTAAP----LHADSVNKYE----LEVVTSDKKAVTKVI---IDVIDVNNNGPEFKQTSYKASLDENMPTGTSVLTVKATDLDSGENGYVTYSIANVNSQPFVIDYFS-GVISSSETLDYELMPRIYTLKVRASDWGSPYRREVETQVTIMLNNLNDNKPLFENVDCDATV----PRDHGVGDQITTVSAIDADELQLVRYRIKAGN-DLNVFEMNPSSGVLSLKQTLSEGEAAKVSYHSLQIIASDGEHETQPMFLNITVVTAH------KPVQVKCVDTGVASMLAEKLLQGSKVHTQSEPEDHFQDFHSVNRVAPQFADTFPSVIEVKEDLPVGARIVHLSASDSDSG---FNGKLVYVISGGDAESRFII---DMDSGWLKVFAPLDRETTDHYTLNITVYDLGIPQKSSSRLLDVKILDANDNSPQFLKETYSVEIS--ESSTVGTEVIQVEAKDKDLGDNGVVRYSILADTDQFAIDTETGIVTVKKPLDREVQPVFVLKIAARDQATAEPQLVSTVLLKITLEDVNDNPPKFIPPNYHVRVREDLPIGTVIMWLEAHDPDVGPSSQVRYSLIDSGDGKFEVDKLSGAVRIVQNLDYEKKQVYSLTAKAKDKGKPISLSSSCHIEVEVVDVNENLYRPLFPSFVDKGFIKEDVPIGTSVMKITAQDEDKGRDGEIRYSIRDGS-GLGIFTIDEDTGVIRTQELLDHETVPHYWLTVYATDRGVVPLSSFV-EVYIEVQDVNDNAPQTSEPVYYPSVMESSPKDVSIIQIEAFDPDTKSSEKLSYKITSGNPQGFFSINQKTGLVTTTSRKLDREQ-------QDEHILEITVSDQGVPAKSTTVRVIVKVLDENDNSPQFM-EKVYKIKLPVREKPEKERALKRDPVY--RVIASDKDEGPNAEISYSIE-------EGDEQGKFFIEPKTGMVYSKKLSSAVD------YDILTIK----AVDNGRPQKST------TCRLHIE---WIPKPEPSTVPLVFDE-PFYTFSVMESDTV-SHMLGVISLEPVDTP-VWFEITGGNSDSRFEV--GKASGT--------MIVAQALDAEQKSHYNLTVNATDGTRSVSTQVLIKVIDTNNHRPQFSKPKYE---VDVSEDTPPETEVL----RITATD----------------QDEKNKLTYTLLSSTDPFSLRK-FRLDPGTGVLYTAERLDHETMHQHTLTVMVRDQDIPVKRNLVRVIVNVQDTNDNAPWF-----SGAPYVGRVFESAATGSAVLQ----------------------------------VSALDKDKGQNAEIIYSIESGNVA-NSFAIDPVLGTITVAKELDRNNKNRFELTVKASDKGTPPL--SGTAAVDITVTISDNAIPKFAEKEFSAEVSETVLPGAFVSLVTANSQSS-------VFYQIKDGNVNGAFDINPNSGVVVTHSVLDYETIPSY-KLTIQGTNMAGLASN----TTLLIHLKDENDNAPVFIQD-QFAGMVSESSPVNSVV--------LTKDNTPLVIRALDTDRDANSRLVYQIVEPFAHNYFAIDSSTGAIRTISELDYEQRSVF-RFSVQVHDMGIPRHFAEKAANVTIEILDVNDCPPQFSQDLYETTVLVPTYKGVEVITVNASDADSGPNSRLFYSIVEGNIGEKFKMDPVTGVITIQN-----VTQLRSRYELRVRVSDGRFSKTSLVKINVRENKESTLRFTQESYKAF-VPENSSEKKTLAVIAA--VGNQVNEPLFYTILNPDKRFTISRTSGVLSSTGTPFDREEQGVFDIVVEVTRDDKSPDVAHVLVTVIIEDVNDNPPVFVNLPYQALVQVDADVDHIITKVTAVDADINENAEINYHLQELN------EFVQISTDGEISLTKKLDKDSVNTEFIITVVARDGGEPALSSSVEVPILVVNKAMPVFEKAFYSLEIPENIQLLTPIVHIQANDSEGPRIVYTITEGDPLNQFTINFNTG-------VIQVVKTLDFETHPAYKLSVRATDSLTGAKAEVFVDIILEDVNDNPPVFHTKLYNASLSEASVIGTSVLEVSATDADTGNNKVLFY--QIVEDKDK-SFDYFSIDRDTGTIWTTRMLDHEEKPSHRLLIRAVDGGVPALSSEVMVLIDVMDLNDNTPVFSQNVYEATVSELAPRGHFVTQVQASDADISDSGKLEFSILSGNEGQN-FAMDPNTGALVISNHRKPHMESLYNINVSVSDGVFRSSAIVKVNVISANF-----------------HNPTFNQVDYVVELLENSPVGTLVAEAQATDDDSGTYGRLTYHIVNDIAKDKFSI-SENGEIFTLESLDRENALEKVIPISLIAKDGGGKVGFCTVNVILTDINDNAPQFRAADYRVNV-ASDVSRGTT---ILKIAASDMDEGSNADITYSIETDADNVEENFEIHQFSGVIVTKESLI------GLEN---QMYTFLVRAKDGGNPTKSSV-----------VPVYVKILAPEVPVPKFIESHYRFAIEEDLSLGSEIDVIQAES-DQPVFYSLVKGNTPESNQDEVFVVDPSSGSLKLDKKLDHESTKWYQLTLQAQSEYEGSKVVSAVDISIQVKDVNDNRPLFESNPYEAFVVENLPGGTSVIQVKATDLDSGTNGHVVYNLDPNQETRDIVEL---FAINSESGWITTLKELDRETRNKYTVSVLATDRGDKVQLMASTRVDVTVV----DVNDNPPKFTAEIYKGTVSEDDPPGGVIAILSTTDLDTEENNKQISYFITGGDPLGQFAIEHTQGEWKVSVRKPLDREEKDNYL-LNITATDGTFTAKA--VVEVKVLDANDNSPICEKSFYMESVPEDSPAGRLILQVSATDADIRSNAQ-ISYELLGPGSEH-FSIDSETGELKTLLPLDREEEEVHKMKVRALDGGGRFCEAEVEITVEDVNDNPPQF---TTDPYTFTVFENTEINTPVARLYASDLDTGANAEILYSLLDSADGVFSIEEETGVVRLDRPLDRELQSLYTLRAQATDRGSPRHLSSHTTVSVSILDINDNPPVFERREYTATVAEDIPVGTQVLRIHAASRDTEAGTEITYAIINGNERGAFRVDPQTGGVFVIEPLDYETAHEFYLTVEATDGGTPSLSDLATVNINLTDVNDNSPVFNQDIYSAVISEDAELGK-TVLTVMADDADGPSSNQVRFSII------DGNQGSP-------FTIDPVRGEVKVARLLDREKTSGYTLTVLASDNGSPARSSSATINVDVSDINDNPPIFSQANYSIIIQ-------ENQPIGAS-----VLQLTVSDRDASHNGPPFTFSIIRGNEGDFF-----RITPQGVLVSAATLSRQTQEFYLLQAQVTDSGRPPLVSTAFVSVRLIEESIYPPSILPLDIFITTATDEYSGGVLGK------IHATDQD-VYDTLTYSLAPDSSSTSE-NSGLFSVSPADGKLVARGNLDAGQYVLNITVTDGRFTAAARVNIHVRQATAQALDNSIAVRFSAIAPEEFIGDYWRNFLRALRNIAGVRRGDVQLVSLQPAADASGDLEVLLA---------------------------LERSGSP----------FQPQEVLYRKLNASVGVIEEMT-------GVRIVRVMKKLCAGLD-CPLSFCQETIALETGAVSA-YSTARISFVTPRHMRTAKCLC----EGAECSILSKLCEGSPCPDGMECVEDPTHSK-YRCICPEGKQEECSERQSLT---------------------FSGNGYARYRLMENENKEEMKLSLRLRTFSTHATHTGGECLLLTPSILPKKEEKTESDGPGVVSV-HST-----------QVSDGQWHTVSLEVDG------NYARLVLDQVHAASGTAPGTLRTLNLDTSMYFGGH----VRPASGSGRLVMN-GLRGCLEGIVFNGRELPLSQV-----RGAHSVLEELVEAAPGCSLAPPIQGCTSNPCTNGGTCLALP-----NGGYFCKCTAAFMGTHCEVTISPCASNPCLYGGTCIPRGGDFYCQCRGQYSGQRCQLGPYCTD--NPCKNSGKCIDS-----LDGPVCECEPGFQGERCLSDVDECLKNP--CGNG-GHCQNTYGSFSCNCSNGYSGQHCEL 4165          

HSP 2 Score: 213.386 bits (542), Expect = 6.174e-54
Identity = 324/1364 (23.75%), Postives = 565/1364 (41.42%), Query Frame = 3
Query: 7206 PLFDKSKYSVIVPED-ALKDFIVTTVKA---ISSTGHTILYTITNGNDEELF--------DLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWIL-----VKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNSKL--IYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVH--DFTHXXXXXXXXXXXXIKNH----PPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCE-EPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIM--------------------DFETQSQYRINVEYRVDNSPLM------ATRTILIDLIDQND---------------------CPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKD--YEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKA--GHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPL-QLKFLASDRLHWSKE---EFILNIRVIDVNDHAP-VCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVE---SKKCSFKILINVLDINDNA-----PRFVHTSIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSS-FSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLI-KKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNI-------PENTLVSKLT-IGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIF 10988
            PLF +S Y+  + E+ A K ++ + VK    I+     I Y I +G++E LF        D  F     + G   I     L+ E +  + L + A + +S+    T V I VLD ND  P+F  ++YS S+ EN  I   +  +      +  +    +S +   D        F ++ T+G +++   LD+     +E  IL     +K  G    ++ A + V +   ND+ P        A+   +      VV     D   N ++  +  V  +    FK  ++S   +  Q+  ++++   S    + + +   D  +    + +     +  H    PP F+   + ++VSE   +++ +  + A      K+ +L+Y      D   F ++  +G +     L  +  + +EL VV SD   K     V+I V D+N+N P  +Q  Y+ + +     TGT   S+L + A D D      + Y         SIA V+S    +      I+ +  L   + +    +Y +  +  +    Y   + T        VT+ +N L D K +   + C     +++   + I  +  I + E++     + + +  +V   FE++ + G +  K+ +                    + ETQ  + +N+     + P+          ++L + + Q                        P   D     I + ED+P+G++++   A D D  + GK V     Y +   +    F ID D GW+   + +D E T    L ++  D       ++  L + + D ND  P + K      +EI+E     S T    V ++ AKD D        + ++ + +      +   +E+G V +  PLD E  ++P+  LK  A D+     +     +L I + DVND+ P   P    + + E +  G+VI  L+A+D D     + + Y+L++  D     V+ L+G V +   LD E     +    A D     S   S  I + V+D+N+N      P FV        E+ P G+ + KI A D D G + +I Y I D S    F+ID DTG++R   LLD E  P + L + A+D G  P S+   V I + DVND+ PQ         V E +     +I I+A   D   + ++SY++ +   Q FF +   +G +T   +KLD E   E+ L +  SD+G P+ STT    + V  +++N     F+  V+ I       PE     K   + +V A D D G N+ ++YS      + K             F I PKTG ++
Sbjct:   30 PLFTQSVYNATIYENSAAKTYVESPVKMGIYITDPTWEIRYKIVSGDNENLFKAEDYHLGDFSFLRIRTKGGSSAI-----LNREVRDHYILTVKAMEKNSNAEARTRVRIQVLDTNDLRPLFSPTAYSISLPENTAIRTSVAKVMATDADIGTNGEYYYSFREWTD-------MFSVHPTSGVVTLTGKLDYSETKQYELEILAVDRGMKLYGSSGFSSMAKLTVRVDQANDHAPVITAVTLAAS-ETDKDPTYAVVTVEDNDQGANGEIASLSVVAGDPLQQFKAMRTSPGSKEYQIKAVKQVDWDSQPFGYNLTLQAKDKGNPPQFSSAKVIHVMSPHFKVGPPKFIQAIYRVNVSEFAPLHTPVVMVTAVP----KYPQLKYAFRHRLDKNHFAINPDSGLITTAAPLHADSVNKYELEVVTSD---KKAVTKVIIDVIDVNNNGPEFKQTSYKAS-LDENMPTGT---SVLTVKATDLDSGENGYVTY---------SIANVNSQPFVIDYFSGVISSSETL---DYELMPRIYTLKVRASDWGSPYRREVET-------QVTIMLNNLNDNKPLFENVDCDATVPRDHGVGDQITTVSAIDADELQLVRYRIKAGNDLNV---FEMNPSSGVLSLKQTLSEGEAAKVSYHSLQIIASDGEHETQPMF-LNITVVTAHKPVQVKCVDTGVASMLAEKLLQGSKVHTQSEPEDHFQDFHSVNRVAPQFADTFPSVIEVKEDLPVGARIVHLSASDSDSGFNGKLV-----YVISGGDAESRFIIDMDSGWLKVFAPLDRETTDHYTLNITVYDLGIPQKSSSRLLDVKILDANDNSPQFLKE--TYSVEISE-----SSTVGTEVIQVEAKDKDLGDNGVVRYSILADTD-----QFAIDTETGIVTVKKPLDRE--VQPVFVLKIAARDQATAEPQLVSTVLLKITLEDVNDNPPKFIPPNYHVRVREDLPIGTVIMWLEAHDPDVGPS-SQVRYSLIDSGDGK-FEVDKLSGAVRIVQNLDYEKKQVYSLTAKAKDKGKPISLSSSCHIEVEVVDVNENLYRPLFPSFVDKGF--IKEDVPIGTSVMKITAQDEDKGRDGEIRYSIRDGSGLGIFTIDEDTGVIRTQELLDHETVPHYWLTVYATDRGVVPLSSFVEVYIEVQDVNDNAPQTSEPVYYPSVMESSPKDVSIIQIEAFDPDTKSSEKLSYKITSGNPQGFFSINQKTGLVTTTSRKLDREQQDEHILEITVSDQGVPAKSTTV--RVIVKVLDENDNSPQFMEKVYKIKLPVREKPEKERALKRDPVYRVIASDKDEGPNAEISYSIEEGDEQGK-------------FFIEPKTGMVY 1308          
BLAST of Ft-2 vs. Ensembl Zebrafish
Match: fat3a (FAT atypical cadherin 3a [Source:ZFIN;Acc:ZDB-GENE-060929-1254])

HSP 1 Score: 1007.67 bits (2604), Expect = 0.000e+0
Identity = 1075/4060 (26.48%), Postives = 1792/4060 (44.14%), Query Frame = 3
Query: 1575 LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKL--TNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIY--VPHQTTRDSTINHPNNYEESNKPIFGM-RNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMN-KKTELKYKIISGDTWGYFXXX-XXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSENDKSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEK---VTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDV----GSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTG-KLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFAS-YFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLN--PTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLK-LKSALDREERPFVQLLVLAKGWDGSYDYIN--VTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDL--KFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKY-DGRFSP-TNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVL--NEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSIN---VTVKINILYDKKKVNPIITCSI-MTIQENNPLNHIVAMCRI----SSTEMKGKWSLVPSSSP-FDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLI--DQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQL---------DSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSA---SDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVC-PQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFV--HTSIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPK-SNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDEL--TDECILLVAGSLYLGVRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKPNIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPC-GSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILG---VVNMPDWWLHVVIDGLQPRLLSLSSW--IEGDHFNQTILIGARNY-ISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWG-KSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQI 13517
            +++ ++D N+  P        + V E+  +G TV+++ A D D      I+Y +     LPF + +F   V   +E LD E+    F   V  +D G+P  R    +  + + +VN+ KP F    C   +SR+ P    +G  IA    +D D  + ++  I S + ++  F ++P+SG ++L    +H +++     +F++ + A D    S  M +N SVV   S      P    C +  +   +  +  + +  +     +E    +F + R  P F  + P+ I +RE+   GT V ++  K  D D   +  + +  +        FSI   +     I +   LDRE  D+Y + I + D GQP+   ++   + + D NDN P+FL        + EN  I   ++Q++ATD D   + +IQY L+     F I+S +G + +   LDRE    + + + A D         +  TL I + D+ND  P F  +  +    EDLP+G+ +  L   D DL    Q+RY +   +   F  D ++GA+ L  +L   T+  + L    KD G+P +L S +  ++    V+ N Y P      +  +++E+   GT V  +     D      V Y+I   S G+  F I+ E G I T   +DRE ++SYWL +Y  D    +      +VYI+V D NDN P+     Y A++ EN      +I ++A D D    +  L ++I SG+   +FSI+  TG I+T+ R +DRE           + L+V +SD G   +  TV + + ++D        +NDN   F   +    +     K     I RV A D D   NA + Y++       ++ +    F +D K+G     + SS       GT  I T K    A D G P  W  + A + I               D+       + +D +         ++++ +    Q        ++   D D  F V           K    +++A  L  +      +TLE+T        Q ++T+     N N P F+ P+ +   I I + T P   +  V A                    ++ D    + +S+ +S DP ++ +LF I+ N+G                 +I  AR  R  +     HIL         ++ ++Q   Y    R+LA+    VL     + ++   D++ +F+    D      +++G+ + +++A D+D G+N Q+ ++I + +   N F +D   G I + R L         L++  +D G P   + +VV + +     +++ P+  +++    + E+ ++ + +        T    +   +   I+   G + F + + +G I T  SLD E +   V + +   +  G  S  N+ I+V +   D NDNAP F   L   G ISE A   S+V  QSD  +       LVI A D D   N  + Y I+   A  +F +D  TG +    ++D E   +F    + ++D G P+L ++   E+ I ++D NDC PKF +D Y  VL+LPT+     LQ+   DPD N    + +S+ +G    F SI+P+TG L +  N      +F      N+R  DG+F ++  +T+       +  L    S     I EN  ++  + +  A    +  +  ++Y LL+   K  I   +G+++ +   LDREE+    LLV A   +         V V VTD ND  P+F+   Y   V           RV A+D D G NG V Y       F  D    F +D  SG + ++     +L   ++ + + A D G P LSS     V +V+   P+FD+  YSV V ED      +  + A S  G ++LYTIT+G+   LF + F          VI ++  LDYET P H LI+ ATD  +       V +TVLD+ND  P+F + SY A +SE+  I     ++ VL     + K      ++I D +  S+ HF I+ ++G I    +LD E   I  +  LVK  D  F P ++   + V + D NDN P F Q  + A+I+  + +G  V    A+D D +   +L Y ++  NE   +F++D +SG +  +    +++ +PS+  +   V V D   +  A V V       H P F    +   V EN    S++  I A D+D   FG +RY ++     ++F +DS +G +   + LDRE +S   L V   D G +  + +V + V D NDN+P+   + Y  +V  S    GT    ++Q+ A D D     ++ Y L S    Q    +D     +     W+    N                F      + S+ +  +     I    V+V I++L     +          T+ E+ P+  ++    +    S + +   ++ V   +P  + +  F +D   G I+  K +D E    Y   V   +    L A   + +++   D ND  P F++  Y   ++E +  G++++Q +A D D+     + YSL            D  E G  F ID   GW+ ++  +D+E+    +L V A    D A   ++TT+TI+V D ND IP + + P   G  + E     S+    VV  L+ +DNDS      + + IT  N    +A   V    ++ +  PLD E+  + L +   A+D L+ S     +++ V+D ND++PVC P +  + + E +     I  ++A D D+ +    + ++L   S      + P TG +     LDRE  S  + V  A D     C  ++++++LD+ND+ P F   H + + + EN    +++ +I A+D D G+NRK+VY ++D +   FSID+ +GI+ +  LLDRE Q  +H+V+ ASD G P + S++ N+ I +LD+ND+PP F        + ED  +G  ++ + A S DIG NA++ Y + +  +Q  F +   +G +++ + LDFE  ++YFLTV A+D G P LS  T V I + DVNDN P F    Y  +I E+  +   T+ KV A D DS +N  + YS +         +R      E+ F I P TG+I +N   DRE    Y   V   D G PA SS   V I+I D NDNPP F   +   +I          QE K  G    V +L + DKD   N  PF   +L+    + F +  + L  +++      G+ Y+    + VQ +D+G+P L     V V VI  S   P   PL+V  V    E   G    I ++   D+  AFD+LT+   + ++       + FK+    G I     LD+G Y+LN  VT+   +    + + +   + +M+  A  ++   + P+ F +R L   +   L SVM++     + V S                    V       QL      D+L+AV +     F+K++ +  ++ +    L ++ + S+V   N    D   C E QC+ TI ++     + +     +F+S  F   + C+C+       C      CA   C G  +    D ++ P + C+CP  K G+         G++S              + F+G  +I + + +   +  M++    R LQ    +M  + +    + I+   +GK+    D    P   +  S   + DG WH+V L + G    +++ D ++         R L+ + +  +E D    +I  GA+      R     K   +     GC+  V+LN+ +LP Q   +P  +  +G+   +L  GC   L    C A  C NG  C+     +     + C C    TG  CE   S+C  +PC +GG C    + F C C  G TG  C+     C   L  C     CI  T  S Y    C+C+    G  C +
Sbjct:  468 VKVILEDANDNAPSFAQQSYEVFVNESVAVGTTVVVVTASDDDHGENGYITYSMASLTPLPFSVQQFTGAVTTTQE-LDFESSLESFSFVVRASDWGSPYRRESEVNITVHLENVNDNKPLFEKVACVGVVSRELP----VGEVIATISAIDIDELELVKYKILSGN-ERGYFELNPDSGVMTL----RHSLITAAPKNSFSLKITATDGEHFSDPMFVNISVVQGKSP-----PKSFSCTETRVAQRLAEKLLKKAKASSKPKMDEGFIDLFSVNRQTPQFDKSFPTDITVREDVEVGTSVFQV--KALDGDTG-FNGQLLHAIADGNTDSCFSIGILN---GVISIFLPLDREKTDRYLLNITLYDLGQPQRSTWRLLTVYIADANDNAPQFLQDGGYHARISENTPIGTEVIQVEATDKDQGLNGEIQYSLLTSTSQFGINSSSGIVYVAGQLDRELVPLFILKVEARDRAERAAQRFSITTLKITLEDVNDCPPAFIPSVANARALEDLPVGTVIAWLDTQDPDLGLGGQVRYLLDNDYDGRFEVDKTSGAIRLTKELDYETQQFFNLTVRAKDKGRPVSLLSVSFVELEVVDVNENLYAPYFSSFAMNGSVKESVRIGTSVLQVSARDDDTGRDGEVQYSIRDGS-GLGRFTIDEETGVIYTTDLLDRETQDSYWLTVYATDLG-VVPQSAALQVYIQVEDVNDNSPLTSEPMYHATILENSPKDQSVIQIQAQDPDATTAEPRLSFRISSGNPQNFFSINPRTGLITTTSRKLDREQQAE-------HVLEVTVSDGGSSPRHTTVWVVIQVLD--------VNDNKPTFPEKMYQVRLPERSRKQRGAPIYRVFAYDQDQGANAELSYSI-------IDGNEDGKFIIDAKTG-----VVSSPKKQFSAGTYDILTVK----AVDNGRPQRW--ATARLHIEWIRRPPPNPIPLAFDEPLYNFTIMETDRV---------ADIVGVVSAQQQGSASLWFDITGGDVDSMFDV----------EKGVGTIVIAKPLDAEQRSFYNLTLEVTDGTNVANTQVHITVLDN--NDNPPVFSQPTYD---ITITEDTPPDTEVVQVLA--------------------SDRDERHRLTFSLQSSVDPSSM-RLFRIDPNSG-----------------VIYTAR--RLDHESRTQHILT--------IMVKDQEFPYR---RSLAR----VL-----IGVEDVNDHAPLFTMVMYDGQVYESAALGSAVLTVTALDKDKGQNAQISYSIDSGNTG-NTFRIDPVLGIISLARELDLSSIGHYVLSVKATDNGSPALSSTAVVRIAV--TLSNNAGPKFPQNEYQAEISESVAIGTSV-------VTVNALSLSTLTYDIRHGNGHRTFRINQYSGVITTQKSLDFETVSSYV-LIVTASNMAGQAS--NATITVVV--LDQNDNAPVFQ-QLHYRGSISEGAGLNSVV--QSDDGQ------PLVIRASDADRNHNALLVYQIMEESARRFFAVDAGTGSIRTIAQLDHETTPTF-RFHVNVRDSGHPQLSAERPAEVTIEVQDVNDCSPKFSQDSYEAVLLLPTYEGVEALQVFATDPDGNGQSELTYSLTDGSLEHF-SIEPSTGLLTVR-NSTFSKERF----RFNVRVSDGRFSSTALVTV-LVHEALDSGLAFTHSAYNANIEENNGNITTVAVVTA--LGNKLNEPLRYTLLNAGGKFRIKPTSGAIETVGVPLDREEKEEYGLLVQAGREEDRLRVARALVRVQVTDVNDNAPVFVGLPYYAAVQVEAEPGTAIFRVTAVDRDKGLNGEVNY-------FLQDELGHFEVDRVSGELRLRRAFEADLSSVEYQVLVFARDMGTPPLSSSVTFPVTVVNRAMPVFDRPFYSVKVSEDIPVWTPILGINASSPEGQSVLYTITHGDPGTLFSIGFDTG-------VISVIAGLDYETSPAHRLIVRATDCLTGARAEVDVEVTVLDVNDNPPVFEQPSYKAVISESAMIG--TAALQVLATDSDSEKNAAVRYQIIPDRT-NSTDHFHIDSSSGLILTARSLDHET--IQRYVFLVKATDNGFPPLSSEVWVTVDVTDTNDNAPVFNQLLYEASINELAPKGHFVTCIQASDADRSDAERLQYGLVSGNERM-LFELDAASGVLTLSGQRRMQR-MPSA--ITLNVSVSDGVFTSTAQVHVRVERANLHSPQFTQGMYEADVRENAPPGSKVIAIRAQDADPGPFGDVRYVLLSDAARDLFTIDS-SGQITTLERLDREERSEMVLSVAAVDAGGRSGYCSVRVTVIDENDNVPLFGASEYHASV-RSEVEPGTL---VIQVQAWDLDQDANGQVSYSLYSEASLQVTELLD-----IDPDSGWVVTKGN----------------FAPLRGSVLSFLVKASDGGAPIRHSLVSVYIHVLSADAHIPSFSQPQFSFTVPEDMPIGSLLGAVHLHTSTSHSSLPVSFAAVIGQTPESNSEGVFLVDKESGMIKLDKALDRELTQIYHFKVVAMLQQGRLDAVSAVDVEVKVQDVNDNKPAFESDTYETSVTEGLSPGTRILQVRALDPDWAANGQVTYSLAPPGLLGGSGGEDIEEHGAYFTIDSSSGWISTLKGLDHEQNPAHSLTVWAFDLGDPASQSSSTTITIAVSDSNDNIPQFLQ-PRYYG-SVRE-----SDAPGEVVAVLNTRDNDSSPGNRQVTYHITGGNRGGVFALGLVQGEWKLYVKRPLDREEQERYL-INVTATDGLYVSTAS--VDVTVMDTNDNSPVCEPALYSVSVSEDVPLNKQILRVKATDADTGSNAQ-IQFSLF-GSGAEDFFIHPHTGELKTAVALDREKVSRYSLVARATDGGGLWCEAEVVVDLLDVNDSPPMFSMPHYTTSVY-ENTATKALLTRIQAIDPDLGVNRKVVYSLVDSADGFFSIDKSSGIVVLERLLDREIQSSYHIVVRASDQGVPVRLSSLANITITVLDINDNPPVFERRDYLATLPEDVAVGTEVVQVYAASKDIGTNADIYYNIRSGNQQGHFTINVNTGAISVSRALDFESCKDYFLTVEATDGGTPPLSAVTMVNINLTDVNDNAPIFSRDAYSVSISEDANIGD-TVVKVMAEDVDSYVNGDILYSIIS-------GDR------ENQFFIEPITGQIKVNKQLDRETMAGYSLSVRALDSGTPAMSSTVLVNIDISDVNDNPPTFTPANHTAVI----------QENKPLGT--SVLQLSVIDKDASHNGPPFHFHILSGNEGAWFKLDREGLLTSNQVFRRSEGTEYV----IHVQASDSGRPPLSSVASVLVRVIEESVHKPAASPLHVHIVTMEDEFPGGV---IGQIHATDQD-AFDILTYGHTHQQS-------SLFKVSPRDGRIIALSGLDAGRYTLNATVTDGRFTVSVPVSVHVEQASVEMLHDAVTVRFDRVSPHDFISRHLP-SVRRVLSSVMSTSRPDALHVLS--------------------VQPVEATGQL------DLLVAVESAEGGGFYKAALVTQKLSSARRQLDQVLRVSAVLDKNCSGLD---CREAQCEQTITLDSH-SLLTYSSTKTSFVSPKFHRNTRCVCSDG----SCSAASEVCADMRCPGDMQCVGTDSSRGP-YACQCPPGKLGECA-------GHTS--------------LSFSGNSYIKYRVTDGERSGEMKLALRIRTLQSKGIIMYTRADPCSVLKIE---EGKLWFQLDCGNSPR-SIGISGRLVNDGNWHHVVLELRGNYSSLSLDDMYVE--------RRLTTAKFRPLEAD---LSIYFGAQVLPPDARSLTEMKGPRVTNGFQGCLDSVVLNDNELPLQNKRSPY-AEVVGL--TDLKLGC--VLYPDACVAQPCLNGATCI-----SLPSGGFSCSCSALHTGGRCETEISVCMPNPCQNGGVCKPIGNAFICSCKRGYTGATCEEDVNECEREL--CENGGICI-NTFGSFY----CNCTPGFVGSACSV 4161          

HSP 2 Score: 252.292 bits (643), Expect = 9.337e-66
Identity = 456/1886 (24.18%), Postives = 773/1886 (40.99%), Query Frame = 3
Query: 5865 VKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDK-----GSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTF----PSAPLLQLRVHDPDLNPTI-LFSILNGKESRFFSIDPT---TGWLKISTNDIPVSGKFPSVVLINIRAFD-GKFETSCNITINSFDNTRNKVLPLEKSQVV------------------WEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILL--SEQPKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFT---DVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS-STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHT-------------LIISATDPSSSLSHSTTVL------------------------ITVLDINDELPIFLKS-SYSASVSENMPINHEIISISVLLQKVS-NSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQ-PAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXI-----KNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVL---IHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIM---TIQENNPLNHIVAMCRIS---STEMKGKWSL-VPSSSPFDVQNDFEIDSNYGYI-RAKKIMDFETQSQYRINVEYR-VDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDI--PLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISV---YDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSES-GEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQ-IPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDP---YLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVE--SKKCSFKILINVLDINDNAPRFVHTSI-APFLENAPHGSVIGKIHAVDADSGINRKIVYRI-LDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMI--TEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASD-KGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGK------VTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSK--TNVTIEIEDKNDNPPEFAQPSFRFLI 11156
            V + + D+ND  P F  P   +  I+ES               L  S+    + A D D G NG+  Y    R    F +   +GV+SL+ K+D ++   + DL I+  D+     G+  + S  +L   + +E  N+  P         V + P +    P   ++ +   D   N  I   SI+ G     FSI+ T   +  +    + +  S +F   VL  +  FD   +    N+++ + D  R     L   Q+V                  +E+  +    P  ++   K     +    +YIL   ++     IN +TG +     L + ++   +L VL    D     + V V + D ND  P F  + YE  V+ +++     + V A D D GENG + YS+  + P    L F++   +G +T       E   + F+  ++A+D G P          V ++ V+D  PLF+K     +V  +     ++ T+ AI       + Y I +GN+   F+L+  +  +     +I    K  +  K   T              ++    P  S S + T +                        I +  +N + P F KS     +V E++ +   +  +  L      N ++    L  I D +  S   F I    G ISI   LD E    +   I +   G+   +    + V+I D NDN P+F+Q   ++A IS  +  G+ V+   ATD D   N ++ Y +L      F I+ SSG +      + E L+P   +   +V   D         S+  + I      + PP+F+ +  +    E+  V + I  +   D D    G++RY +   +D   F +D  +GA+ L K LD E +    L V   D G      +V    + V D+N+N+      +    +  S K +     S+LQ+ A+D D      + Y               SI     L    I++ + + +  T       Q ++ +    +Y+  +     S ++ V +++  + D    N  +T   M   TI EN+P +  V   +     +T  + + S  + S +P   QN F I+   G I    + +D E Q+++ + V      +SP   T  ++I ++D ND  P F    Y + + E      G+ + +  AYD+D      + YS+  +D  E G  F ID +  V S     +       L V A D        T  + +               + P+    I ET     +    +V  +SA+   S     SL F IT  +++   + F V +  G +++  PLDAE+      L    +D  + +  +  ++I V+D ND+ PV  Q   D+ I E   P + +  + A DRD   +   LT++L    DP    L  ++P +G +     LD E  +     +   D E   ++   ++LI V D+ND+AP F          E+A  GS +  + A+D D G N +I Y I    + ++F ID   GI+ +A  LD      + L ++A+D G P  S+   V+I +   N++ P+F     +  ++E   IG  ++T+ A+S      + ++Y +        FR+   SG +T  K LDFE    Y L V AS+  G  S +T T   + V+D NDN P F  L Y  +I E   ++ +          + A D+D   N++L Y  +                   FF ++  TG I      D E  PT++F V+V D G P  S++    VTIE++D ND  P+F+Q S+  ++
Sbjct:  141 VSVQVLDMNDLRPLF-SPTTYSVTIAEST-------------PLRTSIAQ--VTATDADIGSNGEFYYFFKERM-ELFAVHPTSGVVSLSGKLDVDIQSRY-DLEIQAVDRGMKLYGNNGVSSTAKL--FVHVERINEHVPTLSI-----VTLAPVWTEKSPIIAVVTVEDLDEGKNGEIETVSIVAGDLLELFSIERTDVPSQEMVDEEDSMKGSNEF---VLRAMEQFDWDSYPFGLNLSLQARD--RGTPQKLSAVQIVHLRLSRPPPVEVTFQKDQYEVLLSEVAPPGTIVEAVKL--QPEPDDAEYILTPSADSGFFSINTMTGVISTARWLTQLKQEVFELEVLEVDSDLR---VKVKVILEDANDNAPSFAQQSYEVFVNESVAVGTTVVVVTASDDDHGENGYITYSMASLTP----LPFSVQQFTGAVTTTQELDFESSLESFSFVVRASDWGSPYRRESEVNITVHLENVNDNKPLFEKVACVGVVSRELPVGEVIATISAIDIDELELVKYKILSGNERGYFELNPDSGVMTLRHSLITAAPKNSFSLKITATDGEHFSDPMFVNISVVQGKSPPKSFSCTETRVAQRLAEKLLKKAKASSKPKMDEGFIDLFSVNRQTPQFDKSFPTDITVREDVEVGTSVFQVKALDGDTGFNGQL----LHAIADGNTDSC--FSIGILNGVISIFLPLDREKTDRYLLNITLYDLGQPQRSTWRLLTVYIADANDNAPQFLQDGGYHARISENTPIGTEVIQVEATDKDQGLNGEIQYSLLTSTSQ-FGINSSSGIVYVAGQLDRE-LVP---LFILKVEARDRAERAAQRFSITTLKITLEDVNDCPPAFIPSVANARALEDLPVGTVIAWLDTQDPDLGLGGQVRYLLDNDYDGR-FEVDKTSGAIRLTKELDYETQQFFNLTVRAKDKGRPVSLLSVSFVELEVVDVNENL--YAPYFSSFAMNGSVKESVRIGTSVLQVSARDDDTGRDGEVQY---------------SIRDGSGLGRFTIDEETGV-IYTTDLLDRETQDSYWLT---VYATDLGVVPQSAALQVYIQVEDVND----NSPLTSEPMYHATILENSPKDQSVIQIQAQDPDATTAEPRLSFRISSGNP---QNFFSINPRTGLITTTSRKLDREQQAEHVLEVTVSDGGSSPRHTTVWVVIQVLDVNDNKPTFPEKMYQVRLPERSRKQRGAPIYRVFAYDQDQGANAELSYSI--IDGNEDG-KFIIDAKTGVVSSPKKQFSAGTYDILTVKAVDNGRPQRWATARLHIEWIRRPPPNPIPLAFDEPLYNFTIMET-----DRVADIVGVVSAQQQGS----ASLWFDITGGDVD---SMFDVEKGVGTIVIAKPLDAEQ-RSFYNLTLEVTDGTNVANTQ--VHITVLDNNDNPPVFSQPTYDITITEDTPPDTEVVQVLASDRDERHR---LTFSLQSSVDPSSMRLFRIDPNSGVIYTARRLDHESRTQHILTIMVKDQEFPYRRSLARVLIGVEDVNDHAPLFTMVMYDGQVYESAALGSAVLTVTALDKDKGQNAQISYSIDSGNTGNTFRIDPVLGIISLARELDLSSIGHYVLSVKATDNGSPALSSTAVVRIAVTLSNNAGPKFPQNEYQAEISESVAIGTSVVTVNALS-----LSTLTYDIRHGNGHRTFRINQYSGVITTQKSLDFETVSSYVLIVTASNMAGQASNATIT---VVVLDQNDNAPVFQQLHYRGSISEGAGLNSVVQSDDGQPLVIRASDADRNHNALLVYQIME-------------ESARRFFAVDAGTGSIRTIAQLDHETTPTFRFHVNVRDSGHPQLSAERPAEVTIEVQDVNDCSPKFSQDSYEAVL 1905          

HSP 3 Score: 100.523 bits (249), Expect = 6.151e-20
Identity = 71/216 (32.87%), Postives = 107/216 (49.54%), Query Frame = 3
Query:  219 ESLSISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTKY--TASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRG 860
            E   + FT+PLY+  +Y++   R Y A    +MGI       ++ Y+I    E    F+AE   +GDF +LRIRTK    A LNRE    Y LT++   +  +   +     T+V ++VLD ND  P+F    +     E+  + T I  VTATDAD G N E +Y+  +           F+++P SG++    KL D    S+   +I A+ RG
Sbjct:   34 ERFRLQFTQPLYHASVYENSAARTY-ASSQVRMGIPLQHHSWEVRYRITSGDE-EGFFKAEEYTLGDFCFLRIRTKGGNAAILNREVQDNYVLTVKASLKGDTLEAW-----TKVSVQVLDMNDLRPLFSPTTYSVTIAESTPLRTSIAQVTATDADIGSNGEFYYFFKERMEL-------FAVHPTSGVVSLSGKL-DVDIQSRYDLEIQAVDRG 234          

HSP 4 Score: 97.4413 bits (241), Expect = 5.750e-19
Identity = 142/585 (24.27%), Postives = 248/585 (42.39%), Query Frame = 3
Query: 9057 IMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSA-VDYEETKLINLVVSASDKA-------GHVTNTTLTISVYDVNDEIP---------YWTKNPPVDGIEITETCD----GCSETFPRVVYRL----SAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLL--LHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP------DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPFL-ENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEH-HLVIEASDCGKP-PKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYF-LTVRASD 10694
            I++ E Q  Y + V+  +    L A   + + ++D ND  P+F  + Y++ I+E  PL + + Q  A D D  G +  FY  ++    E    F +     V S+S  +D +     +L + A D+        G  +   L + V  +N+ +P          WT+  P+  +   E  D    G  ET   V   L    S +  D  SQ+     ++  ++         +  S E +L  +   D +     L L   A DR      + +  ++++ +    P   ++       ++++ E   PG+++  ++       A+Y      L   +D     +  +TG VI  A    +    V F +  L+V+S     K+ + + D NDNAP F   S   F+ E+   G+ +  + A D D G N  I Y +   +   FS+ + TG +     LD E   E    V+ ASD G P  + +  N+ + L +VND+ P F  +     V+ +  +G+V+ TI AI  DI     V Y++++  E+ +F L   SG +TL   L     +  F L + A+D
Sbjct:  113 ILNREVQDNYVLTVKASLKGDTLEAWTKVSVQVLDMNDLRPLFSPTTYSVTIAESTPLRTSIAQVTATDADI-GSNGEFYYFFK----ERMELFAVHPTSGVVSLSGKLDVDIQSRYDLEIQAVDRGMKLYGNNGVSSTAKLFVHVERINEHVPTLSIVTLAPVWTEKSPIIAVVTVEDLDEGKNGEIETVSIVAGDLLELFSIERTDVPSQE-----MVDEED--------SMKGSNEFVLRAMEQFDWDSYPFGLNLSLQARDR---GTPQKLSAVQIVHLRLSRPPPVEVTFQKDQYEVLLSEVAPPGTIVEAVKLQPEPDDAEY-----ILTPSADSGFFSINTMTG-VISTARWLTQLKQEV-FELEVLEVDSD-LRVKVKVILEDANDNAPSFAQQSYEVFVNESVAVGTTVVVVTASDDDHGENGYITYSMASLTPLPFSVQQFTGAVTTTQELDFESSLESFSFVVRASDWGSPYRRESEVNITVHLENVNDNKPLFEKVACVGVVSRELPVGEVIATISAI--DIDELELVKYKILSGNERGYFELNPDSGVMTLRHSLITAAPKNSFSLKITATD 666          

HSP 5 Score: 70.0922 bits (170), Expect = 1.185e-10
Identity = 113/453 (24.94%), Postives = 186/453 (41.06%), Query Frame = 3
Query: 1572 TLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTKISYYLFDQN-KLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNE--YKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDN-IQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLT--NFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADR-LDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDS-FQIPMTLPENYDIKKR--IVQIKATDAD---SKDIQYRLV--NFRRVFKIHSRTG 2885
            TL+I+++DVN+ PP  + + +     E+  +G  +  +   DPD+       YL D +    F + +    + + KE LD ET Q+ F + V   D G P++   ++  E+E+ DVNE  Y P F       ++         +    A D D  GRD  +Q SI   S     F+I  E+G +     +   +L + T  ++ + + A D G+V    AL                         +Y+  +   D       N   +++P++        AT       I E S K   V  I ++  D D    E    F + S   Q  FSI   +  +  I    R LDRE   ++ + + V D G           IQV D+NDN P F +  +Q+   LPE    ++   I ++ A D D   + ++ Y ++  N    F I ++TG
Sbjct:  931 TLKITLEDVNDCPPAFIPSVANARALEDLPVGTVIAWLDTQDPDLGLGGQVRYLLDNDYDGRFEVDKTSGAIRLTKE-LDYET-QQFFNLTVRAKDKGRPVSLLSVSFVELEVVDVNENLYAPYFSSFAMNGSVKESVRIGTSVLQVSARD-DDTGRDGEVQYSIRDGS-GLGRFTIDEETGVI-----YTTDLLDRETQDSYWLTVYATDLGVVPQSAALQ------------------------VYIQVEDVND-------NSPLTSEPMY-------HAT-------ILENSPKDQSV--IQIQAQDPDATTAEPRLSFRISSGNPQNFFSI---NPRTGLITTTSRKLDREQQAEHVLEVTVSDGGSSPRHTTVWVVIQVLDVNDNKPTFPEKMYQV--RLPERSRKQRGAPIYRVFAYDQDQGANAELSYSIIDGNEDGKFIIDAKTG 1322          

HSP 6 Score: 63.5438 bits (153), Expect = 1.009e-8
Identity = 131/536 (24.44%), Postives = 220/536 (41.04%), Query Frame = 3
Query: 6840 YINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQP-----ALSSFTDVFVDI--VSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAI--SSTGHTILYTITNGNDEELFDLDFTAAYLQ-----------PGPCVIRLVGKLDYETKPFH-TLIISATDPSSSLSHSTTVLITVLDINDELPI---FLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLD--TNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPS-SGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTL 8366
            +  V+V V D ND +P+F    Y   +  +        +V A D D G NG      YY      +L FA+   SGV+++ SG     +  ++ + I+A D+G        +SS   +FV +  +++  P       + +  E +     V TV+ +     G     +I  G+  ELF ++ T    Q               V+R + + D+++ PF   L + A D  +    S  V I  L ++   P+   F K  Y   +SE  P     I  +V LQ   +    E+ L    DS       F IN  TG IS    L      + E  +L + D       R  ++V + D NDN P F Q ++   ++   + G+ VV+  A+D D   N  + Y + +     F + Q +G +   Q  + E  L S S VV        +      N++V+  ++ ++ P F        VS    V   I  I A D D+ +   ++Y ++ G +   F L+  +G + L+ +L
Sbjct:  138 WTKVSVQVLDMNDLRPLFSPTTYSVTIAESTPLRTSIAQVTATDADIGSNG----EFYYFFKERMEL-FAVHPTSGVVSL-SGKLDVDIQSRYDLEIQAVDRGMKLYGNNGVSSTAKLFVHVERINEHVPTLSIVTLAPVWTEKS-PIIAVVTVEDLDEGKNGEIETVSIVAGDLLELFSIERTDVPSQEMVDEEDSMKGSNEFVLRAMEQFDWDSYPFGLNLSLQARDRGTPQKLS-AVQIVHLRLSRPPPVEVTFQKDQYEVLLSEVAPPG--TIVEAVKLQPEPDD--AEYILTPSADSG-----FFSINTMTGVISTARWLTQLKQEVFELEVL-EVDSDL----RVKVKVILEDANDNAPSFAQQSYEVFVNESVAVGTTVVVVTASDDDHGENGYITYSMASLTPLPFSVQQFTGAVTTTQELDFESSLESFSFVVRASDWGSPYRRESEVNITVHLENVNDNKPLFEKVACVGVVSRELPVGEVIATISAIDIDELEL--VKYKILSGNERGYFELNPDSGVMTLRHSL 649          

HSP 7 Score: 63.1586 bits (152), Expect = 1.422e-8
Identity = 87/355 (24.51%), Postives = 155/355 (43.66%), Query Frame = 3
Query: 5472 LFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLP---QLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPST-GKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGK 6524
            L L++   D G P +++    AV+I   R+S   P     ++ Q ++++ E     +I+  +KL+        A+Y+   + PS     F +   TG I T   L + + Q++  +++       L    +  + VK+ + D NDNAP F             A     VF+    E ++     +V+ A D D G+NG I Y + S     F + Q+TG ++   ++D E         +R  D GSP     E + I + +E+ ND  P FEK   + V+         +  +   D D    + + IL+G E  +F ++P +G + +  + I  + K  +   + I A DG+
Sbjct:  351 LNLSLQARDRGTPQKLS----AVQIVHLRLSRPPPVEVTFQKDQYEVLLSEVAPPGTIVEAVKLQPEPDD---AEYI---LTPSADSGFFSINTMTGVISTARWLTQLK-QEVFELEV-------LEVDSDLRVKVKVILEDANDNAPSF-------------AQQSYEVFVN---ESVAVGTTVVVVTASDDDHGENGYITYSMASLTPLPFSVQQFTGAVTTTQELDFESSLESFSFVVRASDWGSPYRRESE-VNITVHLENVNDNKPLFEKVACVGVVSRELPVGEVIATISAIDIDELELVKYKILSGNERGYFELNPDSGVMTLRHSLITAAPK--NSFSLKITATDGE 668          

HSP 8 Score: 60.4622 bits (145), Expect = 9.587e-8
Identity = 39/125 (31.20%), Postives = 63/125 (50.40%), Query Frame = 3
Query: 10326 ASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKG 10700
            A++L+RE Q  + L ++AS  G   ++  T V + +LD+ND  P F      + +AE T +   +  + A   DIG N E  Y        F +   SG ++L  KLD ++   Y L ++A D+G
Sbjct:  111 AAILNREVQDNYVLTVKASLKGDTLEA-WTKVSVQVLDMNDLRPLFSPTTYSVTIAESTPLRTSIAQVTATDADIGSNGEFYYFFKERMELFAVHPTSGVVSLSGKLDVDIQSRYDLEIQAVDRG 234          

HSP 9 Score: 58.9214 bits (141), Expect = 2.596e-7
Identity = 73/306 (23.86%), Postives = 131/306 (42.81%), Query Frame = 3
Query: 2664 PKNCIFKRFEIQVED-------INDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADS--KDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSP--LTEYRLIAVVKDNGKP----QALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRINNEGEIRTVS 3536
            P +C  +RF +Q            ++  R   S Q+ M +P  +   +   +I + D +   K  +Y L +F    +I ++ G   +   L+RE +D Y + + AS       +L A   +++ V D+ND +P+F+  +YS+ + E  P+ + + Q+ ATDAD+  N +  Y       + F    ++G V L  KL     + Y L     D G        +SS A   ++ +++  N ++P+L                  + ++ P  ++K P   V T+     G         GEI TVS
Sbjct:   28 PGHCQGERFRLQFTQPLYHASVYENSAARTYASSQVRMGIPLQHHSWEVRYRITSGDEEGFFKAEEYTLGDFC-FLRIRTKGGNAAI---LNREVQDNYVLTVKAS---LKGDTLEAWTKVSVQVLDMNDLRPLFSPTTYSVTIAESTPLRTSIAQVTATDADIGSNGEFYYFFKE-RMELFAVHPTSGVVSLSGKLDVDIQSRYDLEIQAVDRGMKLYGNNGVSSTAKLFVHVERI--NEHVPTLS-----------------IVTLAPVWTEKSPIIAVVTVEDLDEG-------KNGEIETVS 299          

HSP 10 Score: 56.9954 bits (136), Expect = 9.740e-7
Identity = 53/192 (27.60%), Postives = 88/192 (45.83%), Query Frame = 3
Query:  231 ISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIR-DSSEIFNTFEAESKLVGDFFYLRIRTKYTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKL 803
            ++F +PLYN  I +   V   V       G+   +++G  +        ++ + F+ E K VG     +        L+ E+  FYNLT++                TQV I VLD NDN P+F    ++    E+    T++  V A+D DE     + + L QS++   S++  F I+P SG+IY  ++L
Sbjct: 1372 LAFDEPLYNFTIMETDRVADIV-------GVVSAQQQGSASLWFDITGGDVDSMFDVE-KGVGTIVIAK-------PLDAEQRSFYNLTLE-------VTDGTNVANTQVHITVLDNNDNPPVFSQPTYDITITEDTPPDTEVVQVLASDRDE--RHRLTFSL-QSSVDPSSMRL-FRIDPNSGVIYTARRL 1537          

HSP 11 Score: 54.6842 bits (130), Expect = 4.659e-6
Identity = 41/116 (35.34%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  459 LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNEN-FEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKL 803
            L+RE+   Y L I  L++    G+ + S    + + + D NDN P F+ +  +     EN  I T++  V ATD D+G+N EI Y L    +TS S    F IN  SGI+Y   +L
Sbjct:  798 LDREKTDRYLLNIT-LYD---LGQPQRSTWRLLTVYIADANDNAPQFLQDGGYHARISENTPIGTEVIQVEATDKDQGLNGEIQYSL----LTSTS---QFGINSSSGIVYVAGQL 902          
BLAST of Ft-2 vs. Ensembl Zebrafish
Match: fat3a (FAT atypical cadherin 3a [Source:ZFIN;Acc:ZDB-GENE-060929-1254])

HSP 1 Score: 1006.51 bits (2601), Expect = 0.000e+0
Identity = 1075/4060 (26.48%), Postives = 1792/4060 (44.14%), Query Frame = 3
Query: 1575 LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKL--TNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIY--VPHQTTRDSTINHPNNYEESNKPIFGM-RNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMN-KKTELKYKIISGDTWGYFXXX-XXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSENDKSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEK---VTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDV----GSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPSTG-KLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFAS-YFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLN--PTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLK-LKSALDREERPFVQLLVLAKGWDGSYDYIN--VTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDL--KFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKY-DGRFSP-TNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVL--NEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSIN---VTVKINILYDKKKVNPIITCSI-MTIQENNPLNHIVAMCRI----SSTEMKGKWSLVPSSSP-FDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMATRTILIDLI--DQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQL---------DSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSA---SDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVC-PQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFV--HTSIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPK-SNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDEL--TDECILLVAGSLYLGVRTLWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKPNIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPC-GSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILG---VVNMPDWWLHVVIDGLQPRLLSLSSW--IEGDHFNQTILIGARNY-ISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWG-KSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQI 13517
            +++ ++D N+  P        + V E+  +G TV+++ A D D      I+Y +     LPF + +F   V   +E LD E+    F   V  +D G+P  R    +  + + +VN+ KP F    C   +SR+ P    +G  IA    +D D  + ++  I S + ++  F ++P+SG ++L    +H +++     +F++ + A D    S  M +N SVV   S      P    C +  +   +  +  + +  +     +E    +F + R  P F  + P+ I +RE+   GT V ++  K  D D   +  + +  +        FSI   +     I +   LDRE  D+Y + I + D GQP+   ++   + + D NDN P+FL        + EN  I   ++Q++ATD D   + +IQY L+     F I+S +G + +   LDRE    + + + A D         +  TL I + D+ND  P F  +  +    EDLP+G+ +  L   D DL    Q+RY +   +   F  D ++GA+ L  +L   T+  + L    KD G+P +L S +  ++    V+ N Y P      +  +++E+   GT V  +     D      V Y+I   S G+  F I+ E G I T   +DRE ++SYWL +Y  D    +      +VYI+V D NDN P+     Y A++ EN      +I ++A D D    +  L ++I SG+   +FSI+  TG I+T+ R +DRE           + L+V +SD G   +  TV + + ++D        +NDN   F   +    +     K     I RV A D D   NA + Y++       ++ +    F +D K+G     + SS       GT  I T K    A D G P  W  + A + I               D+       + +D +         ++++ +    Q        ++   D D  F V           K    +++A  L  +      +TLE+T        Q ++T+     N N P F+ P+ +   I I + T P   +  V A                    ++ D    + +S+ +S DP ++ +LF I+ N+G                 +I  AR  R  +     HIL         ++ ++Q   Y    R+LA+    VL     + ++   D++ +F+    D      +++G+ + +++A D+D G+N Q+ ++I + +   N F +D   G I + R L         L++  +D G P   + +VV + +     +++ P+  +++    + E+ ++ + +        T    +   +   I+   G + F + + +G I T  SLD E +   V + +   +  G  S  N+ I+V +   D NDNAP F   L   G ISE A   S+V  QSD  +       LVI A D D   N  + Y I+   A  +F +D  TG +    ++D E   +F    + ++D G P+L ++   E+ I ++D NDC PKF +D Y  VL+LPT+     LQ+   DPD N    + +S+ +G     FSI+P+TG L +  N      +F      N+R  DG+F ++  +T+       +  L    S     I EN  ++  + +  A    +  +  ++Y LL+   K  I   +G+++ +   LDREE+    LLV A   +         V V VTD ND  P+F+   Y   V           RV A+D D G NG V Y       F  D    F +D  SG + ++     +L   ++ + + A D G P LSS     V +V+   P+FD+  YSV V ED      +  + A S  G ++LYTIT+G+   LF + F          VI ++  LDYET P H LI+ ATD  +       V +TVLD+ND  P+F + SY A +SE+  I     ++ VL     + K      ++I D +  S+ HF I+ ++G I    +LD E   I  +  LVK  D  F P ++   + V + D NDN P F Q  + A+I+  + +G  V    A+D D +   +L Y ++  NE   +F++D +SG +  +    +++ +PS+  +   V V D   +  A V V       H P F    +   V EN    S++  I A D+D   FG +RY ++     ++F +DS +G +   + LDRE +S   L V   D G +  + +V + V D NDN+P+   + Y  +V  S    GT    ++Q+ A D D     ++ Y L S    Q    +D     +     W+    N                F      + S+ +  +     I    V+V I++L     +          T+ E+ P+  ++    +    S + +   ++ V   +P  + +  F +D   G I+  K +D E    Y   V   +    L A   + +++   D ND  P F++  Y   ++E +  G++++Q +A D D+     + YSL            D  E G  F ID   GW+ ++  +D+E+    +L V A    D A   ++TT+TI+V D ND IP + + P   G  + E     S+    VV  L+ +DNDS      + + IT  N    +A   V    ++ +  PLD E+  + L +   A+D L+ S     +++ V+D ND++PVC P +  + + E +     I  ++A D D+ +    + ++L   S      + P TG +     LDRE  S  + V  A D     C  ++++++LD+ND+ P F   H + + + EN    +++ +I A+D D G+NRK+VY ++D +   FSID+ +GI+ +  LLDRE Q  +H+V+ ASD G P + S++ N+ I +LD+ND+PP F        + ED  +G  ++ + A S DIG NA++ Y + +  +Q  F +   +G +++ + LDFE  ++YFLTV A+D G P LS  T V I + DVNDN P F    Y  +I E+  +   T+ KV A D DS +N  + YS +         +R      E+ F I P TG+I +N   DRE    Y   V   D G PA SS   V I+I D NDNPP F   +   +I          QE K  G    V +L + DKD   N  PF   +L+    + F +  + L  +++      G+ Y+    + VQ +D+G+P L     V V VI  S   P   PL+V  V    E   G    I ++   D+  AFD+LT+   + ++       + FK+    G I     LD+G Y+LN  VT+   +    + + +   + +M+  A  ++   + P+ F +R L   +   L SVM++     + V S                    V       QL      D+L+AV +     F+K++ +  ++ +    L ++ + S+V   N    D   C E QC+ TI ++     + +     +F+S  F   + C+C+       C      CA   C G  +    D ++ P + C+CP  K G+         G++S              + F+G  +I + + +   +  M++    R LQ    +M  + +    + I+   +GK+    D    P   +  S   + DG WH+V L + G    +++ D ++         R L+ + +  +E D    +I  GA+      R     K   +     GC+  V+LN+ +LP Q   +P  +  +G+   +L  GC   L    C A  C NG  C+     +     + C C    TG  CE   S+C  +PC +GG C    + F C C  G TG  C+     C   L  C     CI  T  S Y    C+C+    G  C +
Sbjct:  468 VKVILEDANDNAPSFAQQSYEVFVNESVAVGTTVVVVTASDDDHGENGYITYSMASLTPLPFSVQQFTGAVTTTQE-LDFESSLESFSFVVRASDWGSPYRRESEVNITVHLENVNDNKPLFEKVACVGVVSRELP----VGEVIATISAIDIDELELVKYKILSGN-ERGYFELNPDSGVMTL----RHSLITAAPKNSFSLKITATDGEHFSDPMFVNISVVQGKSP-----PKSFSCTETRVAQRLAEKLLKKAKASSKPKMDEGFIDLFSVNRQTPQFDKSFPTDITVREDVEVGTSVFQV--KALDGDTG-FNGQLLHAIADGNTDSCFSIGILN---GVISIFLPLDREKTDRYLLNITLYDLGQPQRSTWRLLTVYIADANDNAPQFLQDGGYHARISENTPIGTEVIQVEATDKDQGLNGEIQYSLLTSTSQFGINSSSGIVYVAGQLDRELVPLFILKVEARDRAERAAQRFSITTLKITLEDVNDCPPAFIPSVANARALEDLPVGTVIAWLDTQDPDLGLGGQVRYLLDNDYDGRFEVDKTSGAIRLTKELDYETQQFFNLTVRAKDKGRPVSLLSVSFVELEVVDVNENLYAPYFSSFAMNGSVKESVRIGTSVLQVSARDDDTGRDGEVQYSIRDGS-GLGRFTIDEETGVIYTTDLLDRETQDSYWLTVYATDLG-VVPQSAALQVYIQVEDVNDNSPLTSEPMYHATILENSPKDQSVIQIQAQDPDATTAEPRLSFRISSGNPQNFFSINPRTGLITTTSRKLDREQQAE-------HVLEVTVSDGGSSPRHTTVWVVIQVLD--------VNDNKPTFPEKMYQVRLPERSRKQRGAPIYRVFAYDQDQGANAELSYSI-------IDGNEDGKFIIDAKTG-----VVSSPKKQFSAGTYDILTVK----AVDNGRPQRW--ATARLHIEWIRRPPPNPIPLAFDEPLYNFTIMETDRV---------ADIVGVVSAQQQGSASLWFDITGGDVDSMFDV----------EKGVGTIVIAKPLDAEQRSFYNLTLEVTDGTNVANTQVHITVLDN--NDNPPVFSQPTYD---ITITEDTPPDTEVVQVLA--------------------SDRDERHRLTFSLQSSVDPSSM-RLFRIDPNSG-----------------VIYTAR--RLDHESRTQHILT--------IMVKDQEFPYR---RSLAR----VL-----IGVEDVNDHAPLFTMVMYDGQVYESAALGSAVLTVTALDKDKGQNAQISYSIDSGNTG-NTFRIDPVLGIISLARELDLSSIGHYVLSVKATDNGSPALSSTAVVRIAV--TLSNNAGPKFPQNEYQAEISESVAIGTSV-------VTVNALSLSTLTYDIRHGNGHRTFRINQYSGVITTQKSLDFETVSSYV-LIVTASNMAGQAS--NATITVVV--LDQNDNAPVFQ-QLHYRGSISEGAGLNSVV--QSDDGQ------PLVIRASDADRNHNALLVYQIMEESARRFFAVDAGTGSIRTIAQLDHETTPTF-RFHVNVRDSGHPQLSAERPAEVTIEVQDVNDCSPKFSQDSYEAVLLLPTYEGVEALQVFATDPDGNGQSELTYSLTDGS-LEHFSIEPSTGLLTVR-NSTFSKERF----RFNVRVSDGRFSSTALVTV-LVHEALDSGLAFTHSAYNANIEENNGNITTVAVVTA--LGNKLNEPLRYTLLNAGGKFRIKPTSGAIETVGVPLDREEKEEYGLLVQAGREEDRLRVARALVRVQVTDVNDNAPVFVGLPYYAAVQVEAEPGTAIFRVTAVDRDKGLNGEVNY-------FLQDELGHFEVDRVSGELRLRRAFEADLSSVEYQVLVFARDMGTPPLSSSVTFPVTVVNRAMPVFDRPFYSVKVSEDIPVWTPILGINASSPEGQSVLYTITHGDPGTLFSIGFDTG-------VISVIAGLDYETSPAHRLIVRATDCLTGARAEVDVEVTVLDVNDNPPVFEQPSYKAVISESAMIG--TAALQVLATDSDSEKNAAVRYQIIPDRT-NSTDHFHIDSSSGLILTARSLDHET--IQRYVFLVKATDNGFPPLSSEVWVTVDVTDTNDNAPVFNQLLYEASINELAPKGHFVTCIQASDADRSDAERLQYGLVSGNERM-LFELDAASGVLTLSGQRRMQR-MPSA--ITLNVSVSDGVFTSTAQVHVRVERANLHSPQFTQGMYEADVRENAPPGSKVIAIRAQDADPGPFGDVRYVLLSDAARDLFTIDS-SGQITTLERLDREERSEMVLSVAAVDAGGRSGYCSVRVTVIDENDNVPLFGASEYHASV-RSEVEPGTL---VIQVQAWDLDQDANGQVSYSLYSEASLQVTELLD-----IDPDSGWVVTKGN----------------FAPLRGSVLSFLVKASDGGAPIRHSLVSVYIHVLSADAHIPSFSQPQFSFTVPEDMPIGSLLGAVHLHTSTSHSSLPVSFAAVIGQTPESNSEGVFLVDKESGMIKLDKALDRELTQIYHFKVVAMLQQGRLDAVSAVDVEVKVQDVNDNKPAFESDTYETSVTEGLSPGTRILQVRALDPDWAANGQVTYSLAPPGLLGGSGGEDIEEHGAYFTIDSSSGWISTLKGLDHEQNPAHSLTVWAFDLGDPASQSSSTTITIAVSDSNDNIPQFLQ-PRYYG-SVRE-----SDAPGEVVAVLNTRDNDSSPGNRQVTYHITGGNRGGVFALGLVQGEWKLYVKRPLDREEQERYL-INVTATDGLYVSTAS--VDVTVMDTNDNSPVCEPALYSVSVSEDVPLNKQILRVKATDADTGSNAQ-IQFSLF-GSGAEDFFIHPHTGELKTAVALDREKVSRYSLVARATDGGGLWCEAEVVVDLLDVNDSPPMFSMPHYTTSVY-ENTATKALLTRIQAIDPDLGVNRKVVYSLVDSADGFFSIDKSSGIVVLERLLDREIQSSYHIVVRASDQGVPVRLSSLANITITVLDINDNPPVFERRDYLATLPEDVAVGTEVVQVYAASKDIGTNADIYYNIRSGNQQGHFTINVNTGAISVSRALDFESCKDYFLTVEATDGGTPPLSAVTMVNINLTDVNDNAPIFSRDAYSVSISEDANIGD-TVVKVMAEDVDSYVNGDILYSIIS-------GDR------ENQFFIEPITGQIKVNKQLDRETMAGYSLSVRALDSGTPAMSSTVLVNIDISDVNDNPPTFTPANHTAVI----------QENKPLGT--SVLQLSVIDKDASHNGPPFHFHILSGNEGAWFKLDREGLLTSNQVFRRSEGTEYV----IHVQASDSGRPPLSSVASVLVRVIEESVHKPAASPLHVHIVTMEDEFPGGV---IGQIHATDQD-AFDILTYGHTHQQS-------SLFKVSPRDGRIIALSGLDAGRYTLNATVTDGRFTVSVPVSVHVEQASVEMLHDAVTVRFDRVSPHDFISRHLP-SVRRVLSSVMSTSRPDALHVLS--------------------VQPVEATGQL------DLLVAVESAEGGGFYKAALVTQKLSSARRQLDQVLRVSAVLDKNCSGLD---CREAQCEQTITLDSH-SLLTYSSTKTSFVSPKFHRNTRCVCSDG----SCSAASEVCADMRCPGDMQCVGTDSSRGP-YACQCPPGKLGECA-------GHTS--------------LSFSGNSYIKYRVTDGERSGEMKLALRIRTLQSKGIIMYTRADPCSVLKIE---EGKLWFQLDCGNSPR-SIGISGRLVNDGNWHHVVLELRGNYSSLSLDDMYVE--------RRLTTAKFRPLEAD---LSIYFGAQVLPPDARSLTEMKGPRVTNGFQGCLDSVVLNDNELPLQNKRSPY-AEVVGL--TDLKLGC--VLYPDACVAQPCLNGATCI-----SLPSGGFSCSCSALHTGGRCETEISVCMPNPCQNGGVCKPIGNAFICSCKRGYTGATCEEDVNECEREL--CENGGICI-NTFGSFY----CNCTPGFVGSACSV 4161          

HSP 2 Score: 251.906 bits (642), Expect = 1.234e-65
Identity = 456/1886 (24.18%), Postives = 773/1886 (40.99%), Query Frame = 3
Query: 5865 VKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDK-----GSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTF----PSAPLLQLRVHDPDLNPTI-LFSILNGKESRFFSIDPT---TGWLKISTNDIPVSGKFPSVVLINIRAFD-GKFETSCNITINSFDNTRNKVLPLEKSQVV------------------WEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILL--SEQPKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFT---DVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS-STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHT-------------LIISATDPSSSLSHSTTVL------------------------ITVLDINDELPIFLKS-SYSASVSENMPINHEIISISVLLQKVS-NSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQ-PAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXI-----KNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVL---IHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIM---TIQENNPLNHIVAMCRIS---STEMKGKWSL-VPSSSPFDVQNDFEIDSNYGYI-RAKKIMDFETQSQYRINVEYR-VDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDI--PLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISV---YDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSES-GEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQ-IPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDP---YLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVE--SKKCSFKILINVLDINDNAPRFVHTSI-APFLENAPHGSVIGKIHAVDADSGINRKIVYRI-LDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMI--TEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASD-KGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGK------VTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSK--TNVTIEIEDKNDNPPEFAQPSFRFLI 11156
            V + + D+ND  P F  P   +  I+ES               L  S+    + A D D G NG+  Y    R    F +   +GV+SL+ K+D ++   + DL I+  D+     G+  + S  +L   + +E  N+  P         V + P +    P   ++ +   D   N  I   SI+ G     FSI+ T   +  +    + +  S +F   VL  +  FD   +    N+++ + D  R     L   Q+V                  +E+  +    P  ++   K     +    +YIL   ++     IN +TG +     L + ++   +L VL    D     + V V + D ND  P F  + YE  V+ +++     + V A D D GENG + YS+  + P    L F++   +G +T       E   + F+  ++A+D G P          V ++ V+D  PLF+K     +V  +     ++ T+ AI       + Y I +GN+   F+L+  +  +     +I    K  +  K   T              ++    P  S S + T +                        I +  +N + P F KS     +V E++ +   +  +  L      N ++    L  I D +  S   F I    G ISI   LD E    +   I +   G+   +    + V+I D NDN P+F+Q   ++A IS  +  G+ V+   ATD D   N ++ Y +L      F I+ SSG +      + E L+P   +   +V   D         S+  + I      + PP+F+ +  +    E+  V + I  +   D D    G++RY +   +D   F +D  +GA+ L K LD E +    L V   D G      +V    + V D+N+N+      +    +  S K +     S+LQ+ A+D D      + Y               SI     L    I++ + + +  T       Q ++ +    +Y+  +     S ++ V +++  + D    N  +T   M   TI EN+P +  V   +     +T  + + S  + S +P   QN F I+   G I    + +D E Q+++ + V      +SP   T  ++I ++D ND  P F    Y + + E      G+ + +  AYD+D      + YS+  +D  E G  F ID +  V S     +       L V A D        T  + +               + P+    I ET     +    +V  +SA+   S     SL F IT  +++   + F V +  G +++  PLDAE+      L    +D  + +  +  ++I V+D ND+ PV  Q   D+ I E   P + +  + A DRD   +   LT++L    DP    L  ++P +G +     LD E  +     +   D E   ++   ++LI V D+ND+AP F          E+A  GS +  + A+D D G N +I Y I    + ++F ID   GI+ +A  LD      + L ++A+D G P  S+   V+I +   N++ P+F     +  ++E   IG  ++T+ A+S      + ++Y +        FR+   SG +T  K LDFE    Y L V AS+  G  S +T T   + V+D NDN P F  L Y  +I E   ++ +          + A D+D   N++L Y  +                   FF ++  TG I      D E  PT++F V+V D G P  S++    VTIE++D ND  P+F+Q S+  ++
Sbjct:  141 VSVQVLDMNDLRPLF-SPTTYSVTIAEST-------------PLRTSIAQ--VTATDADIGSNGEFYYFFKERM-ELFAVHPTSGVVSLSGKLDVDIQSRY-DLEIQAVDRGMKLYGNNGVSSTAKL--FVHVERINEHVPTLSI-----VTLAPVWTEKSPIIAVVTVEDLDEGKNGEIETVSIVAGDLLELFSIERTDVPSQEMVDEEDSMKGSNEF---VLRAMEQFDWDSYPFGLNLSLQARD--RGTPQKLSAVQIVHLRLSRPPPVEVTFQKDQYEVLLSEVAPPGTIVEAVKL--QPEPDDAEYILTPSADSGFFSINTMTGVISTARWLTQLKQEVFELEVLEVDSDLR---VKVKVILEDANDNAPSFAQQSYEVFVNESVAVGTTVVVVTASDDDHGENGYITYSMASLTP----LPFSVQQFTGAVTTTQELDFESSLESFSFVVRASDWGSPYRRESEVNITVHLENVNDNKPLFEKVACVGVVSRELPVGEVIATISAIDIDELELVKYKILSGNERGYFELNPDSGVMTLRHSLITAAPKNSFSLKITATDGEHFSDPMFVNISVVQGKSPPKSFSCTETRVAQRLAEKLLKKAKASSKPKMDEGFIDLFSVNRQTPQFDKSFPTDITVREDVEVGTSVFQVKALDGDTGFNGQL----LHAIADGNTDSC--FSIGILNGVISIFLPLDREKTDRYLLNITLYDLGQPQRSTWRLLTVYIADANDNAPQFLQDGGYHARISENTPIGTEVIQVEATDKDQGLNGEIQYSLLTSTSQ-FGINSSSGIVYVAGQLDRE-LVP---LFILKVEARDRAERAAQRFSITTLKITLEDVNDCPPAFIPSVANARALEDLPVGTVIAWLDTQDPDLGLGGQVRYLLDNDYDGR-FEVDKTSGAIRLTKELDYETQQFFNLTVRAKDKGRPVSLLSVSFVELEVVDVNENL--YAPYFSSFAMNGSVKESVRIGTSVLQVSARDDDTGRDGEVQY---------------SIRDGSGLGRFTIDEETGV-IYTTDLLDRETQDSYWLT---VYATDLGVVPQSAALQVYIQVEDVND----NSPLTSEPMYHATILENSPKDQSVIQIQAQDPDATTAEPRLSFRISSGNP---QNFFSINPRTGLITTTSRKLDREQQAEHVLEVTVSDGGSSPRHTTVWVVIQVLDVNDNKPTFPEKMYQVRLPERSRKQRGAPIYRVFAYDQDQGANAELSYSI--IDGNEDG-KFIIDAKTGVVSSPKKQFSAGTYDILTVKAVDNGRPQRWATARLHIEWIRRPPPNPIPLAFDEPLYNFTIMET-----DRVADIVGVVSAQQQGS----ASLWFDITGGDVD---SMFDVEKGVGTIVIAKPLDAEQ-RSFYNLTLEVTDGTNVANTQ--VHITVLDNNDNPPVFSQPTYDITITEDTPPDTEVVQVLASDRDERHR---LTFSLQSSVDPSSMRLFRIDPNSGVIYTARRLDHESRTQHILTIMVKDQEFPYRRSLARVLIGVEDVNDHAPLFTMVMYDGQVYESAALGSAVLTVTALDKDKGQNAQISYSIDSGNTGNTFRIDPVLGIISLARELDLSSIGHYVLSVKATDNGSPALSSTAVVRIAVTLSNNAGPKFPQNEYQAEISESVAIGTSVVTVNALS-----LSTLTYDIRHGNGHRTFRINQYSGVITTQKSLDFETVSSYVLIVTASNMAGQASNATIT---VVVLDQNDNAPVFQQLHYRGSISEGAGLNSVVQSDDGQPLVIRASDADRNHNALLVYQIME-------------ESARRFFAVDAGTGSIRTIAQLDHETTPTFRFHVNVRDSGHPQLSAERPAEVTIEVQDVNDCSPKFSQDSYEAVL 1905          

HSP 3 Score: 100.523 bits (249), Expect = 6.208e-20
Identity = 71/216 (32.87%), Postives = 107/216 (49.54%), Query Frame = 3
Query:  219 ESLSISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTKY--TASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRG 860
            E   + FT+PLY+  +Y++   R Y A    +MGI       ++ Y+I    E    F+AE   +GDF +LRIRTK    A LNRE    Y LT++   +  +   +     T+V ++VLD ND  P+F    +     E+  + T I  VTATDAD G N E +Y+  +           F+++P SG++    KL D    S+   +I A+ RG
Sbjct:   34 ERFRLQFTQPLYHASVYENSAARTY-ASSQVRMGIPLQHHSWEVRYRITSGDE-EGFFKAEEYTLGDFCFLRIRTKGGNAAILNREVQDNYVLTVKASLKGDTLEAW-----TKVSVQVLDMNDLRPLFSPTTYSVTIAESTPLRTSIAQVTATDADIGSNGEFYYFFKERMEL-------FAVHPTSGVVSLSGKL-DVDIQSRYDLEIQAVDRG 234          

HSP 4 Score: 97.0561 bits (240), Expect = 6.802e-19
Identity = 142/585 (24.27%), Postives = 248/585 (42.39%), Query Frame = 3
Query: 9057 IMDFETQSQYRINVEYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQGWVYSVSA-VDYEETKLINLVVSASDKA-------GHVTNTTLTISVYDVNDEIP---------YWTKNPPVDGIEITETCD----GCSETFPRVVYRL----SAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLL--LHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP------DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPFL-ENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEH-HLVIEASDCGKP-PKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYF-LTVRASD 10694
            I++ E Q  Y + V+  +    L A   + + ++D ND  P+F  + Y++ I+E  PL + + Q  A D D  G +  FY  ++    E    F +     V S+S  +D +     +L + A D+        G  +   L + V  +N+ +P          WT+  P+  +   E  D    G  ET   V   L    S +  D  SQ+     ++  ++         +  S E +L  +   D +     L L   A DR      + +  ++++ +    P   ++       ++++ E   PG+++  ++       A+Y      L   +D     +  +TG VI  A    +    V F +  L+V+S     K+ + + D NDNAP F   S   F+ E+   G+ +  + A D D G N  I Y +   +   FS+ + TG +     LD E   E    V+ ASD G P  + +  N+ + L +VND+ P F  +     V+ +  +G+V+ TI AI  DI     V Y++++  E+ +F L   SG +TL   L     +  F L + A+D
Sbjct:  113 ILNREVQDNYVLTVKASLKGDTLEAWTKVSVQVLDMNDLRPLFSPTTYSVTIAESTPLRTSIAQVTATDADI-GSNGEFYYFFK----ERMELFAVHPTSGVVSLSGKLDVDIQSRYDLEIQAVDRGMKLYGNNGVSSTAKLFVHVERINEHVPTLSIVTLAPVWTEKSPIIAVVTVEDLDEGKNGEIETVSIVAGDLLELFSIERTDVPSQE-----MVDEED--------SMKGSNEFVLRAMEQFDWDSYPFGLNLSLQARDR---GTPQKLSAVQIVHLRLSRPPPVEVTFQKDQYEVLLSEVAPPGTIVEAVKLQPEPDDAEY-----ILTPSADSGFFSINTMTG-VISTARWLTQLKQEV-FELEVLEVDSD-LRVKVKVILEDANDNAPSFAQQSYEVFVNESVAVGTTVVVVTASDDDHGENGYITYSMASLTPLPFSVQQFTGAVTTTQELDFESSLESFSFVVRASDWGSPYRRESEVNITVHLENVNDNKPLFEKVACVGVVSRELPVGEVIATISAI--DIDELELVKYKILSGNERGYFELNPDSGVMTLRHSLITAAPKNSFSLKITATD 666          

HSP 5 Score: 69.707 bits (169), Expect = 1.267e-10
Identity = 114/456 (25.00%), Postives = 190/456 (41.67%), Query Frame = 3
Query: 1572 TLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTKISYYLFDQN-KLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNE--YKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRD---GRDN-IQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLT--NFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADR-LDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDS-FQIPMTLPENYDIKKR--IVQIKATDAD---SKDIQYRLV--NFRRVFKIHSRTG 2885
            TL+I+++DVN+ PP  + + +     E+  +G  +  +   DPD+       YL D +    F + +    + + KE LD ET Q+ F + V   D G P++   ++  E+E+ DVNE  Y P F        ++      ++IG  + +   RD   GRD  +Q SI   S     F+I  E+G +     +   +L + T  ++ + + A D G+V    AL                         +Y+  +   D       N   +++P++        AT       I E S K   V  I ++  D D    E    F + S   Q  FSI   +  +  I    R LDRE   ++ + + V D G           IQV D+NDN P F +  +Q+   LPE    ++   I ++ A D D   + ++ Y ++  N    F I ++TG
Sbjct:  931 TLKITLEDVNDCPPAFIPSVANARALEDLPVGTVIAWLDTQDPDLGLGGQVRYLLDNDYDGRFEVDKTSGAIRLTKE-LDYET-QQFFNLTVRAKDKGRPVSLLSVSFVELEVVDVNENLYAPYF----SSFAMNGSVKESVRIGTSVLQVSARDDDTGRDGEVQYSIRDGS-GLGRFTIDEETGVI-----YTTDLLDRETQDSYWLTVYATDLGVVPQSAALQ------------------------VYIQVEDVND-------NSPLTSEPMY-------HAT-------ILENSPKDQSV--IQIQAQDPDATTAEPRLSFRISSGNPQNFFSI---NPRTGLITTTSRKLDREQQAEHVLEVTVSDGGSSPRHTTVWVVIQVLDVNDNKPTFPEKMYQV--RLPERSRKQRGAPIYRVFAYDQDQGANAELSYSIIDGNEDGKFIIDAKTG 1322          

HSP 6 Score: 63.5438 bits (153), Expect = 1.088e-8
Identity = 131/536 (24.44%), Postives = 220/536 (41.04%), Query Frame = 3
Query: 6840 YINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQP-----ALSSFTDVFVDI--VSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAI--SSTGHTILYTITNGNDEELFDLDFTAAYLQ-----------PGPCVIRLVGKLDYETKPFH-TLIISATDPSSSLSHSTTVLITVLDINDELPI---FLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLD--TNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPS-SGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTL 8366
            +  V+V V D ND +P+F    Y   +  +        +V A D D G NG      YY      +L FA+   SGV+++ SG     +  ++ + I+A D+G        +SS   +FV +  +++  P       + +  E +     V TV+ +     G     +I  G+  ELF ++ T    Q               V+R + + D+++ PF   L + A D  +    S  V I  L ++   P+   F K  Y   +SE  P     I  +V LQ   +    E+ L    DS       F IN  TG IS    L      + E  +L + D       R  ++V + D NDN P F Q ++   ++   + G+ VV+  A+D D   N  + Y + +     F + Q +G +   Q  + E  L S S VV        +      N++V+  ++ ++ P F        VS    V   I  I A D D+ +   ++Y ++ G +   F L+  +G + L+ +L
Sbjct:  138 WTKVSVQVLDMNDLRPLFSPTTYSVTIAESTPLRTSIAQVTATDADIGSNG----EFYYFFKERMEL-FAVHPTSGVVSL-SGKLDVDIQSRYDLEIQAVDRGMKLYGNNGVSSTAKLFVHVERINEHVPTLSIVTLAPVWTEKS-PIIAVVTVEDLDEGKNGEIETVSIVAGDLLELFSIERTDVPSQEMVDEEDSMKGSNEFVLRAMEQFDWDSYPFGLNLSLQARDRGTPQKLS-AVQIVHLRLSRPPPVEVTFQKDQYEVLLSEVAPPG--TIVEAVKLQPEPDD--AEYILTPSADSG-----FFSINTMTGVISTARWLTQLKQEVFELEVL-EVDSDL----RVKVKVILEDANDNAPSFAQQSYEVFVNESVAVGTTVVVVTASDDDHGENGYITYSMASLTPLPFSVQQFTGAVTTTQELDFESSLESFSFVVRASDWGSPYRRESEVNITVHLENVNDNKPLFEKVACVGVVSRELPVGEVIATISAIDIDELEL--VKYKILSGNERGYFELNPDSGVMTLRHSL 649          

HSP 7 Score: 62.7734 bits (151), Expect = 1.508e-8
Identity = 87/355 (24.51%), Postives = 155/355 (43.66%), Query Frame = 3
Query: 5472 LFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLP---QLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPST-GKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGK 6524
            L L++   D G P +++    AV+I   R+S   P     ++ Q ++++ E     +I+  +KL+        A+Y+   + PS     F +   TG I T   L + + Q++  +++       L    +  + VK+ + D NDNAP F             A     VF+    E ++     +V+ A D D G+NG I Y + S     F + Q+TG ++   ++D E         +R  D GSP     E + I + +E+ ND  P FEK   + V+         +  +   D D    + + IL+G E  +F ++P +G + +  + I  + K  +   + I A DG+
Sbjct:  351 LNLSLQARDRGTPQKLS----AVQIVHLRLSRPPPVEVTFQKDQYEVLLSEVAPPGTIVEAVKLQPEPDD---AEYI---LTPSADSGFFSINTMTGVISTARWLTQLK-QEVFELEV-------LEVDSDLRVKVKVILEDANDNAPSF-------------AQQSYEVFVN---ESVAVGTTVVVVTASDDDHGENGYITYSMASLTPLPFSVQQFTGAVTTTQELDFESSLESFSFVVRASDWGSPYRRESE-VNITVHLENVNDNKPLFEKVACVGVVSRELPVGEVIATISAIDIDELELVKYKILSGNERGYFELNPDSGVMTLRHSLITAAPK--NSFSLKITATDGE 668          

HSP 8 Score: 60.077 bits (144), Expect = 1.000e-7
Identity = 39/125 (31.20%), Postives = 63/125 (50.40%), Query Frame = 3
Query: 10326 ASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKG 10700
            A++L+RE Q  + L ++AS  G   ++  T V + +LD+ND  P F      + +AE T +   +  + A   DIG N E  Y        F +   SG ++L  KLD ++   Y L ++A D+G
Sbjct:  111 AAILNREVQDNYVLTVKASLKGDTLEA-WTKVSVQVLDMNDLRPLFSPTTYSVTIAESTPLRTSIAQVTATDADIGSNGEFYYFFKERMELFAVHPTSGVVSLSGKLDVDIQSRYDLEIQAVDRG 234          

HSP 9 Score: 58.9214 bits (141), Expect = 2.730e-7
Identity = 73/306 (23.86%), Postives = 131/306 (42.81%), Query Frame = 3
Query: 2664 PKNCIFKRFEIQVED-------INDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADS--KDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSP--LTEYRLIAVVKDNGKP----QALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRINNEGEIRTVS 3536
            P +C  +RF +Q            ++  R   S Q+ M +P  +   +   +I + D +   K  +Y L +F    +I ++ G   +   L+RE +D Y + + AS       +L A   +++ V D+ND +P+F+  +YS+ + E  P+ + + Q+ ATDAD+  N +  Y       + F    ++G V L  KL     + Y L     D G        +SS A   ++ +++  N ++P+L                  + ++ P  ++K P   V T+     G         GEI TVS
Sbjct:   28 PGHCQGERFRLQFTQPLYHASVYENSAARTYASSQVRMGIPLQHHSWEVRYRITSGDEEGFFKAEEYTLGDFC-FLRIRTKGGNAAI---LNREVQDNYVLTVKAS---LKGDTLEAWTKVSVQVLDMNDLRPLFSPTTYSVTIAESTPLRTSIAQVTATDADIGSNGEFYYFFKE-RMELFAVHPTSGVVSLSGKLDVDIQSRYDLEIQAVDRGMKLYGNNGVSSTAKLFVHVERI--NEHVPTLS-----------------IVTLAPVWTEKSPIIAVVTVEDLDEG-------KNGEIETVS 299          

HSP 10 Score: 56.9954 bits (136), Expect = 9.991e-7
Identity = 53/192 (27.60%), Postives = 88/192 (45.83%), Query Frame = 3
Query:  231 ISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIR-DSSEIFNTFEAESKLVGDFFYLRIRTKYTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKL 803
            ++F +PLYN  I +   V   V       G+   +++G  +        ++ + F+ E K VG     +        L+ E+  FYNLT++                TQV I VLD NDN P+F    ++    E+    T++  V A+D DE     + + L QS++   S++  F I+P SG+IY  ++L
Sbjct: 1372 LAFDEPLYNFTIMETDRVADIV-------GVVSAQQQGSASLWFDITGGDVDSMFDVE-KGVGTIVIAK-------PLDAEQRSFYNLTLE-------VTDGTNVANTQVHITVLDNNDNPPVFSQPTYDITITEDTPPDTEVVQVLASDRDE--RHRLTFSL-QSSVDPSSMRL-FRIDPNSGVIYTARRL 1537          

HSP 11 Score: 54.6842 bits (130), Expect = 4.739e-6
Identity = 41/116 (35.34%), Postives = 60/116 (51.72%), Query Frame = 3
Query:  459 LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNEN-FEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKL 803
            L+RE+   Y L I  L++    G+ + S    + + + D NDN P F+ +  +     EN  I T++  V ATD D+G+N EI Y L    +TS S    F IN  SGI+Y   +L
Sbjct:  798 LDREKTDRYLLNIT-LYD---LGQPQRSTWRLLTVYIADANDNAPQFLQDGGYHARISENTPIGTEVIQVEATDKDQGLNGEIQYSL----LTSTS---QFGINSSSGIVYVAGQL 902          
BLAST of Ft-2 vs. Ensembl Xenopus
Match: hras (Harvey rat sarcoma viral oncogene homolog [Source:Xenbase;Acc:XB-GENE-479381])

HSP 1 Score: 1124.77 bits (2908), Expect = 0.000e+0
Identity = 1219/4563 (26.71%), Postives = 2015/4563 (44.16%), Query Frame = 3
Query:  222 SLSISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTK--YTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVKYLSKYFDPDFN-DYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNVF---LTPTGELNRYVLKLRAIFSPISTPAISVTIEAKDLSLNPKTSST---HLTIPLGNLRNINLLSVPEFVSVSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLEGTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIA-VAMNDSLETKKTFT-LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDI---YVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXX-XXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNI-LIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSEN----DKSKLYLAYLPSDS----INIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRA----TYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIK-PSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILS-RFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNP--TILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKS-ALDREERPFVQLLVLAKGWDG--SYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIR-VKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHI--VDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVLNEYYNI-FKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRE--RKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSIN---VTVKINILYDK----KKVNPIITCSIMTIQENNPLNHIVAMCRISSTE------MKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINV--EYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSL-YQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHV--TNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPF----LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPK-SNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRTLWV---QVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKPNIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQL------APDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGA--RNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHC 13634
            S S+ FT+  YN  +Y++   + YV H   +MGI   +    I YKI  S +  N F+AE   +GDF +LRIRTK   TA LNRE    Y LT++ + E  S  +     +T++ ++VLD ND  P+F   ++     EN +I + I  VTATDAD G N E +Y   +           F+I+P SG I    +L D+        +I A+ RG        + S + L+I V   N HAP IS   L+    P+ + D  +A +TV D D+  N       I+       P+ +F    T  G     ++ ++     +     ++T++AKD    P+ S+T   HLT        +      +     I E A  N+ V L+K        N+ +K  FR   D +  +S+N  +   S +             SP +   ++ + ++     KK FT + I V   N   P          V EN+ IG +V  + A D D      I+Y + + N  PF +  F   V+   E+LD E M R + +++  +D G P  R       I + ++N+  P F    C+ T+    P DL +G  I     +D D    ++  I S   +   F+++P SG LSL      G  +K++ +++ + A D   ++  + +N +V        S + + L+C +  +           +   N     E          + P F + +PS+I I+E    G  +  I M+  D D   +  + ++ +    +   F++   D  +  + +   LDRE  D+Y++ I V D G P+   ++  ++ V D+NDNPP FL +S+ +   L EN +    I+Q++A D D   + +++Y ++    +F I+S TG ++    LDREK+  + + I A D       L +   L + V D+NDN P+F  ++Y + + EDLP+G+ +  L A D D+  + Q+R+++       F  D  +GAV ++ +L       Y L A  KD GKP +LSS     +    V+ N + P   E +   +IRE+   GT V ++     D      + Y+I   S G+ +F I+ E G IRT  ++DRE    YWL +Y  DR    ++  + ++YI++ D NDN P      Y   V EN      ++ + A D D     +L YKI +G+  G+F+I+  TG I+T+ R +DRE           + L+V I+D+G P +     + V ++D NDN P F+      F +    E     R +N     I RV AVD D   NA + Y+++              F ++ K+G + +  SS+       G   I    +++ A D G P   +      T RL++   A    S      ++     + + SD     I ++  E +GS L         D  G + + + D   G  ++I A+                D+       +T+E T        Q  V+I +   N + P F   S+   ++ I +  +P   I  V A                     + D    +IY++ +S DP++++K F ++   G L      +  + Q   + V  R++       + ++ I++ DTN+  P F  S  +  +Y                                         +++G+ +  +SA D+D G+N ++ ++I++ + A N F +D   G I+  + L    +    L +  +D G PP     + ++ I     +++ P+  + +    + E   V S +  L   S +        VV  I+  +T   F +  ++G + T   LD E +    ++ +Q  +  GL +  NS ++V  H+ D NDN P F       G+ISESA P S+V        L+     LVI A D D+  N  + Y I+      YF ID  TG L   L +D E    F   ++++ D G P+L ++    + I + D NDC P F KD Y   L+LPT+    ++ +   D D      +++SI+ G     F IDP  G + +       +    S   + IRA DG+F +  ++ IN    ++   L   +      + EN   V  L +       S  +  + + +L+  P+ +I+  +G L       DREE    +L+V         +  ++ V V+V D ND  P+F++  Y  +V  + + E   IR V A+D D G+NG + Y   Y+K  +   +      SG I ++     +   K++ I + A D G P+ SS   V + +++   P+F+   YS  + E+A     V  V+A S  G+ I+Y+IT+G+    F+++F          VI +   LD+E+ P + L + ATD  +       V I + D+ND  P+F + +Y+A++SE   I   ++ I+        +  + F L    ++S   SQ+F I+ ++G I   + LD+E     E  ++V+      P     + VHI   D NDNPP FIQ  +   IS  S  G  V    ATD D++   KL Y +L+   ++ F I+  +G I    V  + K++ +       V V D      A V V   S   H P F  NE+ + +SEN  V + +  + A D DK  +G+L YH+I  F  + F ++   G L   +  DRE     +  + V+  D G K  F  V + +TD NDN+P      Y+V+ I S    GT    I+++ A D D      + Y + +    QS A V+   G      + I + S +GL                 E+ +YS+ +  T          V V I IL  +    K   P  T   ++I E+  +   + + +  S E      MKG      ++   ++ + F ID   G ++ +K +D E+   Y+  V          ++++  + I + D ND  P+FD++ Y  FI E++P G+KV+Q +A+D D      + Y L +  D  E    F +D + GWV ++  +D+E+T   ++VV A D    V  +++T+ ++V DVND  P +T       +   +  DG       V+  LS  DND+E   + + F IT  +    +A   +    +V +  PLD E +     L   A+D    +K   ++ ++V+D ND+ PVC +      I E    G VI  + A D D  +    + YTL         +  P TG +  + PLDRE     + +V A D   + C   + + + D+NDNAP F   S  P+     EN    + + ++ A+DAD G+N K+ Y ++  ++  FSID  +GI+ +   LDRE Q  + L ++A+D G P K S++ +V + +LD+ND+PP F +      + ED  +G  ++ + A S DI VNAE++Y++I+  E   F +  ++G + +I  LD+E S EY+LTV A+D G P LS    V I V DVNDN P F    Y   + E++ VS  ++  V A D+D  LN+ + YS     P                F I+P  GE+ +N + DRE    Y   +   D+G P   + T V I++ D NDNPP F++ ++  +IQ          E K  G  F +  L + DKD   N  PF    L+    + F     ++ ++ ++  AG+L   ++ L+V   QV+DNG+P L     + V VI  S  PP I PL +    F  E   G    I +V   D+   +D LT+      +L  ++ N  F +    G +   + LD G Y LNV V++   +T   I + I  +T++++  +   + +++ P  F          +F +S+                               + +  R+I  Q+       P   +DVL+A        +F    L+ +I     ++  I     + +F+ +C D   C    C   I V+  +   +     ++F++      + CLC    +G +C    + C    C     C  D  K   F C CP        +RP            QC    V   + FTG  +I + L E  N   M++    R     A +M  +      + I     GK+    D  + P I   +S++ + DG+WH V L + G       +  +V+D +     +    +   + +  +  G   R   S    NL+    +     GC+  V+LN Q+LP   L +   ++     S +++ GCS S    +C+   C+NGG C        +   Y C+C   F G +C+I  + C  +PC++GG C+  K  F C C    TGPRCQ+G  C    NPC     CI+          VC+C     G  C  D+DEC   P  C P   +C N +  Y CNC+ GY G  C
Sbjct:   30 SSSMQFTQYSYNATVYENSAAKTYVGH-PTKMGIYLKDPSWDIKYKII-SGDNENIFKAEEHNLGDFCFLRIRTKGGNTAILNREVKDNYLLTVKAV-EKNSNAE----ARTRIRVQVLDTNDLRPLFSPTSYSVSLPENTAIRSSIAKVTATDADIGTNGEFYYSFKERTDM-------FAIHPTSGTIVLTGRL-DYTETKHYEMEILAVDRGLKLYGSSGISSMARLNIYVEQANEHAPVISAVRLTH---PELDKDLTYAIVTVDDNDQGPNGEIASLSIIA----GDPLQLFKTTRTSPGSKEYKIVAVKETEWEMQPFGYNLTLQAKDKGSPPQFSATKVIHLTSSRFKYGAVKFEK--DIYRTEISEFAPPNTPVVLVKAV----PSNSHIKYAFRNSAD-KNRFSINPNTGLISTL-------------SPVKAKILSHIELDIITSDKKAFTKVLIKVLGTNINTPEFTQTSYKAVVDENSPIGSSVFSVHAVDHDEGENGFITYSIANINPQPFAIDAFS-GVITTLEDLDYELMPRIYTLKIRASDWGLPYRRETEIPVTITLNNLNDNIPLFEKVNCEGTV----PKDLGVGEQITTVSAIDADELQLVKYRIESGD-ELDLFTLNPNSGVLSLKQPLSEGPANKVSFYSLRITATDGENLAQPIYINITVTS------SRKGVHLNCEETGVAKMLAERLLQANKLFNRGTQEEVYFDSHMTNTHAPHFKSILPSIIAIKENVPVGANI--IHMEANDLDAG-FSGKLLYAISGGNDDSCFAV---DMETGWLKILSPLDRELKDQYNLNITVYDLGIPQKSSWRLLDVNVLDVNDNPPEFLQESYSV--HLKENEEGHNAIIQVQAVDKDLGVNGEVKYSILTDTDIFTINSETGVIKAVAPLDREKQHTHLLKIEARDQAENEPQLFSHVLLKVTVEDVNDNPPVFIPSNYHVKVREDLPVGTVITWLDAYDPDVGLSGQVRFSLLENGDGKFEVDKVSGAVRIIQELDFEEKQVYNLTARAKDRGKPVSLSSACYINVELIDVNENLHTPLFSEFVSKGSIREDVPIGTPVMTVSAHDEDTGRDGEIRYSIRDGS-GVGVFTIHEEKGTIRTADNLDRETTSHYWLTVYATDRGVVPLSSFI-QIYIEIEDVNDNAPQTVEPVYYPEVMENSAKDVSVVQINAFDPDSISSDKLTYKISTGNPQGFFAINPKTGLITTTSRKLDREQQSE-------HILEVTITDNGHPAKSAVTRVIVKVLDENDNKPQFLQK----FYKIRLPEREKPERERNAKRDPIYRVVAVDKDDGANAEISYSIE-------EGDEHGKFFIEPKTGVVSSKKSSAA------GEYDI----LSIKAVDNGRPQKSS------TTRLHIEWIAKPAPSAEPITFEEPSFSFSVMESDPVAHMIGVITTEPLGSPLW-------FDITGGNYDSRFDVDKGTGTIIVARP--------------LDAEQKSNYNLTVEATDGTRSVSTQ--VSIKVIDTNDHRPEF---STSKYEVLIPEDVQPDTEILQVIA--------------------IDRDEKNKLIYTLQSSTDPVSLKK-FRMDPATGSLYTTEKLDHETMQQHILTVMVRDQDVPVLRNFARIVINVTDTNDHAPWFTSSFYEGRVYE---------------------------------------SAAVGSAVLQVSALDKDKGKNAEVGYSIESGNTA-NAFTIDPVLGIIKTAKELDRNNHGRYELVVKATDHGIPPL--SQITSIHIFVTISNNAAPKFTKKEYSSEISETAHVGSFVAMLSAYSQSS-------VVYEIRDGNTLNSFDINPNSGVVTTQKQLDFETLPSF-TLTVQATNMAGLST--NSTLTV--HVRDENDNFPVF-AQTNYRGLISESAPPNSVV--------LTDDNIPLVIRATDSDQESNALLVYQIVEPSVHKYFAIDSSTGALRTLLSLDYEQTNIF-HFTVQVHDMGYPRLFAENAANVTIYVVDINDCAPVFSKDVYETSLLLPTYKGVRVITVNATDDDSGAYSQLIYSIIEGNIGDKFLIDPLKGTITVQN-----TTNLRSRYELTIRASDGRFSSLTSVKIN-VKESKESSLKFTQRSYSATVLENATKVKTLTIISP--LGSRINEPLFFHILNPDPRFKISPTSGVLSTTGIPFDREEEDLFELVVEVSDEQKPPTVAHVLVQVTVEDVNDNNPVFVNLPYYAMVQID-APEGHLIRHVTAVDRDIGKNGEITY---YLKEHSQQFQIG---PSGEIKLKKQFDPDSSNKEYFITVVAKDSGNPSYSSEVVVPITVMNKAMPVFENPFYSAEIAENANLHSPVVHVQANSPEGYRIIYSITDGDPFNQFNINFNTG-------VINVFAPLDFESHPAYKLRVRATDSLTGAHAEVFVDIILEDVNDNPPVFREKTYAATLSEASVIGTSVVQINAKDPDSGQNNAISFHLV---ETSGNISQYFHIDASSGLIETAKPLDYE--YFQECTLVVRATDNGIPPLSNDISVHIGLTDLNDNPPAFIQQVYEVKISELSKPGHFVTCVKATDADSSDTEKLEYSILSGNDDMNFIINSKTGVI---TVSYLRKMILNP-FYSINVSVSDGVFRSSAQVHVTVKSANLHSPKFGQNEYEVELSENSPVQTLVTELKAVDEDKGLYGQLTYHIINDFAKDNFNINE-RGQLFTAERFDREIPTNKVIPVSVMAKDTGGKVGFCIVNVILTDSNDNVPQFRATEYKVS-IASDVPRGT---PIVKVIASDSDEGANADIFYSIEA----QS-ASVEENFGISQSSGTIITKESLIGL-----------------EDEVYSFFVKATDGGTPQKESLVPVFIRILPPEVVLPKFSEPFYT---LSISEDTAVGTELDVVKAESNEPIIYSLMKG------NTLESNLDDVFVIDKQNGRLKLEKQLDHESTKWYQFYVLAHNLHGEHEIISSVDVSILVKDVNDNAPVFDSNPYKAFIVENLPEGTKVVQVRAFDLDVGSNGQVSYMLGHSQDLEEIKELFSVDRETGWVTTLGELDHEKTNKYHIVVVAYDHGDKVLSSSSTIEVTVMDVNDNPPRFTAEIYKGTVSEDDPPDG-------VIAILSTTDNDTEEINKEVTFHITGGDPLGQFAIENMQHEWKVYVRKPLDRE-VKDNYLLNITATDGTFATKA--VVEVKVLDANDNTPVCEKTSYAETISEDALAGRVILQVAASDADIRSNAEII-YTLHGVGAEKFHL-NPFTGELKTSLPLDREILEVYHLMVKATDGGGRFCQAAVELTLEDVNDNAPEF---SADPYTVTVYENTEPQTPLLRVQAIDADLGLNHKVQYSLVSSAEGQFSIDELSGIISLEKPLDRELQAVYTLTVKATDQGLPRKLSSVASVVVSVLDINDNPPVFEHREYGSSLTEDAPVGTEVLQVYATSRDIEVNAEITYKIISGNEHGKFTINPVTGMIFIIASLDYETSPEYYLTVEATDGGTPPLSDVASVNINVTDVNDNSPVFSQNTYTTVVGEDS-VSGQSVLMVVADDADGPLNNHIRYSITEGNPGNT-------------FIIDPVRGEVKVNKLLDRELISGYTLTIQAEDNGQPPRRNTTTVNIDVSDVNDNPPMFSKGNYSIVIQ----------ENKPVG--FSILHLAVTDKDSSHNGPPFTFVFLSGNEDNTF-----QMDEQGLITTAGTLSRKIKDLFVLHIQVSDNGKPQLSSFTNIEVRVIEESIHPPAILPLEIYITTFGEEYSGGV---IGKVHATDQD-VYDTLTY------SLDPKMEN-LFSVSKTGGKLIARKQLDVGQYLLNVSVSDGKFTTAADITVHIRQITQELLNHSITFRFANLSPEEFIGDYWR----NFQRSLR------------------------------NHLGGRKIDIQIISLQPSEPPRNLDVLLAAEKVGN-TYFAPKVLIQKINASIAEIEDISGVKILDVFHKLCLDVE-CPLRFCDEKISVDESVMSTHSTAR-LSFVTPRHHRRAICLC----KGGKCPTLDSLCDGNTCPEGTECVVD-VKEGKFNCVCP-------SDRPG-----------QC---NVGSSVTFTGNSYIKYRLMENENKEEMKLSLKLRTYSAHAVVMYARGTDYSILEI---QGGKLQYKFDCGSGPGIVSVQSIH-VNDGQWHTVSLEVDG------NYARLVLDRVHTASGTAPGTLRTLNLDNHVFFGGHMRQQGSKHGRNLQ----VTNGFRGCMDAVLLNGQELP---LNSKSKNNVHIEESVDISSGCSLSAA-DVCSGSPCQNGGTCSPL-----SNGGYYCKCSSLFMGTHCDISINPCASNPCLYGGTCIVVKEDFMCHCRGDYTGPRCQFGPYCKD--NPCKNSGKCIDS-----LDGPVCECESGFHGDKCLNDIDECLENP--C-PTGAMCENTYGSYSCNCSNGYGGKLC 4163          
BLAST of Ft-2 vs. Ensembl Xenopus
Match: hras (Harvey rat sarcoma viral oncogene homolog [Source:Xenbase;Acc:XB-GENE-479381])

HSP 1 Score: 1124.38 bits (2907), Expect = 0.000e+0
Identity = 1217/4563 (26.67%), Postives = 2014/4563 (44.14%), Query Frame = 3
Query:  222 SLSISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTK--YTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVKYLSKYFDPDFN-DYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNVF---LTPTGELNRYVLKLRAIFSPISTPAISVTIEAKDLSLNPKTSST---HLTIPLGNLRNINLLSVPEFVSVSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLEGTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIA-VAMNDSLETKKTFT-LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDI---YVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXX-XXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNI-LIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSEN----DKSKLYLAYLPSDS----INIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRA----TYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIK-PSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILS-RFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNP--TILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKS-ALDREERPFVQLLVLAKGWDG--SYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIR-VKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHI--VDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVLNEYYNI-FKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRE--RKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSIN---VTVKINILYDK----KKVNPIITCSIMTIQENNPLNHIVAMCRISSTE------MKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINV--EYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSL-YQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHV--TNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPF----LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPK-SNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRTLWV---QVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKPNIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQL------APDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGA--RNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHC 13634
            S S+ FT+  YN  +Y++   + YV H   +MGI   +    I YKI  S +  N F+AE   +GDF +LRIRTK   TA LNRE    Y LT++ + E  S  +     +T++ ++VLD ND  P+F   ++     EN +I + I  VTATDAD G N E +Y   +           F+I+P SG I    +L D+        +I A+ RG        + S + L+I V   N HAP IS   L+    P+ + D  +A +TV D D+  N       I+       P+ +F    T  G     ++ ++     +     ++T++AKD    P+ S+T   HLT        +      +     I E A  N+ V L+K        N+ +K  FR   D +  +S+N  +   S +             SP +   ++ + ++     KK FT + I V   N   P          V EN+ IG +V  + A D D      I+Y + + N  PF +  F   V+   E+LD E M R + +++  +D G P  R       I + ++N+  P F    C+ T+    P DL +G  I     +D D    ++  I S   +   F+++P SG LSL      G  +K++ +++ + A D   ++  + +N +V        S + + L+C +  +           +   N     E          + P F + +PS+I I+E    G  +  I M+  D D   +  + ++ +    +   F++   D  +  + +   LDRE  D+Y++ I V D G P+   ++  ++ V D+NDNPP FL +S+ +   L EN +    I+Q++A D D   + +++Y ++    +F I+S TG ++    LDREK+  + + I A D       L +   L + V D+NDN P+F  ++Y + + EDLP+G+ +  L A D D+  + Q+R+++       F  D  +GAV ++ +L       Y L A  KD GKP +LSS     +    V+ N + P   E +   +IRE+   GT V ++     D      + Y+I   S G+ +F I+ E G IRT  ++DRE    YWL +Y  DR    ++  + ++YI++ D NDN P      Y   V EN      ++ + A D D     +L YKI +G+  G+F+I+  TG I+T+ R +DRE           + L+V I+D+G P +     + V ++D NDN P F+      F +    E     R +N     I RV AVD D   NA + Y+++              F ++ K+G + +  SS+       G   I    +++ A D G P   +      T RL++   A    S      ++     + + SD     I ++  E +GS L         D  G + + + D   G  ++I A+                D+       +T+E T        Q  V+I +   N + P F   S+   ++ I +  +P   I  V A                     + D    +IY++ +S DP++++K F ++   G L      +  + Q   + V  R++       + ++ I++ DTN+  P F  S  +  +Y                                         +++G+ +  +SA D+D G+N ++ ++I++ + A N F +D   G I+  + L    +    L +  +D G PP     + ++ I     +++ P+  + +    + E   V S +       +     +   VV  I+  +T   F +  ++G + T   LD E +    ++ +Q  +  GL +  NS ++V  H+ D NDN P F       G+ISESA P S+V        L+     LVI A D D+  N  + Y I+      YF ID  TG L   L +D E    F   ++++ D G P+L ++    + I + D NDC P F KD Y   L+LPT+    ++ +   D D      +++SI+ G     F IDP  G + +       +    S   + IRA DG+F +  ++ IN    ++   L   +      + EN   V  L +       S  +  + + +L+  P+ +I+  +G L       DREE    +L+V         +  ++ V V+V D ND  P+F++  Y  +V  + + E   IR V A+D D G+NG + Y   Y+K  +   +      SG I ++     +   K++ I + A D G P+ SS   V + +++   P+F+   YS  + E+A     V  V+A S  G+ I+Y+IT+G+    F+++F          VI +   LD+E+ P + L + ATD  +       V I + D+ND  P+F + +Y+A++SE   I   ++ I+        +  + F L    ++S   SQ+F I+ ++G I   + LD+E     E  ++V+      P     + VHI   D NDNPP FIQ  +   IS  S  G  V    ATD D++   KL Y +L+   ++ F I+  +G I    V  + K++ +       V V D      A V V   S   H P F  NE+ + +SEN  V + +  + A D DK  +G+L YH+I  F  + F ++   G L   +  DRE     +  + V+  D G K  F  V + +TD NDN+P      Y+V+ I S    GT    I+++ A D D      + Y + +    QS A V+   G      + I + S +GL                 E+ +YS+ +  T          V V I IL  +    K   P  T   ++I E+  +   + + +  S E      MKG      ++   ++ + F ID   G ++ +K +D E+   Y+  V          ++++  + I + D ND  P+FD++ Y  FI E++P G+KV+Q +A+D D      + Y L +  D  E    F +D + GWV ++  +D+E+T   ++VV A D    V  +++T+ ++V DVND  P +T       +   +  DG       V+  LS  DND+E   + + F IT  +    +A   +    +V +  PLD E +     L   A+D    +K   ++ ++V+D ND+ PVC +      I E    G VI  + A D D  +    + YTL         +  P TG +  + PLDRE     + +V A D   + C   + + + D+NDNAP F   S  P+     EN    + + ++ A+DAD G+N K+ Y ++  ++  FSID  +GI+ +   LDRE Q  + L ++A+D G P K S++ +V + +LD+ND+PP F +      + ED  +G  ++ + A S DI VNAE++Y++I+  E   F +  ++G + +I  LD+E S EY+LTV A+D G P LS    V I V DVNDN P F    Y   + E++ VS  ++  V A D+D  LN+ + YS     P                F I+P  GE+ +N + DRE    Y   +   D+G P   + T V I++ D NDNPP F++ ++  +IQ          E K  G  F +  L + DKD   N  PF    L+    + F     ++ ++ ++  AG+L   ++ L+V   QV+DNG+P L     + V VI  S  PP I PL +    F  E   G    I +V   D+   +D LT+      +L  ++ N  F +    G +   + LD G Y LNV V++   +T   I + I  +T++++  +   + +++ P  F          +F +S+                               + +  R+I  Q+       P   +DVL+A        +F    L+ +I     ++  I     + +F+ +C D   C    C   I V+  +   +     ++F++      + CLC    +G +C    + C    C     C  D  K   F C CP        +RP            QC    V   + FTG  +I + L E  N   M++    R     A +M  +      + I     GK+    D  + P I   +S++ + DG+WH V L + G       +  +V+D +     +    +   + +  +  G   R   S    NL+    +     GC+  V+LN Q+LP   L +   ++     S +++ GCS S    +C+   C+NGG C        +   Y C+C   F G +C+I  + C  +PC++GG C+  K  F C C    TGPRCQ+G  C    NPC     CI+          VC+C     G  C  D+DEC   P  C P   +C N +  Y CNC+ GY G  C
Sbjct:   72 SSSMQFTQYSYNATVYENSAAKTYVGH-PTKMGIYLKDPSWDIKYKII-SGDNENIFKAEEHNLGDFCFLRIRTKGGNTAILNREVKDNYLLTVKAV-EKNSNAE----ARTRIRVQVLDTNDLRPLFSPTSYSVSLPENTAIRSSIAKVTATDADIGTNGEFYYSFKERTDM-------FAIHPTSGTIVLTGRL-DYTETKHYEMEILAVDRGLKLYGSSGISSMARLNIYVEQANEHAPVISAVRLTH---PELDKDLTYAIVTVDDNDQGPNGEIASLSIIA----GDPLQLFKTTRTSPGSKEYKIVAVKETEWEMQPFGYNLTLQAKDKGSPPQFSATKVIHLTSSRFKYGAVKFEK--DIYRTEISEFAPPNTPVVLVKAV----PSNSHIKYAFRNSAD-KNRFSINPNTGLISTL-------------SPVKAKILSHIELDIITSDKKAFTKVLIKVLGTNINTPEFTQTSYKAVVDENSPIGSSVFSVHAVDHDEGENGFITYSIANINPQPFAIDAFS-GVITTLEDLDYELMPRIYTLKIRASDWGLPYRRETEIPVTITLNNLNDNIPLFEKVNCEGTV----PKDLGVGEQITTVSAIDADELQLVKYRIESGD-ELDLFTLNPNSGVLSLKQPLSEGPANKVSFYSLRITATDGENLAQPIYINITVTS------SRKGVHLNCEETGVAKMLAERLLQANKLFNRGTQEEVYFDSHMTNTHAPHFKSILPSIIAIKENVPVGANI--IHMEANDLDAG-FSGKLLYAISGGNDDSCFAV---DMETGWLKILSPLDRELKDQYNLNITVYDLGIPQKSSWRLLDVNVLDVNDNPPEFLQESYSV--HLKENEEGHNAIIQVQAVDKDLGVNGEVKYSILTDTDIFTINSETGVIKAVAPLDREKQHTHLLKIEARDQAENEPQLFSHVLLKVTVEDVNDNPPVFIPSNYHVKVREDLPVGTVITWLDAYDPDVGLSGQVRFSLLENGDGKFEVDKVSGAVRIIQELDFEEKQVYNLTARAKDRGKPVSLSSACYINVELIDVNENLHTPLFSEFVSKGSIREDVPIGTPVMTVSAHDEDTGRDGEIRYSIRDGS-GVGVFTIHEEKGTIRTADNLDRETTSHYWLTVYATDRGVVPLSSFI-QIYIEIEDVNDNAPQTVEPVYYPEVMENSAKDVSVVQINAFDPDSISSDKLTYKISTGNPQGFFAINPKTGLITTTSRKLDREQQSE-------HILEVTITDNGHPAKSAVTRVIVKVLDENDNKPQFLQK----FYKIRLPEREKPERERNAKRDPIYRVVAVDKDDGANAEISYSIE-------EGDEHGKFFIEPKTGVVSSKKSSAA------GEYDI----LSIKAVDNGRPQKSS------TTRLHIEWIAKPAPSAEPITFEEPSFSFSVMESDPVAHMIGVITTEPLGSPLW-------FDITGGNYDSRFDVDKGTGTIIVARP--------------LDAEQKSNYNLTVEATDGTRSVSTQ--VSIKVIDTNDHRPEF---STSKYEVLIPEDVQPDTEILQVIA--------------------IDRDEKNKLIYTLQSSTDPVSLKK-FRMDPATGSLYTTEKLDHETMQQHILTVMVRDQDVPVLRNFARIVINVTDTNDHAPWFTSSFYEGRVYE---------------------------------------SAAVGSAVLQVSALDKDKGKNAEVGYSIESGNTA-NAFTIDPVLGIIKTAKELDRNNHGRYELVVKATDHGIPPL--SQITSIHIFVTISNNAAPKFTKKEYSSEISETAHVGSFV-------AMLSAYSQSSVVYEIRDGNTLNSFDINPNSGVVTTQKQLDFETLPSF-TLTVQATNMAGLST--NSTLTV--HVRDENDNFPVF-AQTNYRGLISESAPPNSVV--------LTDDNIPLVIRATDSDQESNALLVYQIVEPSVHKYFAIDSSTGALRTLLSLDYEQTNIF-HFTVQVHDMGYPRLFAENAANVTIYVVDINDCAPVFSKDVYETSLLLPTYKGVRVITVNATDDDSGAYSQLIYSIIEGNIGDKFLIDPLKGTITVQN-----TTNLRSRYELTIRASDGRFSSLTSVKIN-VKESKESSLKFTQRSYSATVLENATKVKTLTIISP--LGSRINEPLFFHILNPDPRFKISPTSGVLSTTGIPFDREEEDLFELVVEVSDEQKPPTVAHVLVQVTVEDVNDNNPVFVNLPYYAMVQID-APEGHLIRHVTAVDRDIGKNGEITY---YLKEHSQQFQIG---PSGEIKLKKQFDPDSSNKEYFITVVAKDSGNPSYSSEVVVPITVMNKAMPVFENPFYSAEIAENANLHSPVVHVQANSPEGYRIIYSITDGDPFNQFNINFNTG-------VINVFAPLDFESHPAYKLRVRATDSLTGAHAEVFVDIILEDVNDNPPVFREKTYAATLSEASVIGTSVVQINAKDPDSGQNNAISFHLV---ETSGNISQYFHIDASSGLIETAKPLDYE--YFQECTLVVRATDNGIPPLSNDISVHIGLTDLNDNPPAFIQQVYEVKISELSKPGHFVTCVKATDADSSDTEKLEYSILSGNDDMNFIINSKTGVI---TVSYLRKMILNP-FYSINVSVSDGVFRSSAQVHVTVKSANLHSPKFGQNEYEVELSENSPVQTLVTELKAVDEDKGLYGQLTYHIINDFAKDNFNINE-RGQLFTAERFDREIPTNKVIPVSVMAKDTGGKVGFCIVNVILTDSNDNVPQFRATEYKVS-IASDVPRGT---PIVKVIASDSDEGANADIFYSIEA----QS-ASVEENFGISQSSGTIITKESLIGL-----------------EDEVYSFFVKATDGGTPQKESLVPVFIRILPPEVVLPKFSEPFYT---LSISEDTAVGTELDVVKAESNEPIIYSLMKG------NTLESNLDDVFVIDKQNGRLKLEKQLDHESTKWYQFYVLAHNLHGEHEIISSVDVSILVKDVNDNAPVFDSNPYKAFIVENLPEGTKVVQVRAFDLDVGSNGQVSYMLGHSQDLEEIKELFSVDRETGWVTTLGELDHEKTNKYHIVVVAYDHGDKVLSSSSTIEVTVMDVNDNPPRFTAEIYKGTVSEDDPPDG-------VIAILSTTDNDTEEINKEVTFHITGGDPLGQFAIENMQHEWKVYVRKPLDRE-VKDNYLLNITATDGTFATKA--VVEVKVLDANDNTPVCEKTSYAETISEDALAGRVILQVAASDADIRSNAEII-YTLHGVGAEKFHL-NPFTGELKTSLPLDREILEVYHLMVKATDGGGRFCQAAVELTLEDVNDNAPEF---SADPYTVTVYENTEPQTPLLRVQAIDADLGLNHKVQYSLVSSAEGQFSIDELSGIISLEKPLDRELQAVYTLTVKATDQGLPRKLSSVASVVVSVLDINDNPPVFEHREYGSSLTEDAPVGTEVLQVYATSRDIEVNAEITYKIISGNEHGKFTINPVTGMIFIIASLDYETSPEYYLTVEATDGGTPPLSDVASVNINVTDVNDNSPVFSQNTYTTVVGEDS-VSGQSVLMVVADDADGPLNNHIRYSITEGNPGNT-------------FIIDPVRGEVKVNKLLDRELISGYTLTIQAEDNGQPPRRNTTTVNIDVSDVNDNPPMFSKGNYSIVIQ----------ENKPVG--FSILHLAVTDKDSSHNGPPFTFVFLSGNEDNTF-----QMDEQGLITTAGTLSRKIKDLFVLHIQVSDNGKPQLSSFTNIEVRVIEESIHPPAILPLEIYITTFGEEYSGGV---IGKVHATDQD-VYDTLTY------SLDPKMEN-LFSVSKTGGKLIARKQLDVGQYLLNVSVSDGKFTTAADITVHIRQITQELLNHSITFRFANLSPEEFIGDYWR----NFQRSLR------------------------------NHLGGRKIDIQIISLQPSEPPRNLDVLLAAEKVGN-TYFAPKVLIQKINASIAEIEDISGVKILDVFHKLCLDVE-CPLRFCDEKISVDESVMSTHSTAR-LSFVTPRHHRRAICLC----KGGKCPTLDSLCDGNTCPEGTECVVD-VKEGKFNCVCP-------SDRPG-----------QC---NVGSSVTFTGNSYIKYRLMENENKEEMKLSLKLRTYSAHAVVMYARGTDYSILEI---QGGKLQYKFDCGSGPGIVSVQSIH-VNDGQWHTVSLEVDG------NYARLVLDRVHTASGTAPGTLRTLNLDNHVFFGGHMRQQGSKHGRNLQ----VTNGFRGCMDAVLLNGQELP---LNSKSKNNVHIEESVDISSGCSLSAA-DVCSGSPCQNGGTCSPL-----SNGGYYCKCSSLFMGTHCDISINPCASNPCLYGGTCIVVKEDFMCHCRGDYTGPRCQFGPYCKD--NPCKNSGKCIDS-----LDGPVCECESGFHGDKCLNDIDECLENP--C-PTGAMCENTYGSYSCNCSNGYGGKLC 4205          
BLAST of Ft-2 vs. Ensembl Xenopus
Match: hras (Harvey rat sarcoma viral oncogene homolog [Source:Xenbase;Acc:XB-GENE-479381])

HSP 1 Score: 1123.61 bits (2905), Expect = 0.000e+0
Identity = 1219/4563 (26.71%), Postives = 2015/4563 (44.16%), Query Frame = 3
Query:  222 SLSISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTK--YTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVKYLSKYFDPDFN-DYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNVF---LTPTGELNRYVLKLRAIFSPISTPAISVTIEAKDLSLNPKTSST---HLTIPLGNLRNINLLSVPEFVSVSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLEGTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIA-VAMNDSLETKKTFT-LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDI---YVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXX-XXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNI-LIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSEN----DKSKLYLAYLPSDS----INIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRA----TYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIK-PSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILS-RFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNP--TILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKS-ALDREERPFVQLLVLAKGWDG--SYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIR-VKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHI--VDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVLNEYYNI-FKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRE--RKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSIN---VTVKINILYDK----KKVNPIITCSIMTIQENNPLNHIVAMCRISSTE------MKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINV--EYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSL-YQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHV--TNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPF----LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPK-SNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRTLWV---QVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKPNIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQL------APDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGA--RNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHC 13634
            S S+ FT+  YN  +Y++   + YV H   +MGI   +    I YKI  S +  N F+AE   +GDF +LRIRTK   TA LNRE    Y LT++ + E  S  +     +T++ ++VLD ND  P+F   ++     EN +I + I  VTATDAD G N E +Y   +           F+I+P SG I    +L D+        +I A+ RG        + S + L+I V   N HAP IS   L+    P+ + D  +A +TV D D+  N       I+       P+ +F    T  G     ++ ++     +     ++T++AKD    P+ S+T   HLT        +      +     I E A  N+ V L+K        N+ +K  FR   D +  +S+N  +   S +             SP +   ++ + ++     KK FT + I V   N   P          V EN+ IG +V  + A D D      I+Y + + N  PF +  F   V+   E+LD E M R + +++  +D G P  R       I + ++N+  P F    C+ T+    P DL +G  I     +D D    ++  I S   +   F+++P SG LSL      G  +K++ +++ + A D   ++  + +N +V        S + + L+C +  +           +   N     E          + P F + +PS+I I+E    G  +  I M+  D D   +  + ++ +    +   F++   D  +  + +   LDRE  D+Y++ I V D G P+   ++  ++ V D+NDNPP FL +S+ +   L EN +    I+Q++A D D   + +++Y ++    +F I+S TG ++    LDREK+  + + I A D       L +   L + V D+NDN P+F  ++Y + + EDLP+G+ +  L A D D+  + Q+R+++       F  D  +GAV ++ +L       Y L A  KD GKP +LSS     +    V+ N + P   E +   +IRE+   GT V ++     D      + Y+I   S G+ +F I+ E G IRT  ++DRE    YWL +Y  DR    ++  + ++YI++ D NDN P      Y   V EN      ++ + A D D     +L YKI +G+  G+F+I+  TG I+T+ R +DRE           + L+V I+D+G P +     + V ++D NDN P F+      F +    E     R +N     I RV AVD D   NA + Y+++              F ++ K+G + +  SS+       G   I    +++ A D G P   +      T RL++   A    S      ++     + + SD     I ++  E +GS L         D  G + + + D   G  ++I A+                D+       +T+E T        Q  V+I +   N + P F   S+   ++ I +  +P   I  V A                     + D    +IY++ +S DP++++K F ++   G L      +  + Q   + V  R++       + ++ I++ DTN+  P F  S  +  +Y                                         +++G+ +  +SA D+D G+N ++ ++I++ + A N F +D   G I+  + L    +    L +  +D G PP     + ++ I     +++ P+  + +    + E   V S +  L   S +        VV  I+  +T   F +  ++G + T   LD E +    ++ +Q  +  GL +  NS ++V  H+ D NDN P F       G+ISESA P S+V        L+     LVI A D D+  N  + Y I+      YF ID  TG L   L +D E    F   ++++ D G P+L ++    + I + D NDC P F KD Y   L+LPT+    ++ +   D D      +++SI+ G     F IDP  G + +       +    S   + IRA DG+F +  ++ IN    ++   L   +      + EN   V  L +       S  +  + + +L+  P+ +I+  +G L       DREE    +L+V         +  ++ V V+V D ND  P+F++  Y  +V  + + E   IR V A+D D G+NG + Y   Y+K  +   +      SG I ++     +   K++ I + A D G P+ SS   V + +++   P+F+   YS  + E+A     V  V+A S  G+ I+Y+IT+G+    F+++F          VI +   LD+E+ P + L + ATD  +       V I + D+ND  P+F + +Y+A++SE   I   ++ I+        +  + F L    ++S   SQ+F I+ ++G I   + LD+E     E  ++V+      P     + VHI   D NDNPP FIQ  +   IS  S  G  V    ATD D++   KL Y +L+   ++ F I+  +G I    V  + K++ +       V V D      A V V   S   H P F  NE+ + +SEN  V + +  + A D DK  +G+L YH+I  F  + F ++   G L   +  DRE     +  + V+  D G K  F  V + +TD NDN+P      Y+V+ I S    GT    I+++ A D D      + Y + +    QS A V+   G      + I + S +GL                 E+ +YS+ +  T          V V I IL  +    K   P  T   ++I E+  +   + + +  S E      MKG      ++   ++ + F ID   G ++ +K +D E+   Y+  V          ++++  + I + D ND  P+FD++ Y  FI E++P G+KV+Q +A+D D      + Y L +  D  E    F +D + GWV ++  +D+E+T   ++VV A D    V  +++T+ ++V DVND  P +T       +   +  DG       V+  LS  DND+E   + + F IT  +    +A   +    +V +  PLD E +     L   A+D    +K   ++ ++V+D ND+ PVC +      I E    G VI  + A D D  +    + YTL         +  P TG +  + PLDRE     + +V A D   + C   + + + D+NDNAP F   S  P+     EN    + + ++ A+DAD G+N K+ Y ++  ++  FSID  +GI+ +   LDRE Q  + L ++A+D G P K S++ +V + +LD+ND+PP F +      + ED  +G  ++ + A S DI VNAE++Y++I+  E   F +  ++G + +I  LD+E S EY+LTV A+D G P LS    V I V DVNDN P F    Y   + E++ VS  ++  V A D+D  LN+ + YS     P                F I+P  GE+ +N + DRE    Y   +   D+G P   + T V I++ D NDNPP F++ ++  +IQ          E K  G  F +  L + DKD   N  PF    L+    + F     ++ ++ ++  AG+L   ++ L+V   QV+DNG+P L     + V VI  S  PP I PL +    F  E   G    I +V   D+   +D LT+      +L  ++ N  F +    G +   + LD G Y LNV V++   +T   I + I  +T++++  +   + +++ P  F          +F +S+                               + +  R+I  Q+       P   +DVL+A        +F    L+ +I     ++  I     + +F+ +C D   C    C   I V+  +   +     ++F++      + CLC    +G +C    + C    C     C  D  K   F C CP        +RP            QC    V   + FTG  +I + L E  N   M++    R     A +M  +      + I     GK+    D  + P I   +S++ + DG+WH V L + G       +  +V+D +     +    +   + +  +  G   R   S    NL+    +     GC+  V+LN Q+LP   L +   ++     S +++ GCS S    +C+   C+NGG C        +   Y C+C   F G +C+I  + C  +PC++GG C+  K  F C C    TGPRCQ+G  C    NPC     CI+          VC+C     G  C  D+DEC   P  C P   +C N +  Y CNC+ GY G  C
Sbjct:   30 SSSMQFTQYSYNATVYENSAAKTYVGH-PTKMGIYLKDPSWDIKYKII-SGDNENIFKAEEHNLGDFCFLRIRTKGGNTAILNREVKDNYLLTVKAV-EKNSNAE----ARTRIRVQVLDTNDLRPLFSPTSYSVSLPENTAIRSSIAKVTATDADIGTNGEFYYSFKERTDM-------FAIHPTSGTIVLTGRL-DYTETKHYEMEILAVDRGLKLYGSSGISSMARLNIYVEQANEHAPVISAVRLTH---PELDKDLTYAIVTVDDNDQGPNGEIASLSIIA----GDPLQLFKTTRTSPGSKEYKIVAVKETEWEMQPFGYNLTLQAKDKGSPPQFSATKVIHLTSSRFKYGAVKFEK--DIYRTEISEFAPPNTPVVLVKAV----PSNSHIKYAFRNSAD-KNRFSINPNTGLISTL-------------SPVKAKILSHIELDIITSDKKAFTKVLIKVLGTNINTPEFTQTSYKAVVDENSPIGSSVFSVHAVDHDEGENGFITYSIANINPQPFAIDAFS-GVITTLEDLDYELMPRIYTLKIRASDWGLPYRRETEIPVTITLNNLNDNIPLFEKVNCEGTV----PKDLGVGEQITTVSAIDADELQLVKYRIESGD-ELDLFTLNPNSGVLSLKQPLSEGPANKVSFYSLRITATDGENLAQPIYINITVTS------SRKGVHLNCEETGVAKMLAERLLQANKLFNRGTQEEVYFDSHMTNTHAPHFKSILPSIIAIKENVPVGANI--IHMEANDLDAG-FSGKLLYAISGGNDDSCFAV---DMETGWLKILSPLDRELKDQYNLNITVYDLGIPQKSSWRLLDVNVLDVNDNPPEFLQESYSV--HLKENEEGHNAIIQVQAVDKDLGVNGEVKYSILTDTDIFTINSETGVIKAVAPLDREKQHTHLLKIEARDQAENEPQLFSHVLLKVTVEDVNDNPPVFIPSNYHVKVREDLPVGTVITWLDAYDPDVGLSGQVRFSLLENGDGKFEVDKVSGAVRIIQELDFEEKQVYNLTARAKDRGKPVSLSSACYINVELIDVNENLHTPLFSEFVSKGSIREDVPIGTPVMTVSAHDEDTGRDGEIRYSIRDGS-GVGVFTIHEEKGTIRTADNLDRETTSHYWLTVYATDRGVVPLSSFI-QIYIEIEDVNDNAPQTVEPVYYPEVMENSAKDVSVVQINAFDPDSISSDKLTYKISTGNPQGFFAINPKTGLITTTSRKLDREQQSE-------HILEVTITDNGHPAKSAVTRVIVKVLDENDNKPQFLQK----FYKIRLPEREKPERERNAKRDPIYRVVAVDKDDGANAEISYSIE-------EGDEHGKFFIEPKTGVVSSKKSSAA------GEYDI----LSIKAVDNGRPQKSS------TTRLHIEWIAKPAPSAEPITFEEPSFSFSVMESDPVAHMIGVITTEPLGSPLW-------FDITGGNYDSRFDVDKGTGTIIVARP--------------LDAEQKSNYNLTVEATDGTRSVSTQ--VSIKVIDTNDHRPEF---STSKYEVLIPEDVQPDTEILQVIA--------------------IDRDEKNKLIYTLQSSTDPVSLKK-FRMDPATGSLYTTEKLDHETMQQHILTVMVRDQDVPVLRNFARIVINVTDTNDHAPWFTSSFYEGRVYE---------------------------------------SAAVGSAVLQVSALDKDKGKNAEVGYSIESGNTA-NAFTIDPVLGIIKTAKELDRNNHGRYELVVKATDHGIPPL--SQITSIHIFVTISNNAAPKFTKKEYSSEISETAHVGSFVAMLSAYSQSS-------VVYEIRDGNTLNSFDINPNSGVVTTQKQLDFETLPSF-TLTVQATNMAGLST--NSTLTV--HVRDENDNFPVF-AQTNYRGLISESAPPNSVV--------LTDDNIPLVIRATDSDQESNALLVYQIVEPSVHKYFAIDSSTGALRTLLSLDYEQTNIF-HFTVQVHDMGYPRLFAENAANVTIYVVDINDCAPVFSKDVYETSLLLPTYKGVRVITVNATDDDSGAYSQLIYSIIEGNIGDKFLIDPLKGTITVQN-----TTNLRSRYELTIRASDGRFSSLTSVKIN-VKESKESSLKFTQRSYSATVLENATKVKTLTIISP--LGSRINEPLFFHILNPDPRFKISPTSGVLSTTGIPFDREEEDLFELVVEVSDEQKPPTVAHVLVQVTVEDVNDNNPVFVNLPYYAMVQID-APEGHLIRHVTAVDRDIGKNGEITY---YLKEHSQQFQIG---PSGEIKLKKQFDPDSSNKEYFITVVAKDSGNPSYSSEVVVPITVMNKAMPVFENPFYSAEIAENANLHSPVVHVQANSPEGYRIIYSITDGDPFNQFNINFNTG-------VINVFAPLDFESHPAYKLRVRATDSLTGAHAEVFVDIILEDVNDNPPVFREKTYAATLSEASVIGTSVVQINAKDPDSGQNNAISFHLV---ETSGNISQYFHIDASSGLIETAKPLDYE--YFQECTLVVRATDNGIPPLSNDISVHIGLTDLNDNPPAFIQQVYEVKISELSKPGHFVTCVKATDADSSDTEKLEYSILSGNDDMNFIINSKTGVI---TVSYLRKMILNP-FYSINVSVSDGVFRSSAQVHVTVKSANLHSPKFGQNEYEVELSENSPVQTLVTELKAVDEDKGLYGQLTYHIINDFAKDNFNINE-RGQLFTAERFDREIPTNKVIPVSVMAKDTGGKVGFCIVNVILTDSNDNVPQFRATEYKVS-IASDVPRGT---PIVKVIASDSDEGANADIFYSIEA----QS-ASVEENFGISQSSGTIITKESLIGL-----------------EDEVYSFFVKATDGGTPQKESLVPVFIRILPPEVVLPKFSEPFYT---LSISEDTAVGTELDVVKAESNEPIIYSLMKG------NTLESNLDDVFVIDKQNGRLKLEKQLDHESTKWYQFYVLAHNLHGEHEIISSVDVSILVKDVNDNAPVFDSNPYKAFIVENLPEGTKVVQVRAFDLDVGSNGQVSYMLGHSQDLEEIKELFSVDRETGWVTTLGELDHEKTNKYHIVVVAYDHGDKVLSSSSTIEVTVMDVNDNPPRFTAEIYKGTVSEDDPPDG-------VIAILSTTDNDTEEINKEVTFHITGGDPLGQFAIENMQHEWKVYVRKPLDRE-VKDNYLLNITATDGTFATKA--VVEVKVLDANDNTPVCEKTSYAETISEDALAGRVILQVAASDADIRSNAEII-YTLHGVGAEKFHL-NPFTGELKTSLPLDREILEVYHLMVKATDGGGRFCQAAVELTLEDVNDNAPEF---SADPYTVTVYENTEPQTPLLRVQAIDADLGLNHKVQYSLVSSAEGQFSIDELSGIISLEKPLDRELQAVYTLTVKATDQGLPRKLSSVASVVVSVLDINDNPPVFEHREYGSSLTEDAPVGTEVLQVYATSRDIEVNAEITYKIISGNEHGKFTINPVTGMIFIIASLDYETSPEYYLTVEATDGGTPPLSDVASVNINVTDVNDNSPVFSQNTYTTVVGEDS-VSGQSVLMVVADDADGPLNNHIRYSITEGNPGNT-------------FIIDPVRGEVKVNKLLDRELISGYTLTIQAEDNGQPPRRNTTTVNIDVSDVNDNPPMFSKGNYSIVIQ----------ENKPVG--FSILHLAVTDKDSSHNGPPFTFVFLSGNEDNTF-----QMDEQGLITTAGTLSRKIKDLFVLHIQVSDNGKPQLSSFTNIEVRVIEESIHPPAILPLEIYITTFGEEYSGGV---IGKVHATDQD-VYDTLTY------SLDPKMEN-LFSVSKTGGKLIARKQLDVGQYLLNVSVSDGKFTTAADITVHIRQITQELLNHSITFRFANLSPEEFIGDYWR----NFQRSLR------------------------------NHLGGRKIDIQIISLQPSEPPRNLDVLLAAEKVGN-TYFAPKVLIQKINASIAEIEDISGVKILDVFHKLCLDVE-CPLRFCDEKISVDESVMSTHSTAR-LSFVTPRHHRRAICLC----KGGKCPTLDSLCDGNTCPEGTECVVD-VKEGKFNCVCP-------SDRPG-----------QC---NVGSSVTFTGNSYIKYRLMENENKEEMKLSLKLRTYSAHAVVMYARGTDYSILEI---QGGKLQYKFDCGSGPGIVSVQSIH-VNDGQWHTVSLEVDG------NYARLVLDRVHTASGTAPGTLRTLNLDNHVFFGGHMRQQGSKHGRNLQ----VTNGFRGCMDAVLLNGQELP---LNSKSKNNVHIEESVDISSGCSLSAA-DVCSGSPCQNGGTCSPL-----SNGGYYCKCSSLFMGTHCDISINPCASNPCLYGGTCIVVKEDFMCHCRGDYTGPRCQFGPYCKD--NPCKNSGKCIDS-----LDGPVCECESGFHGDKCLNDIDECLENP--C-PTGAMCENTYGSYSCNCSNGYGGKLC 4163          
BLAST of Ft-2 vs. Ensembl Xenopus
Match: hras (Harvey rat sarcoma viral oncogene homolog [Source:Xenbase;Acc:XB-GENE-479381])

HSP 1 Score: 1120.53 bits (2897), Expect = 0.000e+0
Identity = 1217/4560 (26.69%), Postives = 2013/4560 (44.14%), Query Frame = 3
Query:  222 SLSISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTK--YTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVKYLSKYFDPDFN-DYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNVFLTPTGELNRYVLKLRAIFSPISTPAISVTIEAKDLSLNPKTSST---HLTIPLGNLRNINLLSVPEFVSVSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLEGTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIA-VAMNDSLETKKTFT-LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDI---YVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXX-XXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNI-LIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSEN----DKSKLYLAYLPSDS----INIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRA----TYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIK-PSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILS-RFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNP--TILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKS-ALDREERPFVQLLVLAKGWDG--SYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIR-VKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHI--VDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVLNEYYNI-FKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRE--RKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSIN---VTVKINILYDK----KKVNPIITCSIMTIQENNPLNHIVAMCRISSTE------MKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINV--EYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSL-YQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHV--TNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPF----LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPK-SNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRTLWV---QVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKPNIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQL------APDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGA--RNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHC 13634
            S S+ FT+  YN  +Y++   + YV H   +MGI   +    I YKI  S +  N F+AE   +GDF +LRIRTK   TA LNRE    Y LT++ + E  S  +     +T++ ++VLD ND  P+F   ++     EN +I + I  VTATDAD G N E +Y   +           F+I+P SG I    +L D+        +I A+ RG        + S + L+I V   N HAP IS   L+    P+ + D  +A +TV D D+  N       I I   P        T  G     ++ ++     +     ++T++AKD    P+ S+T   HLT        +      +     I E A  N+ V L+K        N+ +K  FR   D +  +S+N  +   S +             SP +   ++ + ++     KK FT + I V   N   P          V EN+ IG +V  + A D D      I+Y + + N  PF +  F   V+   E+LD E M R + +++  +D G P  R       I + ++N+  P F    C+ T+    P DL +G  I     +D D    ++  I S   +   F+++P SG LSL      G  +K++ +++ + A D   ++  + +N +V        S + + L+C +  +           +   N     E          + P F + +PS+I I+E    G  +  I M+  D D   +  + ++ +    +   F++   D  +  + +   LDRE  D+Y++ I V D G P+   ++  ++ V D+NDNPP FL +S+ +   L EN +    I+Q++A D D   + +++Y ++    +F I+S TG ++    LDREK+  + + I A D       L +   L + V D+NDN P+F  ++Y + + EDLP+G+ +  L A D D+  + Q+R+++       F  D  +GAV ++ +L       Y L A  KD GKP +LSS     +    V+ N + P   E +   +IRE+   GT V ++     D      + Y+I   S G+ +F I+ E G IRT  ++DRE    YWL +Y  DR    ++  + ++YI++ D NDN P      Y   V EN      ++ + A D D     +L YKI +G+  G+F+I+  TG I+T+ R +DRE           + L+V I+D+G P +     + V ++D NDN P F+      F +    E     R +N     I RV AVD D   NA + Y+++              F ++ K+G + +  SS+       G   I    +++ A D G P   +      T RL++   A    S      ++     + + SD     I ++  E +GS L         D  G + + + D   G  ++I A+                D+       +T+E T        Q  V+I +   N + P F   S+   ++ I +  +P   I  V A                     + D    +IY++ +S DP++++K F ++   G L      +  + Q   + V  R++       + ++ I++ DTN+  P F  S  +  +Y                                         +++G+ +  +SA D+D G+N ++ ++I++ + A N F +D   G I+  + L    +    L +  +D G PP     + ++ I     +++ P+  + +    + E   V S +  L   S +        VV  I+  +T   F +  ++G + T   LD E +    ++ +Q  +  GL +  NS ++V  H+ D NDN P F       G+ISESA P S+V        L+     LVI A D D+  N  + Y I+      YF ID  TG L   L +D E    F   ++++ D G P+L ++    + I + D NDC P F KD Y   L+LPT+    ++ +   D D      +++SI+ G     F IDP  G + +       +    S   + IRA DG+F +  ++ IN    ++   L   +      + EN   V  L +       S  +  + + +L+  P+ +I+  +G L       DREE    +L+V         +  ++ V V+V D ND  P+F++  Y  +V  + + E   IR V A+D D G+NG + Y   Y+K  +   +      SG I ++     +   K++ I + A D G P+ SS   V + +++   P+F+   YS  + E+A     V  V+A S  G+ I+Y+IT+G+    F+++F          VI +   LD+E+ P + L + ATD  +       V I + D+ND  P+F + +Y+A++SE   I   ++ I+        +  + F L    ++S   SQ+F I+ ++G I   + LD+E     E  ++V+      P     + VHI   D NDNPP FIQ  +   IS  S  G  V    ATD D++   KL Y +L+   ++ F I+  +G I    V  + K++ +       V V D      A V V   S   H P F  NE+ + +SEN  V + +  + A D DK  +G+L YH+I  F  + F ++   G L   +  DRE     +  + V+  D G K  F  V + +TD NDN+P      Y+V+ I S    GT    I+++ A D D      + Y + +    QS A V+   G      + I + S +GL                 E+ +YS+ +  T          V V I IL  +    K   P  T   ++I E+  +   + + +  S E      MKG      ++   ++ + F ID   G ++ +K +D E+   Y+  V          ++++  + I + D ND  P+FD++ Y  FI E++P G+KV+Q +A+D D      + Y L +  D  E    F +D + GWV ++  +D+E+T   ++VV A D    V  +++T+ ++V DVND  P +T       +   +  DG       V+  LS  DND+E   + + F IT  +    +A   +    +V +  PLD E +     L   A+D    +K   ++ ++V+D ND+ PVC +      I E    G VI  + A D D  +    + YTL         +  P TG +  + PLDRE     + +V A D   + C   + + + D+NDNAP F   S  P+     EN    + + ++ A+DAD G+N K+ Y ++  ++  FSID  +GI+ +   LDRE Q  + L ++A+D G P K S++ +V + +LD+ND+PP F +      + ED  +G  ++ + A S DI VNAE++Y++I+  E   F +  ++G + +I  LD+E S EY+LTV A+D G P LS    V I V DVNDN P F    Y   + E++ VS  ++  V A D+D  LN+ + YS     P                F I+P  GE+ +N + DRE    Y   +   D+G P   + T V I++ D NDNPP F++ ++  +IQ          E K  G  F +  L + DKD   N  PF    L+    + F     ++ ++ ++  AG+L   ++ L+V   QV+DNG+P L     + V VI  S  PP I PL +    F  E   G    I +V   D+   +D LT+      +L  ++ N  F +    G +   + LD G Y LNV V++   +T   I + I  +T++++  +   + +++ P  F          +F +S+                               + +  R+I  Q+       P   +DVL+A        +F    L+ +I     ++  I     + +F+ +C D   C    C   I V+  +   +     ++F++      + CLC    +G +C    + C    C     C  D  K   F C CP        E+ + + G+S               + FTG  +I + L E  N   M++    R     A +M  +      + I     GK+    D  + P I   +S++ + DG+WH V L + G       +  +V+D +     +    +   + +  +  G   R   S    NL+    +     GC+  V+LN Q+LP   L +   ++     S +++ GCS S    +C+   C+NGG C        +   Y C+C   F G +C+I  + C  +PC++GG C+  K  F C C    TGPRCQ+G  C    NPC     CI+          VC+C     G  C  D+DEC   P  C P   +C N +  Y CNC+ GY G  C
Sbjct:   30 SSSMQFTQYSYNATVYENSAAKTYVGH-PTKMGIYLKDPSWDIKYKII-SGDNENIFKAEEHNLGDFCFLRIRTKGGNTAILNREVKDNYLLTVKAV-EKNSNAE----ARTRIRVQVLDTNDLRPLFSPTSYSVSLPENTAIRSSIAKVTATDADIGTNGEFYYSFKERTDM-------FAIHPTSGTIVLTGRL-DYTETKHYEMEILAVDRGLKLYGSSGISSMARLNIYVEQANEHAPVISAVRLTH---PELDKDLTYAIVTVDDNDQGPNGEIASLSI-IAGDPLQLFKTTRTSPGSKEYKIVAVKETEWEMQPFGYNLTLQAKDKGSPPQFSATKVIHLTSSRFKYGAVKFEK--DIYRTEISEFAPPNTPVVLVKAV----PSNSHIKYAFRNSAD-KNRFSINPNTGLISTL-------------SPVKAKILSHIELDIITSDKKAFTKVLIKVLGTNINTPEFTQTSYKAVVDENSPIGSSVFSVHAVDHDEGENGFITYSIANINPQPFAIDAFS-GVITTLEDLDYELMPRIYTLKIRASDWGLPYRRETEIPVTITLNNLNDNIPLFEKVNCEGTV----PKDLGVGEQITTVSAIDADELQLVKYRIESGD-ELDLFTLNPNSGVLSLKQPLSEGPANKVSFYSLRITATDGENLAQPIYINITVTS------SRKGVHLNCEETGVAKMLAERLLQANKLFNRGTQEEVYFDSHMTNTHAPHFKSILPSIIAIKENVPVGANI--IHMEANDLDAG-FSGKLLYAISGGNDDSCFAV---DMETGWLKILSPLDRELKDQYNLNITVYDLGIPQKSSWRLLDVNVLDVNDNPPEFLQESYSV--HLKENEEGHNAIIQVQAVDKDLGVNGEVKYSILTDTDIFTINSETGVIKAVAPLDREKQHTHLLKIEARDQAENEPQLFSHVLLKVTVEDVNDNPPVFIPSNYHVKVREDLPVGTVITWLDAYDPDVGLSGQVRFSLLENGDGKFEVDKVSGAVRIIQELDFEEKQVYNLTARAKDRGKPVSLSSACYINVELIDVNENLHTPLFSEFVSKGSIREDVPIGTPVMTVSAHDEDTGRDGEIRYSIRDGS-GVGVFTIHEEKGTIRTADNLDRETTSHYWLTVYATDRGVVPLSSFI-QIYIEIEDVNDNAPQTVEPVYYPEVMENSAKDVSVVQINAFDPDSISSDKLTYKISTGNPQGFFAINPKTGLITTTSRKLDREQQSE-------HILEVTITDNGHPAKSAVTRVIVKVLDENDNKPQFLQK----FYKIRLPEREKPERERNAKRDPIYRVVAVDKDDGANAEISYSIE-------EGDEHGKFFIEPKTGVVSSKKSSAA------GEYDI----LSIKAVDNGRPQKSS------TTRLHIEWIAKPAPSAEPITFEEPSFSFSVMESDPVAHMIGVITTEPLGSPLW-------FDITGGNYDSRFDVDKGTGTIIVARP--------------LDAEQKSNYNLTVEATDGTRSVSTQ--VSIKVIDTNDHRPEF---STSKYEVLIPEDVQPDTEILQVIA--------------------IDRDEKNKLIYTLQSSTDPVSLKK-FRMDPATGSLYTTEKLDHETMQQHILTVMVRDQDVPVLRNFARIVINVTDTNDHAPWFTSSFYEGRVYE---------------------------------------SAAVGSAVLQVSALDKDKGKNAEVGYSIESGNTA-NAFTIDPVLGIIKTAKELDRNNHGRYELVVKATDHGIPPL--SQITSIHIFVTISNNAAPKFTKKEYSSEISETAHVGSFVAMLSAYSQSS-------VVYEIRDGNTLNSFDINPNSGVVTTQKQLDFETLPSF-TLTVQATNMAGLST--NSTLTV--HVRDENDNFPVF-AQTNYRGLISESAPPNSVV--------LTDDNIPLVIRATDSDQESNALLVYQIVEPSVHKYFAIDSSTGALRTLLSLDYEQTNIF-HFTVQVHDMGYPRLFAENAANVTIYVVDINDCAPVFSKDVYETSLLLPTYKGVRVITVNATDDDSGAYSQLIYSIIEGNIGDKFLIDPLKGTITVQN-----TTNLRSRYELTIRASDGRFSSLTSVKIN-VKESKESSLKFTQRSYSATVLENATKVKTLTIISP--LGSRINEPLFFHILNPDPRFKISPTSGVLSTTGIPFDREEEDLFELVVEVSDEQKPPTVAHVLVQVTVEDVNDNNPVFVNLPYYAMVQID-APEGHLIRHVTAVDRDIGKNGEITY---YLKEHSQQFQIG---PSGEIKLKKQFDPDSSNKEYFITVVAKDSGNPSYSSEVVVPITVMNKAMPVFENPFYSAEIAENANLHSPVVHVQANSPEGYRIIYSITDGDPFNQFNINFNTG-------VINVFAPLDFESHPAYKLRVRATDSLTGAHAEVFVDIILEDVNDNPPVFREKTYAATLSEASVIGTSVVQINAKDPDSGQNNAISFHLV---ETSGNISQYFHIDASSGLIETAKPLDYE--YFQECTLVVRATDNGIPPLSNDISVHIGLTDLNDNPPAFIQQVYEVKISELSKPGHFVTCVKATDADSSDTEKLEYSILSGNDDMNFIINSKTGVI---TVSYLRKMILNP-FYSINVSVSDGVFRSSAQVHVTVKSANLHSPKFGQNEYEVELSENSPVQTLVTELKAVDEDKGLYGQLTYHIINDFAKDNFNINE-RGQLFTAERFDREIPTNKVIPVSVMAKDTGGKVGFCIVNVILTDSNDNVPQFRATEYKVS-IASDVPRGT---PIVKVIASDSDEGANADIFYSIEA----QS-ASVEENFGISQSSGTIITKESLIGL-----------------EDEVYSFFVKATDGGTPQKESLVPVFIRILPPEVVLPKFSEPFYT---LSISEDTAVGTELDVVKAESNEPIIYSLMKG------NTLESNLDDVFVIDKQNGRLKLEKQLDHESTKWYQFYVLAHNLHGEHEIISSVDVSILVKDVNDNAPVFDSNPYKAFIVENLPEGTKVVQVRAFDLDVGSNGQVSYMLGHSQDLEEIKELFSVDRETGWVTTLGELDHEKTNKYHIVVVAYDHGDKVLSSSSTIEVTVMDVNDNPPRFTAEIYKGTVSEDDPPDG-------VIAILSTTDNDTEEINKEVTFHITGGDPLGQFAIENMQHEWKVYVRKPLDRE-VKDNYLLNITATDGTFATKA--VVEVKVLDANDNTPVCEKTSYAETISEDALAGRVILQVAASDADIRSNAEII-YTLHGVGAEKFHL-NPFTGELKTSLPLDREILEVYHLMVKATDGGGRFCQAAVELTLEDVNDNAPEF---SADPYTVTVYENTEPQTPLLRVQAIDADLGLNHKVQYSLVSSAEGQFSIDELSGIISLEKPLDRELQAVYTLTVKATDQGLPRKLSSVASVVVSVLDINDNPPVFEHREYGSSLTEDAPVGTEVLQVYATSRDIEVNAEITYKIISGNEHGKFTINPVTGMIFIIASLDYETSPEYYLTVEATDGGTPPLSDVASVNINVTDVNDNSPVFSQNTYTTVVGEDS-VSGQSVLMVVADDADGPLNNHIRYSITEGNPGNT-------------FIIDPVRGEVKVNKLLDRELISGYTLTIQAEDNGQPPRRNTTTVNIDVSDVNDNPPMFSKGNYSIVIQ----------ENKPVG--FSILHLAVTDKDSSHNGPPFTFVFLSGNEDNTF-----QMDEQGLITTAGTLSRKIKDLFVLHIQVSDNGKPQLSSFTNIEVRVIEESIHPPAILPLEIYITTFGEEYSGGV---IGKVHATDQD-VYDTLTY------SLDPKMEN-LFSVSKTGGKLIARKQLDVGQYLLNVSVSDGKFTTAADITVHIRQITQELLNHSITFRFANLSPEEFIGDYWR----NFQRSLR------------------------------NHLGGRKIDIQIISLQPSEPPRNLDVLLAAEKVGN-TYFAPKVLIQKINASIAEIEDISGVKILDVFHKLCLDVE-CPLRFCDEKISVDESVMSTHSTAR-LSFVTPRHHRRAICLC----KGGKCPTLDSLCDGNTCPEGTECVVD-VKEGKFNCVCP------MWEQKAELFGSS---------------VTFTGNSYIKYRLMENENKEEMKLSLKLRTYSAHAVVMYARGTDYSILEI---QGGKLQYKFDCGSGPGIVSVQSIH-VNDGQWHTVSLEVDG------NYARLVLDRVHTASGTAPGTLRTLNLDNHVFFGGHMRQQGSKHGRNLQ----VTNGFRGCMDAVLLNGQELP---LNSKSKNNVHIEESVDISSGCSLSAA-DVCSGSPCQNGGTCSPL-----SNGGYYCKCSSLFMGTHCDISINPCASNPCLYGGTCIVVKEDFMCHCRGDYTGPRCQFGPYCKD--NPCKNSGKCIDS-----LDGPVCECESGFHGDKCLNDIDECLENP--C-PTGAMCENTYGSYSCNCSNGYGGKLC 4163          
BLAST of Ft-2 vs. Ensembl Xenopus
Match: hras (Harvey rat sarcoma viral oncogene homolog [Source:Xenbase;Acc:XB-GENE-479381])

HSP 1 Score: 1116.29 bits (2886), Expect = 0.000e+0
Identity = 1210/4568 (26.49%), Postives = 2001/4568 (43.80%), Query Frame = 3
Query:  222 SLSISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTK--YTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVKYLSKYFDPDFN-DYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNVFLTPTGELNRYVLKLRAIFSPISTPAISVTIEAKDLSLNPKTSST---HLTIPLGNLRNINLLSVPEFVSVSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLEGTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIA-VAMNDSLETKKTFT-LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDI---YVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKL--SPLTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDL---------KVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNI-LIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSEN----DKSKLYLAYLPSDS----INIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNKRA----TYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIK-PSTGKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILS-RFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNP--TILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKS-ALDREERPFVQLLVLAKGWDG--SYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIR-VKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHI--VDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVLNEYYNI-FKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRE--RKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSIN---VTVKINILYDK----KKVNPIITCSIMTIQENNPLNHIVAMCRISSTE------MKGKWSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINV--EYRVDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSL-YQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHV--TNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPF----LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPK-SNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRTLWV---QVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKPNIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQL------APDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGA--RNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHC 13634
            S S+ FT+  YN  +Y++   + YV H   +MGI   +    I YKI  S +  N F+AE   +GDF +LRIRTK   TA LNRE    Y LT++ + E  S  +     +T++ ++VLD ND  P+F   ++     EN +I + I  VTATDAD G N E +Y   +           F+I+P SG I    +L D+        +I A+ RG        + S + L+I V   N HAP IS   L+    P+ + D  +A +TV D D+  N       I I   P        T  G     ++ ++     +     ++T++AKD    P+ S+T   HLT        +      +     I E A  N+ V L+K        N+ +K  FR   D +  +S+N  +   S +             SP +   ++ + ++     KK FT + I V   N   P          V EN+ IG +V  + A D D      I+Y + + N  PF +  F   V+   E+LD E M R + +++  +D G P  R       I + ++N+  P F    C+ T+    P DL +G  I     +D D    ++  I S   +   F+++P SG LSL      G  +K++ +++ + A D   ++  + +N +V        S + + L+C +  +           +   N     E          + P F + +PS+I I+E    G  +  I M+  D D   +  + ++ +    +   F++   D  +  + +   LDRE  D+Y++ I V D G P+   ++  ++ V D+NDNPP FL +S+ +   L EN +    I+Q++A D D   + +++Y ++    +F I+S TG ++    LDREK+  + + I A D       L +   L + V D+NDN P+F  ++Y + + EDLP+G+ +  L A D D+  + Q+R+++       F  D  +GAV ++ +L       Y L A  KD GKP +LSS     +    V+ N + P   E +   +IRE+   GT V ++     D      + Y+I   S G+ +F I+ E G IRT  ++DRE    YWL +Y  DR    ++  + ++YI++ D NDN P      Y   V EN      ++ + A D D     +L YKI +G+  G+F+I+                  + C  T   DL         +V I+D+G P +     + V ++D NDN P F+      F +    E     R +N     I RV AVD D   NA + Y+++              F ++ K+G + +  SS+       G   I    +++ A D G P   +      T RL++   A    S      ++     + + SD     I ++  E +GS L         D  G + + + D   G  ++I A+                D+       +T+E T        Q  V+I +   N + P F   S+   ++ I +  +P   I  V A                     + D    +IY++ +S DP++++K F ++   G L      +  + Q   + V  R++       + ++ I++ DTN+  P F  S  +  +Y                                         +++G+ +  +SA D+D G+N ++ ++I++ + A N F +D   G I+  + L    +    L +  +D G PP     + ++ I     +++ P+  + +    + E   V S +       +     +   VV  I+  +T   F +  ++G + T   LD E +    ++ +Q  +  GL +  NS ++V  H+ D NDN P F       G+ISESA P S+V        L+     LVI A D D+  N  + Y I+      YF ID  TG L   L +D E    F   ++++ D G P+L ++    + I + D NDC P F KD Y   L+LPT+    ++ +   D D      +++SI+ G     F IDP  G + +       +    S   + IRA DG+F +  ++ IN    ++   L   +      + EN   V  L +       S  +  + + +L+  P+ +I+  +G L       DREE    +L+V         +  ++ V V+V D ND  P+F++  Y  +V  + + E   IR V A+D D G+NG + Y   Y+K  +   +      SG I ++     +   K++ I + A D G P+ SS   V + +++   P+F+   YS  + E+A     V  V+A S  G+ I+Y+IT+G+    F+++F          VI +   LD+E+ P + L + ATD  +       V I + D+ND  P+F + +Y+A++SE   I   ++ I+        +  + F L    ++S   SQ+F I+ ++G I   + LD+E     E  ++V+      P     + VHI   D NDNPP FIQ  +   IS  S  G  V    ATD D++   KL Y +L+   ++ F I+  +G I    V  + K++ +       V V D      A V V   S   H P F  NE+ + +SEN  V + +  + A D DK  +G+L YH+I  F  + F ++   G L   +  DRE     +  + V+  D G K  F  V + +TD NDN+P      Y+V+ I S    GT    I+++ A D D      + Y + +    QS A V+   G      + I + S +GL                 E+ +YS+ +  T          V V I IL  +    K   P  T   ++I E+  +   + + +  S E      MKG      ++   ++ + F ID   G ++ +K +D E+   Y+  V          ++++  + I + D ND  P+FD++ Y  FI E++P G+KV+Q +A+D D      + Y L +  D  E    F +D + GWV ++  +D+E+T   ++VV A D    V  +++T+ ++V DVND  P +T       +   +  DG       V+  LS  DND+E   + + F IT  +    +A   +    +V +  PLD E +     L   A+D    +K   ++ ++V+D ND+ PVC +      I E    G VI  + A D D  +    + YTL         +  P TG +  + PLDRE     + +V A D   + C   + + + D+NDNAP F   S  P+     EN    + + ++ A+DAD G+N K+ Y ++  ++  FSID  +GI+ +   LDRE Q  + L ++A+D G P K S++ +V + +LD+ND+PP F +      + ED  +G  ++ + A S DI VNAE++Y++I+  E   F +  ++G + +I  LD+E S EY+LTV A+D G P LS    V I V DVNDN P F    Y   + E+++  +     V A D+D  LN+ + YS     P                F I+P  GE+ +N + DRE    Y   +   D+G P   + T V I++ D NDNPP F++ ++  +IQ          E K  G  F +  L + DKD   N  PF    L+    + F     ++ ++ ++  AG+L   ++ L+V   QV+DNG+P L     + V VI  S  PP I PL +    F  E   G    I +V   D+   +D LT+      +L  ++ N  F +    G +   + LD G Y LNV V++   +T   I + I  +T++++  +   + +++ P  F          +F +S+                               + +  R+I  Q+       P   +DVL+A        +F    L+ +I     ++  I     + +F+ +C D   C    C   I V+  +   +     ++F++      + CLC    +G +C    + C    C     C  D  K   F C CP        +RP            QC    V   + FTG  +I + L E  N   M++    R     A +M  +      + I     GK+    D  + P I   +S++ + DG+WH V L + G       +  +V+D +     +    +   + +  +  G   R   S    NL+    +     GC+  V+LN Q+LP   L +   ++     S +++ GCS S    +C+   C+NGG C        +   Y C+C   F G +C+I  + C  +PC++GG C+  K  F C C    TGPRCQ+G  C    NPC     CI+          VC+C     G  C  D+DEC   P  C P   +C N +  Y CNC+ GY G  C
Sbjct:   30 SSSMQFTQYSYNATVYENSAAKTYVGH-PTKMGIYLKDPSWDIKYKII-SGDNENIFKAEEHNLGDFCFLRIRTKGGNTAILNREVKDNYLLTVKAV-EKNSNAE----ARTRIRVQVLDTNDLRPLFSPTSYSVSLPENTAIRSSIAKVTATDADIGTNGEFYYSFKERTDM-------FAIHPTSGTIVLTGRL-DYTETKHYEMEILAVDRGLKLYGSSGISSMARLNIYVEQANEHAPVISAVRLTH---PELDKDLTYAIVTVDDNDQGPNGEIASLSI-IAGDPLQLFKTTRTSPGSKEYKIVAVKETEWEMQPFGYNLTLQAKDKGSPPQFSATKVIHLTSSRFKYGAVKFEK--DIYRTEISEFAPPNTPVVLVKAV----PSNSHIKYAFRNSAD-KNRFSINPNTGLISTL-------------SPVKAKILSHIELDIITSDKKAFTKVLIKVLGTNINTPEFTQTSYKAVVDENSPIGSSVFSVHAVDHDEGENGFITYSIANINPQPFAIDAFS-GVITTLEDLDYELMPRIYTLKIRASDWGLPYRRETEIPVTITLNNLNDNIPLFEKVNCEGTV----PKDLGVGEQITTVSAIDADELQLVKYRIESGD-ELDLFTLNPNSGVLSLKQPLSEGPANKVSFYSLRITATDGENLAQPIYINITVTS------SRKGVHLNCEETGVAKMLAERLLQANKLFNRGTQEEVYFDSHMTNTHAPHFKSILPSIIAIKENVPVGANI--IHMEANDLDAG-FSGKLLYAISGGNDDSCFAV---DMETGWLKILSPLDRELKDQYNLNITVYDLGIPQKSSWRLLDVNVLDVNDNPPEFLQESYSV--HLKENEEGHNAIIQVQAVDKDLGVNGEVKYSILTDTDIFTINSETGVIKAVAPLDREKQHTHLLKIEARDQAENEPQLFSHVLLKVTVEDVNDNPPVFIPSNYHVKVREDLPVGTVITWLDAYDPDVGLSGQVRFSLLENGDGKFEVDKVSGAVRIIQELDFEEKQVYNLTARAKDRGKPVSLSSACYINVELIDVNENLHTPLFSEFVSKGSIREDVPIGTPVMTVSAHDEDTGRDGEIRYSIRDGS-GVGVFTIHEEKGTIRTADNLDRETTSHYWLTVYATDRGVVPLSSFI-QIYIEIEDVNDNAPQTVEPVYYPEVMENSAKDVSVVQINAFDPDSISSDKLTYKISTGNPQGFFAINPKT--------------GNLCLCTFGLDLVSTNHFCFGQVTITDNGHPAKSAVTRVIVKVLDENDNKPQFLQK----FYKIRLPEREKPERERNAKRDPIYRVVAVDKDDGANAEISYSIE-------EGDEHGKFFIEPKTGVVSSKKSSAA------GEYDI----LSIKAVDNGRPQKSS------TTRLHIEWIAKPAPSAEPITFEEPSFSFSVMESDPVAHMIGVITTEPLGSPLW-------FDITGGNYDSRFDVDKGTGTIIVARP--------------LDAEQKSNYNLTVEATDGTRSVSTQ--VSIKVIDTNDHRPEF---STSKYEVLIPEDVQPDTEILQVIA--------------------IDRDEKNKLIYTLQSSTDPVSLKK-FRMDPATGSLYTTEKLDHETMQQHILTVMVRDQDVPVLRNFARIVINVTDTNDHAPWFTSSFYEGRVYE---------------------------------------SAAVGSAVLQVSALDKDKGKNAEVGYSIESGNTA-NAFTIDPVLGIIKTAKELDRNNHGRYELVVKATDHGIPPL--SQITSIHIFVTISNNAAPKFTKKEYSSEISETAHVGSFV-------AMLSAYSQSSVVYEIRDGNTLNSFDINPNSGVVTTQKQLDFETLPSF-TLTVQATNMAGLST--NSTLTV--HVRDENDNFPVF-AQTNYRGLISESAPPNSVV--------LTDDNIPLVIRATDSDQESNALLVYQIVEPSVHKYFAIDSSTGALRTLLSLDYEQTNIF-HFTVQVHDMGYPRLFAENAANVTIYVVDINDCAPVFSKDVYETSLLLPTYKGVRVITVNATDDDSGAYSQLIYSIIEGNIGDKFLIDPLKGTITVQN-----TTNLRSRYELTIRASDGRFSSLTSVKIN-VKESKESSLKFTQRSYSATVLENATKVKTLTIISP--LGSRINEPLFFHILNPDPRFKISPTSGVLSTTGIPFDREEEDLFELVVEVSDEQKPPTVAHVLVQVTVEDVNDNNPVFVNLPYYAMVQID-APEGHLIRHVTAVDRDIGKNGEITY---YLKEHSQQFQIG---PSGEIKLKKQFDPDSSNKEYFITVVAKDSGNPSYSSEVVVPITVMNKAMPVFENPFYSAEIAENANLHSPVVHVQANSPEGYRIIYSITDGDPFNQFNINFNTG-------VINVFAPLDFESHPAYKLRVRATDSLTGAHAEVFVDIILEDVNDNPPVFREKTYAATLSEASVIGTSVVQINAKDPDSGQNNAISFHLV---ETSGNISQYFHIDASSGLIETAKPLDYE--YFQECTLVVRATDNGIPPLSNDISVHIGLTDLNDNPPAFIQQVYEVKISELSKPGHFVTCVKATDADSSDTEKLEYSILSGNDDMNFIINSKTGVI---TVSYLRKMILNP-FYSINVSVSDGVFRSSAQVHVTVKSANLHSPKFGQNEYEVELSENSPVQTLVTELKAVDEDKGLYGQLTYHIINDFAKDNFNINE-RGQLFTAERFDREIPTNKVIPVSVMAKDTGGKVGFCIVNVILTDSNDNVPQFRATEYKVS-IASDVPRGT---PIVKVIASDSDEGANADIFYSIEA----QS-ASVEENFGISQSSGTIITKESLIGL-----------------EDEVYSFFVKATDGGTPQKESLVPVFIRILPPEVVLPKFSEPFYT---LSISEDTAVGTELDVVKAESNEPIIYSLMKG------NTLESNLDDVFVIDKQNGRLKLEKQLDHESTKWYQFYVLAHNLHGEHEIISSVDVSILVKDVNDNAPVFDSNPYKAFIVENLPEGTKVVQVRAFDLDVGSNGQVSYMLGHSQDLEEIKELFSVDRETGWVTTLGELDHEKTNKYHIVVVAYDHGDKVLSSSSTIEVTVMDVNDNPPRFTAEIYKGTVSEDDPPDG-------VIAILSTTDNDTEEINKEVTFHITGGDPLGQFAIENMQHEWKVYVRKPLDRE-VKDNYLLNITATDGTFATKA--VVEVKVLDANDNTPVCEKTSYAETISEDALAGRVILQVAASDADIRSNAEII-YTLHGVGAEKFHL-NPFTGELKTSLPLDREILEVYHLMVKATDGGGRFCQAAVELTLEDVNDNAPEF---SADPYTVTVYENTEPQTPLLRVQAIDADLGLNHKVQYSLVSSAEGQFSIDELSGIISLEKPLDRELQAVYTLTVKATDQGLPRKLSSVASVVVSVLDINDNPPVFEHREYGSSLTEDAPVGTEVLQVYATSRDIEVNAEITYKIISGNEHGKFTINPVTGMIFIIASLDYETSPEYYLTVEATDGGTPPLSDVASVNINVTDVNDNSPVFSQNTYTTVVGEDSVSGQ----SVVADDADGPLNNHIRYSITEGNPGNT-------------FIIDPVRGEVKVNKLLDRELISGYTLTIQAEDNGQPPRRNTTTVNIDVSDVNDNPPMFSKGNYSIVIQ----------ENKPVG--FSILHLAVTDKDSSHNGPPFTFVFLSGNEDNTF-----QMDEQGLITTAGTLSRKIKDLFVLHIQVSDNGKPQLSSFTNIEVRVIEESIHPPAILPLEIYITTFGEEYSGGV---IGKVHATDQD-VYDTLTY------SLDPKMEN-LFSVSKTGGKLIARKQLDVGQYLLNVSVSDGKFTTAADITVHIRQITQELLNHSITFRFANLSPEEFIGDYWR----NFQRSLR------------------------------NHLGGRKIDIQIISLQPSEPPRNLDVLLAAEKVGN-TYFAPKVLIQKINASIAEIEDISGVKILDVFHKLCLDVE-CPLRFCDEKISVDESVMSTHSTAR-LSFVTPRHHRRAICLC----KGGKCPTLDSLCDGNTCPEGTECVVD-VKEGKFNCVCP-------SDRPG-----------QC---NVGSSVTFTGNSYIKYRLMENENKEEMKLSLKLRTYSAHAVVMYARGTDYSILEI---QGGKLQYKFDCGSGPGIVSVQSIH-VNDGQWHTVSLEVDG------NYARLVLDRVHTASGTAPGTLRTLNLDNHVFFGGHMRQQGSKHGRNLQ----VTNGFRGCMDAVLLNGQELP---LNSKSKNNVHIEESVDISSGCSLSAA-DVCSGSPCQNGGTCSPL-----SNGGYYCKCSSLFMGTHCDISINPCASNPCLYGGTCIVVKEDFMCHCRGDYTGPRCQFGPYCKD--NPCKNSGKCIDS-----LDGPVCECESGFHGDKCLNDIDECLENP--C-PTGAMCENTYGSYSCNCSNGYGGKLC 4161          
BLAST of Ft-2 vs. Ensembl Mouse
Match: Fat1 (FAT atypical cadherin 1 [Source:MGI Symbol;Acc:MGI:109168])

HSP 1 Score: 1053.89 bits (2724), Expect = 0.000e+0
Identity = 1085/4101 (26.46%), Postives = 1827/4101 (44.55%), Query Frame = 3
Query: 1581 ISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDI--YVPHQTTRDSTINHPNNYEESNKPIFGMR-NIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXX-XXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSEND-----KSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNK----RATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPP--RINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPST-GKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILS-RFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNP--TILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKS-ALDREERPFVQLLV-LAKGWDGSYDYINVTVSVT-DENDYKPMFLSEKYEFLVHTNLSKEAQSIR-VKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVLN-EYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRE--RKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIA---FVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKV----NPIITCSIMTIQENNPLNHIVAMCRISSTEMKGK--WSLVPSSSPFDVQND-FEIDSNYGYIRAKKIMDFETQSQYRINVEYR--VDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHV---TNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPF----LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIV-LLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRT---LWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKP----------------NIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGARNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHCE 13637
            + V   N  PP         ++ EN  IG  V  + A DPD      ++Y + + N +PF +  F    V   ENLD E M R + +R+  +D G P  R V     I + ++N+  P F    C+ TI    P DL +G  I     +D D    ++  I + + +   F ++P SG LSL  +   G+ +K++  ++ + A D    ++ + +N +V  A SR    +P+ L C +  +   +  +  + + ++   + E+     + +  + P F   +P+ I ++E    G  +  + M   D D   +  + V+ +    +   F+I   D  +  + V   LDRE +DKY + I V D G P+   ++  ++ V D NDN P FL +S+ + ++  E+ ++   I+Q++ATD D   S  + Y ++     F I S TG +++   LDRE +  + + I A D       L +T  L + + D+NDN P F   +YS+ + EDLP G+ ++ L A D D+  +SQ+RY++       F  D  +GAV ++ +L    +  Y L    KD GKP +LSS    ++    V+ N + P     +    ++E+   G+ V ++     D      + Y+I   S GI +FRI+ E G I T   +DRE    YWL +Y  D+    ++  + EVYI+V D NDN P      Y   + EN      ++ ++A D D +   +L Y+I SG+  G+FSI   TG I+T+ R +DRE         D + L+V ++D+GVP +     + V I+D NDN P F+    F   R    E  +  R  +    + RV A D D   NA + Y+++         +    FS++ K+G     +SS  F  S  G   I    +++ A D G P   +      T RL++ E  + PK  ++     +S      + SD +  +    I  E   +P+    D  G + +   D   G  ++I AK                D+       +T+E T   T    Q  V I +   N + P F   S+   ++ + + T+P   I  + A                     + D    +IY++ +S DP +++K F ++   G L      +  +     + V  R++    +  + ++ +++ D N+  P F        +Y                                         +++G+++  ++A D+D GRN +++++I++ ++  N F +D   G I+  R L         L +  +D G PP   +    +AV + D    ++ P+    +    + E   + S +  +   S +        V+  I+    G  F +   +G IIT  +LD E +  + S+ +Q  +  GL +      +V +H+ D NDN P F    + +G ISESA+  S+V        L+     LVI A D D   N  + Y I+     +YF ID  TG +   L +D E   +F   ++++ D G+P+L ++    + + + D NDCPP F K  Y   L+LPT+    ++ +   D D      +++SI  G     FS+D  TG + I       + +  S   + +RA DG+F +  ++ IN  ++  +   PL+ +Q  +      N      L       +  +  + Y +L+   + +I+  +G L       DRE++    ++V + K  + S     V      D+ND  P+F++  Y  +V  + ++    IR V AID D+G NG +    YY+K   +   F I   SG I+++     + L K++ + + A D G PA S+   V + +++   P+F+K+ YS  +PE+      V  ++A S  G  + Y+IT+G+    F ++F          V+ ++  LD+E+ P + L + ATD  +       V I V DIND  P+F++ SYS ++SE   I   ++ +         ++ +  S +LI + S  S  HF I+  TG IS+   LD+E    H  ++     G  + ++   + V + D NDNPP F Q  + A IS  ++ G  V+   A D D++   KL Y +L+   +  F ID+ +G I  + +     L P        V V D      A V+V  +    H P F  NE+ + ++EN  +++ + ++ ASD D   +  + YH++  F  + F ++       L+K LDRE   + +  +R++  D G K  F TV + +TD NDN P      YEV  I S+ + GT   S++++ A D D      + Y + +   S+S+     ++ +TG ++ K S I      GL N       +  A      P  S             V V I IL  + ++     P  T    TI E+ P+   + + R+   E  G   + LV  ++P   +++ F ID   G ++ +K +D ET   Y+ ++  R  +D+  ++A+  + I + D ND  P+ ++S Y  FI E++P GS+VIQ +A D D      + YSL Q    +   SF I+ + GW+ ++  +D+EE     + V ASD    V   +   + ++V DVND  P +T        EI +      +    V+  LS  D D+E     + + IT  +    +A   V     V +  PLD E+    L L   A+D    SK    + ++V+D ND++PVC +      I E   PG ++  + A D D  +    +TYTL   S      + P TG +   A LDRE  +  N +V A D   + C   I++ + D+NDNAP F   +  P+     EN   G+ + ++ A DAD+G+NRKI Y +++ +   FSI+  +GI+++   LDRE Q  + L ++A D G P +   T   +V +LD+ND+PP F        V+ED  IG  ++ + A S DI  NAE++Y +I+  E   F ++S +G + +I+ LD+E S EY+LTV A+D G PSLS    V I V D+NDN P F    Y   + E+  + +  I  + A D+D   NS + YS +      + N  S        F I+P  GE+ +    DRE    Y   V   D+G P   + T V I++ D NDN P F++ ++  +I          QE K  G  F V +L + DKD   N  PF   +++    + F     E+    +LL A ++   V+    L V+V D+G+P L     + + VI  S  PP I PL +    F  E   G    I ++   D+   +D L +      +L   + +  F + S  G +     LD G Y LNV VT+   +T   I + I  +T++M+     I+ +++ P                NI   R+ D++++    S                                             P   +DVL+ V   +      +  L+ +I +   D+ +I     +++F  +C     C    C   + V+  +   +     ++F++      + CLC    +G  C    + C   PC +   C  DP +   + C CP    G + + P    G+SS              I FTG  F+ + L E  N L M++    R     A +M  +       +++I++ G++    D  + P I   +S+  + DG+WH V L + G       +  +V+D +     +    ++  + +  +  G   ++  +     +   +     GC+  + LN Q+LP    P         V   +L++GC  +     C++  C+NGG+C            Y C+C   + G  CE+  + C  +PC++GG C+    GF C C    TG RCQ    C    +PC    TC +         AVC C    RG  CQ D+DEC   P  C+ G  +C N H  Y CNC+  YRG HCE
Sbjct:  452 VKVLGTNSNPPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVTYSIANLNHVPFVIDHFT-GTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCEGTI----PRDLGVGEQITTVSAIDADELQLVRYQIEAGN-ELDLFGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGENFATPLYINLTV--AASR----KPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFFDSYSVNTHTPQFGVTLPTGIEVKENLPVGANI--LFMNATDLDSG-FNGKLVYAISGGNDDSCFTI---DMETGVLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYFVEVS--EDKEVNSEIIQVEATDKDLGPSGHVTYAILTDTEKFSIDSMTGVVKIIQPLDREVQPVHYLKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGHFDVDKLSGAVRIVQQLDFEKKQLYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDTGRDGEIRYSIRDGS-GIGVFRIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFI-EVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLTYRITSGNPQGFFSIHPKTGLITTTSRKLDREQ-------QDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQK--FYKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYSIE-------EGNEHGRFSIEPKTG----VVSSKKF--SAAGEYDI----LSIKAVDNGRPQKSS------TTRLHI-EWISKPKPSSEPISFEESVFSFTVMESDPVAHMIG-VISVEPPGMPL--WFDIIGGNYDSHFDVDKGTGTIIVAKP--------------LDAEQKSSYNLTVEATDGTTTILTQ--VLIKVIDTNDHRPQF---STSKYEVAVPEDTEPEVEILQISA--------------------VDRDEKNKLIYTLQSSIDPASLKK-FRLDPATGALYTAEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYE---------------------------------------SAAVGSVVLQVTALDKDKGRNAEVLYSIESGNIG-NSFTIDPILGSIKTARELDRSHQVDYDLMVKATDKGDPPMSEMTSVRIAVTVAD----NASPKFTSKEYSAEISEAIRIGSFVGMVSAHSQSS-------VMYEIRDGNMGDAFNINPHSGSIITQRALDFETLP-MYSLTVQGTNMAGLSTN----TTVVVHVRDENDNPPVFT-QAEYSGFISESASVNSVV--------LTDRNVPLVIRATDADRESNALLVYQIVEPSVHNYFAIDPTTGAIRTVLSLDYEETHAF-HFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFSKSLYEVSLLLPTYRGVNVITVNATDADSKAFSQVMYSITEGNIGEKFSMDHKTGTIAIQN-----TTQLRSRYELTVRASDGRFTSMASVKINVKESRES---PLKFTQDAYSAVVKENSTEARTLAVITAIGNPLNEPLFYRILNPDRRFKISHTSGVLSTTGIPFDREQQETFDVVVEVTKEHEPSAVAHVVVKVTVEDQNDNAPVFVNLPYYAVVKVD-AEVGHVIRYVTAIDRDSGRNGDI---HYYLK--EHHDHFQI-GPSGDISLKKQFEHDTLNKEYLVTVVAKDGGSPAFSAEVLVPITVMNKAMPVFEKAFYSAEIPENIQMHSPVVHIQANSPEGLKVFYSITDGDPFSQFTINFNTG-------VVNVIAPLDFESHPAYKLSVRATDSLTGAHAEVFVDIIVEDINDNPPVFVQPSYSTTLSEASVIGTPVLQVRATDSDSEPNRGI--SYQLIGNHSK-SHDHFHIDSNTGLISLVRALDYEQSQQHRIFVRAVDGGMPALSSDVVVTVAVTDLNDNPPLFEQQVYEARISEHAAHGHFVMCVRACDADSSDLDKLEYSILSGNDHKSFIIDRETGIITLSNLRR-HTLKP---FYSLNVSVSDGVFRSSARVNVTVMGGNLHSPVFHQNEYEVELAENAPLHTLVVQVKASDRDSGIYSHVTYHIVNDFAKDRFYVNDRGQIFTLEK-LDRETPAEKVISIRLMAKDAGGKVAFCTVNVILTDDNDNAPQFRSTKYEVN-IGSSAAKGT---SVVKVFASDADEGSNADVTYAIEAD--SESVKENLEINKLTGLITTKESLI------GLEN--EFFTFFVRAVDSGSPPRESV------------VPVYIKILPPEVQLPRFSEPFYT---YTISEDTPIGTEIDLIRV---EHGGAVLYILVKGNTPESNRDEFFVIDRQNGRLKLEKSLDHETTKWYQFSILARCTLDDYEVVASIDVSIQVKDANDNSPVLESSPYEAFIVENLPGGSRVIQIRASDLDSGANGQVMYSLDQSQDADIIESFAINMETGWITTLKELDHEERASYQIKVVASDHGEKVQLSSTAIVGVTVTDVNDSPPRFTA-------EIYKGTVSEDDPPGGVIAILSTTDADTEEINRQVSYFITGGDALGQFAVENVQSDWRVYVKKPLDREQKDSYL-LTVTATDGTFSSKAR--VEVKVLDANDNSPVCEKTSYSDTIPEDALPGKLVMQVSATDADIRSNAE-ITYTLF-GSGAEKFKLNPDTGELRTLALLDREEQAVYNLLVKATDGGGRSCQAAIVLTLEDVNDNAPEF---TAEPYTITVFENTEPGTPLTRVQATDADTGLNRKISYSLVESADGQFSINERSGIIQLEKHLDRELQAVYTLTLKAVDQGLPRRLTATGTVVVSVLDINDNPPVFEYREYGASVSEDIVIGTEVLQVYAASRDIEANAEITYAIISGNEHGKFSIDSKTGAIFIIESLDYESSHEYYLTVEATDGGTPSLSDVATVNINVTDINDNSPVFSQDTYTTVVSEDAALEQPVI-TIMADDADGPSNSHIHYSII------EGNQGSP-------FTIDPVRGEVKVTKPLDRETISGYTLTVQAADNGNPPRVNTTTVNIDVSDVNDNAPLFSRDNYSVII----------QENKPVG--FSVLKLVVTDKDSSHNGPPFFFTIVSGNDENAF-----EVNQHGVLLTAATIKRKVKDHYLLHVKVADSGKPQLSSMTHIDIRVIEESIHPPAILPLEIFITAFGEEYSGGV---IGKIHATDQD-VYDTLMY------SLDPHM-DGLFSVSSTGGKLIAHRKLDIGQYLLNVSVTDGKFTTVADITVHIQQVTQEMLNHTVAIRFANLTPEEFVGDYWRNFQRALRNILGVRKNDIQIVSLQPS--------------------------------------------EPHSHLDVLLFV-ERSGGTHVSTKQLLHKINSSVTDVEEIIGVRILEVFQKLCAGLD-CPWKFCDEKVSVDENVMSTHSTAR-LSFVTPRHHRTAVCLCK---DGT-CPPVHHGCEDNPCPAGSECVADP-REEKYSCVCP---GGGFGKCP----GSSS--------------ITFTGNSFVKYRLLENENRLEMKLSMRLRTYSSHAVVMYARGTDYS--ILEIHT-GRLQYKFDCGSGPGIVSVQSIQ-VNDGQWHAVSLEVEG------NYAKLVLDEVHTASGTAPGALKTLNLDNYVFFGG--HLRQQGTKHGRGAQVASGFRGCMDSIYLNGQELPLNNKPRAYAHIEEWV---DLSHGCLLTATED-CSSSPCQNGGVC-----NPSPTGGYYCKCSALYVGTFCEVSVNPCSSNPCLYGGTCMVDNGGFVCQCRGLYTGQRCQLSPYCKD--DPCKNGGTCFDS-----LDGAVCQCDSGFRGERCQSDIDECAGNP--CRNG-ALCENTHGSYHCNCSQEYRGKHCE 4165          

HSP 2 Score: 247.669 bits (631), Expect = 2.503e-64
Identity = 441/1825 (24.16%), Postives = 747/1825 (40.93%), Query Frame = 3
Query: 6021 INAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERL----EIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTIL-FSILNG------KESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFD-GKFETSCNITINSFDNTRNKVLPLEKSQVVW--EIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSE--QPKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQP---ALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTG-HTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDP---SSSLSHSTTVLITVLDIN--------------------------DELPIFLKSSYSAS---------------VSENMPINHEIISISVL-LQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLD--TNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHX-----XXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDIND-----NIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDK--KKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYI-RAKKIMDFETQSQYRINVEYRVDNSPLMAT-RTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCK--------AYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDS----------ESQKESLHFLITNQNLNPFYAYFRVSE-SGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAP-VCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLV---VEPLTGRVIVNAPLDRE--FSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSI-APFLENAPHGSVIGKIHAVDADSGINRKIVYRILDES-KSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNF---FRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGK------VTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSK--TNVTIEIEDKNDNPPEFAQ 11135
            ++A D D G NG+  Y    R    F I   +GV+ L  ++D  +     +L I   D+G  KL     +    ++ + +E  N+C P       L    L   P+  ++ +   D   N  I   SI+ G      K  R F   P +   K+           P    + ++A D G       + +    + + +  P++    V+  EI E       +VL +A   +SH    ++Y+  S   +PK  +N  TG + +   + R+     +L V       S     V V V   N   P F    Y+  +  N    A   RV A+D D GENG V YSI  +      + F ID  +G ++       EL+ + +T+ I+A+D G P    +     + ++ ++D +PLF++      +P D      +TTV AI +     + Y I  GN+ +LF L+ ++  L     +   +G        FH+L I+ATD    ++ L  + TV  +   +N                          D   IF   SYS +               V EN+P+   I+ ++   L    N K+V +++    D S C    F I+  TG + +   LD E    +   I V   G         + V ++D NDN P+F+Q ++   +S +    S ++   ATD D   +  + Y +L +    F ID  +G ++  Q P   ++ P   V   ++   D             + V+   + ++PP F+   + + V E+    + I  + A D D  +  ++RY ++   +   F +D L+GA+ + + LD E+K ++ L V   D G     ++      ++ D     + PV   ++ E  V+     TG+   S++ + A D D      + Y +        +  +D  TG +        +++      +   L VY     V   PL S+          I V +++  + D   +   P+    IM   EN+P +  V        +      L    +  + Q  F I    G I    + +D E Q ++ + V    +  P  +T   +++ ++D+ND  P F    Y I + E           K        A DKD      + YS+ + +  E G  F I+ + G V S       E  ++++    + +    + T L I           W   P      I         +F   V+  +  ++D           E     L F I   N +   ++F V + +G +++  PLDAE+      L   A+D       + +  I+VID NDH P       ++ + E   P   I  + A DRD   + N L YTL    DP  L    ++P TG +     LD E      +  +V   DV  K+   +I++NV D ND+AP F   S      E+A  GSV+ ++ A+D D G N +++Y I   +  +SF+ID   G ++ A  LDR  Q ++ L+++A+D G PP S +T+V+I +   +++ P+F +      ++E   IG  +  + A S      + V Y+ I + N    F +   SG++   + LDFE    Y LTV+ ++     LST T V++ V D NDN P F    Y   I E+  V+ + +        + A D+D   N++L Y  +                + ++F I+P TG I      D EE   + F V V D G P   ++   NVT+ + D ND PP F++
Sbjct:  172 VSATDADIGTNGEFYYSFKDR-TDVFAIHPTSGVVVLTGRLDF-LETQLYELEILAADRGM-KLYGSSGVSSLAKLTVHVEQANECAPIITA-VTLSPSELDKDPTYAIITVEDCDQGANGEIASLSIVAGDLLQQFKTVRSF---PGSKAFKVKAVGAVDWDSHPYGYNLTLQAKDKGTPPQFSPVKVVHIISPQFRAGPVKFEMDVYRAEISEFAPPHTPVVLVKAIPSYSH----LRYVFKSAPGKPKFGLNHNTGLISILEPIRRQHTSHFELEVTTSDKRAS---ARVVVKVLGTNSNPPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVTYSIANLN----HVPFVIDHFTGTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDADELQLVRYQIEAGNELDLFGLNPSSGVLSLKHSLTDGLGA----KVSFHSLRITATDGENFATPLYINLTVAASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFF-DSYSVNTHTPQFGVTLPTGIEVKENLPVGANILFMNATDLDSGFNGKLV-YAISGGNDDS-C----FTIDMETGVLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYFVEVSEDKEVNSEIIQVEATDKDLGPSGHVTYAILTDTEK-FSIDSMTGVVKIIQ-PLDREVQP---VHYLKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGH-FDVDKLSGAVRIVQQLDFEKKQLYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVF-SSFVEKGVVKEDVPTGS---SVMTVSAHDEDTGRDGEIRYSIRDGS-GIGVFRIDEETGVIETSDRLDREST------SHYWLTVYATDQGVV--PLSSF----------IEVYIEVEDVNDNAPQTSEPVYYPEIM---ENSPKDVSVVQIEAFDPDSSSNDKLTYRITSGNPQGFFSIHPKTGLITTTSRKLDREQQDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKFYKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYSIEEGN--EHG-RFSIEPKTGVVSSKKFSAAGEYDILSIKAVDNGRPQKSSTTRLHIE----------WISKPKPSSEPI---------SFEESVFSFTVMESDPVAHMIGVISVEPPGMPLWFDIIGGNYD---SHFDVDKGTGTIIVAKPLDAEQ-KSSYNLTVEATDGTTTILTQVL--IKVIDTNDHRPQFSTSKYEVAVPEDTEPEVEILQISAVDRD---EKNKLIYTLQSSIDPASLKKFRLDPATGALYTAEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYESAAVGSVVLQVTALDKDKGRNAEVLYSIESGNIGNSFTIDPILGSIKTARELDRSHQVDYDLMVKATDKGDPPMSEMTSVRIAVTVADNASPKFTSKEYSAEISEAIRIGSFVGMVSAHS-----QSSVMYE-IRDGNMGDAFNINPHSGSIITQRALDFETLPMYSLTVQGTNMA--GLSTNTTVVVHVRDENDNPPVFTQAEYSGFISESASVNSVVLTDRNVPLVIRATDADRESNALLVYQIVE-------------PSVHNYFAIDPTTGAIRTVLSLDYEETHAFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFSK 1883          

HSP 3 Score: 230.335 bits (586), Expect = 4.710e-59
Identity = 447/1900 (23.53%), Postives = 772/1900 (40.63%), Query Frame = 3
Query: 5706 KPSTGK-LFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGK-FETSCNITINSFDNTRNKVLPLEKSQVVWEIPE---------NRNDVPDL----------------VLPRAKFYFSHQHPSIKYILLSEQPKVE---------------------INEITGSLKLKSALDRE--ERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKG--QPALSS--FTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS---STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDIND----ELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLD--TNSKLIYKVLN-EYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKN-HPPSFVMNEFHMSVSENFTVNSE--------IGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGK----WSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMAT-RTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDD-QGWVYSVSAVDYEETKLINLVVSASDKAGHVTN--TTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITT-------LQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKC----SFKILINVLDINDNAPRFVHT--SIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDES-KSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIK-KLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFL--NFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDK 11108
            K + GK  FG+  +TG I  +  + R   Q     +++V + D   S       V + +   N N P F         I E+A  G+ V                 ++A DPDEG+NG + Y I +     F ID +TG +S +  +D E++     L IR  D G P     E L   I + + ND  P FE+      +         +  +   D D    + + I  G E   F ++P++G L +  +     G   S   + I A DG+ F T   I +    + +   L  E++ V   + E         ++ DV D+                 LP          P    IL      ++                     I+  TG LK+ S LDRE  ++  + + V   G      +  + V+V D ND  P FL E Y   V  +    ++ I+V+A D D G +G V Y+I          KF+IDS +GV+ I     +E+    + + I+A D+   +P L S     V +D V+D  P F    YSV V ED  +  I+  ++A          + Y++ + + E  FD+D  +         +R+V +LD+E K  + L + A D    +S S+T  + V  ++       P+F        V E++P    ++++S   +       + +S++   D S      FRI+  TG I   + LD E+   +   +     G    ++   + + + D NDN P+  +P +   I   S +   VV   A D D  +N KL Y++ +      F I   +G I       +++      ++E  V  +           +  +  +N + P F+   + + + E    + +        + R++A+D D+     L Y +  G +   F ++  TG +  KK        +  ++ V  D G     +T  +H+  I+   P  E   +E              ES+      + D    H +    V PP    + F D I G         N +S+  ++     + V +      ++  Y+  +  T  + +I   V I ++ D     P  + S   +         V + +IS+ +   K    ++L  S  P  ++  F +D   G +   + +D E   Q+ + V  R  + P+      I++++ D+ND  P F +  Y   + E   +GS V+Q  A DKD +G++     LY ++S   G SF ID   G + +   +D       +L+V A+DK     +  T++ I+V   ++  P +T        EI+E     S  F  +V         S   + S+ + I + N+    A+     SG ++    LD E +  P+    +    +        + + V D ND+ PV  Q      I E  +  SV+ T       ++A D D  +    L Y ++E S      ++P TG +     LD E +   +F V   D+ + +     +  + ++V+DIND  P F  +   ++  L      +VI  ++A DADS    +++Y I + +    FS+D  TG + + +    + +  + L + ASD G+   +++ +VKI + +  +SP +F        V E++   + L  I AI + +  N  + Y+++     F++   SG L+      D E    + + V  + +  PS      V + V D NDN P F  LPY   +  +  V  + I  VTA D DSG N  +     Y+L E          H +H F+I P +G+I L   F  D   +  Y   V   D G PAFS++  V I + +K
Sbjct:  404 KSAPGKPKFGLNHNTGLISILEPIRR---QHTSHFELEVTTSDKRAS-----ARVVVKVLGTNSNPPEFT-QTSYKASIDENAPIGAAV---------------TRVSAMDPDEGENGYVTYSIANLNHVPFVIDHFTGTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVL-ATITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDADELQLVRYQIEAGNELDLFGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGENFATPLYINLTVAASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFFDSYSVNTHTPQFGVTLPTG-IEVKENLPVGANILFMNATDLDSGFNGKLVYAISGGNDDSCFTIDMETGVLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYFVEVSEDKEVNSEIIQVEATDKDLGPSGHVTYAI-----LTDTEKFSIDSMTGVVKIIQPLDREVQPVHY-LKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLD-HGEGHFDVDKLSG-------AVRIVQQLDFEKKQLYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDTGRDGEIRYSIR---DGSGIGV--FRIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLTYRITSGNPQGFFSIHPKTGLITTTSR-KLDREQQDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKFYKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYSIEEGNEHGRFSIEPKTGVVSSKKFSAAGEYDILSIKAV--DNGRPQKSSTTRLHIEWISKPKPSSEPISFE--------------ESVFSFTVMESD-PVAHMIGVISVEPP-GMPLWF-DIIGG---------NYDSHFDVDKGTGTIIVAK-PLDAEQKSSYNLTVEATDGTTTILTQVLIKVI-DTNDHRPQFSTSKYEVAVPEDTEPEVEILQISAVDRDEKNKLIYTLQSSIDPASLKK-FRLDPATGALYTAEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYESAAVGSVVLQVTALDKD-KGRNAEV--LYSIESGNIGNSFTIDPILGSIKTARELDRSHQVDYDLMVKATDKGDPPMSEMTSVRIAVTVADNASPKFTSKEY--SAEISEAIRIGS--FVGMV---------SAHSQSSVMYEIRDGNMGD--AFNINPHSGSIITQRALDFETL--PMYSLTVQGTNMAGLSTNTTVVVHVRDENDNPPVFTQAEYSGFISESASVNSVVLTDRNVPLVIRATDADRESN-ALLVYQIVEPSVHNYFAIDPTTGAIRTVLSLDYEETHAFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFSKSLYEVSLLLPTYRGVNVI-TVNATDADSKAFSQVMYSITEGNIGEKFSMDHKTGTIAIQNTT--QLRSRYELTVRASD-GR--FTSMASVKINVKESRESPLKFTQDAYSAVVKENSTEARTLAVITAIGNPL--NEPLFYRILNPDRRFKISHTSGVLSTTGIPFDREQQETFDVVVEVTKEHEPSAVAHVVVKVTVEDQNDNAPVFVNLPYYAVVKVDAEVGHV-IRYVTAIDRDSGRNGDIH----YYLKE----------HHDH-FQIGP-SGDISLKKQFEHDTLNK-EYLVTVVAKDGGSPAFSAEVLVPITVMNK 2179          

HSP 4 Score: 169.088 bits (427), Expect = 1.493e-40
Identity = 332/1388 (23.92%), Postives = 567/1388 (40.85%), Query Frame = 3
Query: 7308 ILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGK------LDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWIL-----VKYDGRFSPTNRAHMQVHIVDEND----------NPPKFIQPAFNATISLES-SQGSLVVIAMATDLDTNSKLIYKVLNEY--YNIFKIDQSSGFIRFNQVP---NIEKLLPSSGV-VEFQ--VLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMK------------GKWSLVPSSSPFDVQNDF------EIDSNYGYIRAKKIMDFET---------QSQYRINVEYRVDNSPLMATRTILI--DLIDQNDCPPIFDNS--------RYAIFISEDI------PLGSKVIQCKAYDKD--YEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYE--ETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRV-SESGEVLLLHPLDAEKILKPLQ-LKFLASDRLHWSKEEF---ILNIRVIDVNDHAP-VCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSI-APFL------ENAPHGSVIGKIHAVDADSGINRKIVYRILDESK-SSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLI-KKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPE-------NTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDK---NDNPPEFAQPSFRFLI 11156
            I Y I +G+ E LF  +    Y+    C +R+  K      L+ E +  +TLI+ A + ++       V + VLD ND  P+F  +SYS S+ EN  I   I  +S     +  +    +S K   D        F I+ T+G + +   LDF    ++E  IL     +K  G    ++ A + VH+   N+          +P +  +    A I++E   QG+   IA  + +  +    +K +  +     FK+ ++ G + ++  P   N+       G   +F    +VH  +              +  P  F M+ +   +SE    ++ +  + A  S    +  LRY          FGL+  TG + + + + R+  S  EL V  SD   K   A V++ V   N N P   Q  Y+ ++            ++ ++ A D D      + Y + +  L+     +D  TG VS      ++N +  L        VY +  +  +  L  YR    V++     T+ +N L D   +   I C     ++      I  +  I + E++              + L PSS    +++        ++  +   I A    +F T          S+  +N++        M    +L    L  Q D   IF +S        ++ + +   I      P+G+ ++   A D D  + GK V   S    DS      F ID + G +  +S +D E  +   +N+ V             L ++V D ND  P + +      +E++E  +  SE     + ++ A D D        + ++T+         F + S +G V ++ PLD E  ++P+  LK  A D+       F   +L + + DVND+ P   P    + + E +  G++I  L+AYD D   + + + Y+L++  + +   V+ L+G V +   LD E     N  V A D + K  S      V     +    +HT + + F+      E+ P GS +  + A D D+G + +I Y I D S    F ID +TG++  +  LDRE    + L + A+D G  P S+   V I + DVND+ PQ         + E++     ++ I+A   D   N +++Y++ +   Q FF +   +G +T   +KLD E   E+ L V  +D G P  ST   VI++++D NDN PQF    Y   +PE        +   +  + +V A D D G N+ L+YS    + E   + R         F I PKTG +         E       +   D+G P  SS T + IE   K   +  P  F +  F F +
Sbjct:   71 IRYKIVSGDSENLFKAE---EYVLGDFCFLRIRTKGGNTAILNREVRDHYTLIVKAVEKATDAEARAKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDV-------FAIHPTSGVVVLTGRLDFLETQLYELEILAADRGMKLYGSSGVSSLAKLTVHVEQANECAPIITAVTLSPSELDKDPTYAIITVEDCDQGANGEIASLSIVAGDLLQQFKTVRSFPGSKAFKV-KAVGAVDWDSHPYGYNLTLQAKDKGTPPQFSPVKVVHIIS-----------PQFRAGPVKFEMDVYRAEISEFAPPHTPVVLVKAIPS----YSHLRYVFKSAPGKPKFGLNHNTGLISILEPIRRQHTSHFELEVTTSD---KRASARVVVKVLGTNSNPPEFTQTSYKASI----DENAPIGAAVTRVSAMDPDEGENGYVTYSIAN--LNHVPFVIDHFTGTVS-----TSENLDYEL-----MPRVYTLRIRASDWGL-PYRREVEVLA-----TITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDADELQLVRYQIEAGNELDLFGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGENFATPLYINLTVAASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFFDSYSVNTHTPQFGVTLPTGIEVKENLPVGANILFMNATDLDSGFNGKLVYAISGGNDDSC-----FTIDMETGVLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYF--VEVSEDKEVNSE-----IIQVEATDKDLGPSGHVTYAILTDTE------KFSIDSMTGVVKIIQPLDRE--VQPVHYLKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPD-VGQSSQVRYSLLDHGEGH-FDVDKLSGAVRIVQQLDFEKKQLYNLTVRAKD-KGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDTGRDGEIRYSIRDGSGIGVFRIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLTYRITSGNPQGFFSIHPKTGLITTTSRKLDREQQDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKFYKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYS----IEEGNEHGR---------FSIEPKTGVVSSKKFSAAGEYDI--LSIKAVDNGRPQKSSTTRLHIEWISKPKPSSEPISFEESVFSFTV 1369          

HSP 5 Score: 154.451 bits (389), Expect = 3.846e-36
Identity = 244/1050 (23.24%), Postives = 419/1050 (39.90%), Query Frame = 3
Query: 5724 LFGVTRSTGCIITVSSLDREQIQ----DIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIE--YVILSRFASYFK-IDQYTGVLSLALK----IDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPS--IKYIL--LSEQPKVEINEITGSLKLKSALDREERPFV-QLLVLAKGWDGSYDY---INVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKK--FTIGIKANDKGQPALSSFTDVFVDIVSDKSPL---------------------------------FDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILY----------------TITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVL-ITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPT--NRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHD------FTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYG--NKHDFATVLIHVTDINDNIP-VIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVS 8621
            +F +  ++G ++    LD  + Q    +I++ D  ++ Y    S  +S+  + +H+   N+ AP          I + + +P           +L K     +I  ED D+G NG+I    ++       FK +  + G  +  +K    +D +      +L+++ +DKG+P   S  ++ + II       P KFE D Y   +     P  P++ ++      +   +F    GK    F ++  TG + I     P+  +  S   + +   D +   S  + +       N   P E +Q  ++   + N      + R       +  +  + Y +  L+  P V I+  TG++     LD E  P V  L + A  W   Y     +  T+++ + ND  P+F     E  +  +L    Q   V AID D  E   V Y I        DL F ++ +SGV++++   +  L  K    ++ I A D    A   + ++ V   + + P+                                 FD    +   P+  +       VK     G  IL+                 I+ GND+  F +D           V++++  LD E    +TL I+  D       +  +L +TVLD ND  P FL+ SY   VSE+  +N EII +    + +  S  V +++          ++ F I+  TG + I + LD E   +H   I  +      P   +   ++V + D NDNPP+FI P ++  +  +  +G++++   A D D   +S++ Y +L+     F +D+ SG +R  Q  + EK      +    V   D       + +    V V  V+   H P F        V E+    S +  + A D D  + G +RY +  G    +F +D  TG +     LDRE  S + L V  +D G      F  V I V D+NDN P   E  YY   +  S K       S++Q+ A D D S   ++ YR+ S
Sbjct:  195 VFAIHPTSGVVVLTGRLDFLETQLYELEILAADRGMKLYGS--SGVSSLAKLTVHVEQANECAPI---------ITAVTLSPS----------ELDKDPTYAIITVEDCDQGANGEIASLSIVAGDLLQQFKTVRSFPGSKAFKVKAVGAVDWDSHPYGYNLTLQAKDKGTPPQFSPVKV-VHIISPQFRAGPVKFEMDVYRAEISEFAPPHTPVVLVKAIPSYSHLRYVFKSAPGKPK--FGLNHNTGLISILE---PIRRQHTSHFELEVTTSDKR--ASARVVVKVLGTNSN---PPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVTYSIANLNHVPFV-IDHFTGTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDAD--ELQLVRYQIEAGNEL--DL-FGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGENFATPLYINLTV--AASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFFDSYSVNTHTPQFGVTLPTGIEVKENLPVGANILFMNATDLDSGFNGKLVYAISGGNDDSCFTIDMETG-------VLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYFVEVSEDKEVNSEIIQVEATDKDLGPSGHVTYAIL-------TDTEKFSIDSMTGVVKIIQPLDREVQPVHYLKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGHFDVDKLSGAVRIVQQLDFEK----KQLYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDTGRDGEIRYSIRDGSGIGVFRIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDV-----SVVQIEAFDPDSSSNDKLTYRITS 1181          

HSP 6 Score: 132.494 bits (332), Expect = 1.808e-29
Identity = 171/676 (25.30%), Postives = 284/676 (42.01%), Query Frame = 3
Query: 1557 TKKTFT----LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDI-SRTKISYYLFDQNKLPFRL----GEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGL---VSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRF-LDSFQIPMTLPENYDIKKRIVQIKATDADS---KDIQYRLV--NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRY--AIHGIHSDCFHCDTSTGAVHLLCKLSPLTEYRLIAV-VKDNGKPQALS-SQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRINNEG 3518
            T  TF+    + + V D N+  PV        T+ E+   G+ V+ + A D DI S  +I+Y LF      F+L    GE +   ++ +E       Q  + + V  TD G    RS  A   + + DVN+  PEF  +   IT+         +    A D D      I  S+   +  Q  FSI+  SG + L    KH        +T+ L+A D GL   +++   +  SV+D N                                       N P+F  R              + E+   GT V ++   + D + +   +E  + + S  E   FSI   DS +  I + + LD E+  +Y++T+   D G P         I V DINDN P F  D++     + E+  +++ ++ I A DAD      I Y ++  N    F I    G +++   LDRE    Y + + A+D    N     T T+ I V+D+NDN P+F++++YS+ + E+ P+G  +++L  TD D   N    +   + G   + F  +     +        + ++ L+ V V D+GKPQ  S +  D ++  + +HP   +P   E  ITA   E    G ++  I     D    + +Y++  H +G  LF +++ G
Sbjct: 3001 TDGTFSSKARVEVKVLDANDNSPVCEKTSYSDTIPEDALPGKLVMQVSATDADIRSNAEITYTLFGSGAEKFKLNPDTGELRTLALLDREE------QAVYNLLVKATDGGG---RSCQAAIVLTLEDVNDNAPEFTAEPYTITVFENTEPGTPLTRVQATDADTGLNRKISYSLVESADGQ--FSINERSGIIQLE---KHLDRELQAVYTLTLKAVDQGLPRRLTATGTVVVSVLDIN--------------------------------------DNPPVFEYREYG---------ASVSEDIVIGTEVLQVYAASRDIEAN---AEITYAIISGNEHGKFSI---DSKTGAIFIIESLDYESSHEYYLTVEATDGGTPSLSDVATVNINVTDINDNSPVFSQDTYT--TVVSEDAALEQPVITIMADDADGPSNSHIHYSIIEGNQGSPFTIDPVRGEVKVTKPLDRETISGYTLTVQAADNG--NPPRVNTTTVNIDVSDVNDNAPLFSRDNYSVIIQENKPVGFSVLKLVVTDKDSSHNGPPFFFTIVSGNDENAFEVNQHGVLLTAATIKRKVKDHYLLHVKVADSGKPQLSSMTHIDIRVIEESIHPPAILP--LEIFITAFGEE--YSGGVIGKIHATDQDVY-DTLMYSLDPHMDG--LFSVSSTG 3598          

HSP 7 Score: 102.449 bits (254), Expect = 1.786e-20
Identity = 76/213 (35.68%), Postives = 115/213 (53.99%), Query Frame = 3
Query:  231 ISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTKY--TASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFY-YLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRG 860
            I FT   YNV ++++   + YV H   +MGI   +   +I YKI  S +  N F+AE  ++GDF +LRIRTK   TA LNRE    Y L ++ +   K+T   +   + +V ++VLD ND  P+F   ++     EN +I T I  V+ATDAD G N E +Y + D++ +        F+I+P SG++    +L DF+       +I A  RG
Sbjct:   33 IQFTHFQYNVTVHENSAAKTYVGH-PRKMGIYILDPSWEIRYKIV-SGDSENLFKAEEYVLGDFCFLRIRTKGGNTAILNREVRDHYTLIVKAV--EKAT---DAEARAKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDV--------FAIHPTSGVVVLTGRL-DFLETQLYELEILAADRG 229          

HSP 8 Score: 96.6709 bits (239), Expect = 1.135e-18
Identity = 142/583 (24.36%), Postives = 250/583 (42.88%), Query Frame = 3
Query: 6771 LDREERPFVQLLVLA--KGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQ--------PALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKD--FIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPF-HTLIISATDPSSSLSHSTTVLITVLDINDEL-PI-FLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLV--VIAMATDLDTNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHD----FTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLD---RERKSMHELRVVVSDYGNKHDFATVL 8447
            L+RE R    L+V A  K  D       V V V D ND +P+F    Y   +  N +      RV A D D G NG   YS            FAI   SGV+ + +G    L  + + + I A D+G          +L+  T V V+  ++ +P+      S   P +  KD  + + TV+      +  + +++    + L       ++       ++ VG +D+++ P+ + L + A D  +    S   ++ ++       P+ F    Y A +SE  P +  +    VL++ + +   + +  K    S+P   + F +N  TG ISI E +  +     E  +    D R S    A + V ++  N NPP+F Q ++ A+I   +  G+ V  V AM  D   N  + Y + N  +  F ID  +G +  ++  + E L+P   V   ++   D    +   V    ++   ++ ++ P F       ++  +  V  +I  + A D+D+ +   +RY +  G + ++FGL+  +G L LK +L      + S H LR+  +D  N   FAT L
Sbjct:  109 LNREVRDHYTLIVKAVEKATDAEA-RAKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDV-----FAIHPTSGVVVL-TGRLDFLETQLYELEILAADRGMKLYGSSGVSSLAKLT-VHVEQANECAPIITAVTLS---PSELDKDPTYAIITVEDCDQGANGEIASLSIVAGDLLQQFKTVRSFPGSKAFKVKAVGAVDWDSHPYGYNLTLQAKDKGTPPQFSPVKVVHIISPQFRAGPVKFEMDVYRAEISEFAPPHTPV----VLVKAIPSYSHLRYVFK----SAPGKPK-FGLNHNTGLISILEPIRRQHTSHFELEVTTS-DKRAS----ARVVVKVLGTNSNPPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVTYSIANLNHVPFVIDHFTGTVSTSENLDYE-LMPR--VYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDADELQL--VRYQIEAGNELDLFGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGEN---FATPL 658          

HSP 9 Score: 90.5077 bits (223), Expect = 7.976e-17
Identity = 192/819 (23.44%), Postives = 327/819 (39.93%), Query Frame = 3
Query: 1566 TFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISR-TKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNE--YKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDN-IQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLV--SSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADR-LDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPE------NYDIKKR--IVQIKATDAD---SKDIQYRLV--NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPI-FTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDC-FHCDTSTGAVHLLCKLSP--LTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISL--FRIN-NEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVP 3941
            T  L++S+ DVN+ PP  +     + V+E+   G  ++ ++AYDPD+ + +++ Y L D  +  F + +    V IV++ LD E  Q  + + V   D G P++ S   + E+E+ DVNE  + P F     +  +    P    +    A D D  GRD  I+ SI   S     F I  E+G +    T         +++ + + A D G+V  SS + +   V D N                                 +N  ++++P++            P ++   E S K   V +I     D   +    +  + + S   Q  FSI      +  I    R LDRE  D++ + + V D G P      R  +++ D NDN P+FL  F   + LPE      +    KR  + ++ A D D   + ++ Y +   N    F I  +TG +  +        +Y  + I A D     +S T    +  I      ++PI F ++ +S  + E  P+   +  +      +     L + I G + D  F  D  TG + +   L     + Y L     D G    L+     Q+  + +  N + P         A+ E+  P   +  I     D E    +YT+    +  SL  FR++   G + T   +D E    + L + + D+ D  + +  A + + V+D+ND+ P      Y   V E+      ++ V A D D  +  E+ Y I SG+    F+I        + R +DR       +    YDL V  +D G P
Sbjct:  911 TVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGHFDVDKLSGAVRIVQQ-LDFEKKQ-LYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDT-GRDGEIRYSIRDGS-GIGVFRIDEETGVIE---TSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVN---------------------------------DNAPQTSEPVY-----------YPEIM---ENSPKDVSVVQIEAFDPDSSSN---DKLTYRITSGNPQGFFSI---HPKTGLITTTSRKLDREQQDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKF-YKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYSIEEGNEHGRFSIEPKTGVVSSKKF--SAAGEYDILSIKAVDNGRPQKSSTTRLHIEWISKPKPSSEPISFEESVFSFTVMESDPVAHMIGVISVEPPGM----PLWFDIIGGNYDSHFDVDKGTGTIIVAKPLDAEQKSSYNLTVEATD-GTTTILT-----QVLIKVIDTNDHRPQFSTSKYEVAVPEDTEPEVEILQISAVDRD-EKNKLIYTLQSSIDPASLKKFRLDPATGALYTAEKLDHEAIHQHVLTVMVRDQ-DVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYESAAVGSVVLQVTALDKDKGRNAEVLYSIESGNIGNSFTIDPILGSIKTARELDR-------SHQVDYDLMVKATDKGDP 1647          

HSP 10 Score: 82.4185 bits (202), Expect = 1.984e-14
Identity = 112/452 (24.78%), Postives = 186/452 (41.15%), Query Frame = 3
Query: 1566 TFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDI-SRTKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKD-IQYRL-VNFRRVFKIHSRTGWLRLRVNLD 2912
            T T+ +SV D+N+ PPV        +V E+  IG  VL + A   DI +  +I+Y +   N+      + K   + + E+LD E+    +++ V  TD G P + S +A   I + D+N+  P F   T    +S  A  +  +   +A+D D     +I  SI   +   P F+I P  G + +        +S    +T+ +QA D                      +G P +++    +I V       S +N                N P+F+ +  SVI I+E    G  V K+ +   DKD       F F + S  ++  F +   + H   ++ A  + R+  D Y + + V D G+P+       +I+V + + +PP  L          E Y     I +I ATD D  D + Y L  +   +F + S  G L     LD
Sbjct: 3215 TGTVVVSVLDINDNPPVFEYREYGASVSEDIVIGTEVLQVYAASRDIEANAEITYAIISGNEHGKFSIDSKTGAIFIIESLDYES-SHEYYLTVEATDGGTP-SLSDVATVNINVTDINDNSPVFSQDTYTTVVSEDAALEQPVITIMADDADGPSNSHIHYSIIEGNQGSP-FTIDPVRGEVKVTKPLDRETIS---GYTLTVQAAD----------------------NGNPPRVNTTTVNIDV-------SDVND---------------NAPLFSRDNYSVI-IQENKPVGFSVLKLVV--TDKDSSHNGPPFFFTIVSGNDENAFEV---NQHGV-LLTAATIKRKVKDHYLLHVKVADSGKPQLSSMTHIDIRVIEESIHPPAILPLEIFITAFGEEYS-GGVIGKIHATDQDVYDTLMYSLDPHMDGLFSVSSTGGKLIAHRKLD 3608          

HSP 11 Score: 68.1662 bits (165), Expect = 4.235e-10
Identity = 127/532 (23.87%), Postives = 227/532 (42.67%), Query Frame = 3
Query:  459 LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVK-YLSKYFDPDFNDYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNV---FLTPTGELNRYVLKLRAIFSPISTPAISVTIEAKDLSLNPKTSSTHLTIPLGNLRNIN----LLSVPEFVSVSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLE-GTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPD-ISRTKISYYLFDQNK-LPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLD 2021
            L+RE+   Y LT+     + + G F  S K +V +KVLD NDN P+    ++     E+A     +  V+ATDAD   N+EI Y L  S          F +NP +G +  +  L D    +  +  + A   G  S   C       L       N +AP+ + + Y    F+      P   +  TD D  LNR +  Y ++     +  +N     +     L+R   +L+A+++        +T++A D  L  + ++T   +   ++ +IN    +    E+   S+ E+ ++ + V  L+ +  S ++    ++ +  I   E G +S++      +G + + + L+ E   S E  LT+      +       T+ I+V D+N+  PV   +     V E+  + + V+ I A D D  S + I Y + + N+  PF +   +  V + K  LD ET+   + + V   D+G P  R       I+++DVN+  P F      + I    P    +   +  D D
Sbjct: 2986 LDREQKDSYLLTV-----TATDGTF--SSKARVEVKVLDANDNSPVCEKTSYSDTIPEDALPGKLVMQVSATDADIRSNAEITYTLFGSGAEK------FKLNPDTGELRTL-ALLDREEQAVYNLLVKATDGGGRS---CQAAIVLTLEDV----NDNAPEFTAEPYTITVFENTEPGTPLTRVQATDADTGLNR-KISYSLVESADGQFSINERSGIIQLEKHLDR---ELQAVYT--------LTLKAVDQGLPRRLTATGTVVV--SVLDINDNPPVFEYREY-GASVSEDIVIGTEV--LQVYAASRDIEANAEITYAIISGNEHGKFSID----SKTGAIFIIESLDYE--SSHEYYLTVEATDGGTPSLSDVATVNINVTDINDNSPVFSQDTYTTVVSEDAALEQPVITIMADDADGPSNSHIHYSIIEGNQGSPFTIDPVRGEVKVTKP-LDRETIS-GYTLTVQAADNGNP-PRVNTTTVNIDVSDVNDNAPLFSRDNYSVIIQENKPVGFSVLKLVVTDKD 3470          

HSP 12 Score: 67.3958 bits (163), Expect = 7.236e-10
Identity = 74/293 (25.26%), Postives = 125/293 (42.66%), Query Frame = 3
Query: 2721 PPRFLDSFQIPMTLPENYDIKK-----RIVQIKATDADSKDIQYRLVN------FRRVFKIHSRTGWLRLRVN------LDREKRDYYPIVIVASD--VDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRINNEGEIRTVS 3536
            PP     FQ  +T+ EN   K      R + I   D  S +I+Y++V+      F+    +     +LR+R        L+RE RD+Y +++ A +   D   R+          V D ND +P+F+  SYS++LPE+  I + + ++ ATDAD+  N +  Y+     +D F    ++G V L  +L  L    Y L  +  D G                K++ +  + SL +  +       C P     ++ P   DK+P   + T+     G +       GEI ++S
Sbjct:   31 PPIQFTHFQYNVTVHENSAAKTYVGHPRKMGIYILDP-SWEIRYKIVSGDSENLFKAEEYVLGDFCFLRIRTKGGNTAILNREVRDHYTLIVKAVEKATDAEARAKVRVQ-----VLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKD-RTDVFAIHPTSGVVVLTGRLDFLETQLYELEILAADRG---------------MKLYGSSGVSSLAKLTVHVEQANECAPIITAVTLSPSELDKDPTYAIITVEDCDQGAN-------GEIASLS 294          

HSP 13 Score: 65.0846 bits (157), Expect = 3.670e-9
Identity = 53/146 (36.30%), Postives = 69/146 (47.26%), Query Frame = 3
Query:  360 IRDSSEI----FNTFEAESKLVGDFFYLRIRTKYTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGII 785
            IR ++EI    F +   + KL  D   LR      A L+RE    YNL +      K+T     SC+  +V+ + D NDN P F  E +     EN    T +  V ATDAD G+N +I Y L +SA         FSIN  SGII
Sbjct: 3054 IRSNAEITYTLFGSGAEKFKLNPDTGELRT----LALLDREEQAVYNLLV------KATDGGGRSCQAAIVLTLEDVNDNAPEFTAEPYTITVFENTEPGTPLTRVQATDADTGLNRKISYSLVESA------DGQFSINERSGII 3183          

HSP 14 Score: 54.299 bits (129), Expect = 6.915e-6
Identity = 38/115 (33.04%), Postives = 62/115 (53.91%), Query Frame = 3
Query:  459 LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKL 803
            L+ E+   YNLT++    +       T+  TQV+IKV+D ND+ P F    +E    E+     +I  ++A D DE   +++ Y L QS+I   S+K  F ++P +G +Y  +KL
Sbjct: 1419 LDAEQKSSYNLTVEATDGT-------TTILTQVLIKVIDTNDHRPQFSTSKYEVAVPEDTEPEVEILQISAVDRDE--KNKLIYTL-QSSIDPASLK-KFRLDPATGALYTAEKL 1522          
BLAST of Ft-2 vs. Ensembl Mouse
Match: Fat1 (FAT atypical cadherin 1 [Source:MGI Symbol;Acc:MGI:109168])

HSP 1 Score: 1053.51 bits (2723), Expect = 0.000e+0
Identity = 1085/4101 (26.46%), Postives = 1827/4101 (44.55%), Query Frame = 3
Query: 1581 ISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDI--YVPHQTTRDSTINHPNNYEESNKPIFGMR-NIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXX-XXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSEND-----KSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNK----RATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPP--RINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPST-GKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILS-RFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNP--TILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKS-ALDREERPFVQLLV-LAKGWDGSYDYINVTVSVT-DENDYKPMFLSEKYEFLVHTNLSKEAQSIR-VKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVLN-EYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRE--RKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIA---FVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKV----NPIITCSIMTIQENNPLNHIVAMCRISSTEMKGK--WSLVPSSSPFDVQND-FEIDSNYGYIRAKKIMDFETQSQYRINVEYR--VDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHV---TNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPF----LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIV-LLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRT---LWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKP----------------NIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGARNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHCE 13637
            + V   N  PP         ++ EN  IG  V  + A DPD      ++Y + + N +PF +  F    V   ENLD E M R + +R+  +D G P  R V     I + ++N+  P F    C+ TI    P DL +G  I     +D D    ++  I + + +   F ++P SG LSL  +   G+ +K++  ++ + A D    ++ + +N +V  A SR    +P+ L C +  +   +  +  + + ++   + E+     + +  + P F   +P+ I ++E    G  +  + M   D D   +  + V+ +    +   F+I   D  +  + V   LDRE +DKY + I V D G P+   ++  ++ V D NDN P FL +S+ + ++  E+ ++   I+Q++ATD D   S  + Y ++     F I S TG +++   LDRE +  + + I A D       L +T  L + + D+NDN P F   +YS+ + EDLP G+ ++ L A D D+  +SQ+RY++       F  D  +GAV ++ +L    +  Y L    KD GKP +LSS    ++    V+ N + P     +    ++E+   G+ V ++     D      + Y+I   S GI +FRI+ E G I T   +DRE    YWL +Y  D+    ++  + EVYI+V D NDN P      Y   + EN      ++ ++A D D +   +L Y+I SG+  G+FSI   TG I+T+ R +DRE         D + L+V ++D+GVP +     + V I+D NDN P F+    F   R    E  +  R  +    + RV A D D   NA + Y+++         +    FS++ K+G     +SS  F  S  G   I    +++ A D G P   +      T RL++ E  + PK  ++     +S      + SD +  +    I  E   +P+    D  G + +   D   G  ++I AK                D+       +T+E T   T    Q  V I +   N + P F   S+   ++ + + T+P   I  + A                     + D    +IY++ +S DP +++K F ++   G L      +  +     + V  R++    +  + ++ +++ D N+  P F        +Y                                         +++G+++  ++A D+D GRN +++++I++ ++  N F +D   G I+  R L         L +  +D G PP   +    +AV + D    ++ P+    +    + E   + S +  +   S +        V+  I+    G  F +   +G IIT  +LD E +  + S+ +Q  +  GL +      +V +H+ D NDN P F    + +G ISESA+  S+V        L+     LVI A D D   N  + Y I+     +YF ID  TG +   L +D E   +F   ++++ D G+P+L ++    + + + D NDCPP F K  Y   L+LPT+    ++ +   D D      +++SI  G     FS+D  TG + I       + +  S   + +RA DG+F +  ++ IN  ++  +   PL+ +Q  +      N      L       +  +  + Y +L+   + +I+  +G L       DRE++    ++V + K  + S     V      D+ND  P+F++  Y  +V  + ++    IR V AID D+G NG +    YY+K   +   F I   SG I+++     + L K++ + + A D G PA S+   V + +++   P+F+K+ YS  +PE+      V  ++A S  G  + Y+IT+G+    F ++F          V+ ++  LD+E+ P + L + ATD  +       V I V DIND  P+F++ SYS ++SE   I   ++ +         ++ +  S +LI + S  S  HF I+  TG IS+   LD+E    H  ++     G  + ++   + V + D NDNPP F Q  + A IS  ++ G  V+   A D D++   KL Y +L+   +  F ID+ +G I  + +     L P        V V D      A V+V  +    H P F  NE+ + ++EN  +++ + ++ ASD D   +  + YH++  F  + F ++       L+K LDRE   + +  +R++  D G K  F TV + +TD NDN P      YEV  I S+ + GT   S++++ A D D      + Y + +   S+S+     ++ +TG ++ K S I      GL N       +  A      P  S             V V I IL  + ++     P  T    TI E+ P+   + + R+   E  G   + LV  ++P   +++ F ID   G ++ +K +D ET   Y+ ++  R  +D+  ++A+  + I + D ND  P+ ++S Y  FI E++P GS+VIQ +A D D      + YSL Q    +   SF I+ + GW+ ++  +D+EE     + V ASD    V   +   + ++V DVND  P +T        EI +      +    V+  LS  D D+E     + + IT  +    +A   V     V +  PLD E+    L L   A+D    SK    + ++V+D ND++PVC +      I E   PG ++  + A D D  +    +TYTL   S      + P TG +   A LDRE  +  N +V A D   + C   I++ + D+NDNAP F   +  P+     EN   G+ + ++ A DAD+G+NRKI Y +++ +   FSI+  +GI+++   LDRE Q  + L ++A D G P +   T   +V +LD+ND+PP F        V+ED  IG  ++ + A S DI  NAE++Y +I+  E   F ++S +G + +I+ LD+E S EY+LTV A+D G PSLS    V I V D+NDN P F    Y   + E+  + +  I  + A D+D   NS + YS +      + N  S        F I+P  GE+ +    DRE    Y   V   D+G P   + T V I++ D NDN P F++ ++  +I          QE K  G  F V +L + DKD   N  PF   +++    + F     E+    +LL A ++   V+    L V+V D+G+P L     + + VI  S  PP I PL +    F  E   G    I ++   D+   +D L +      +L   + +  F + S  G +     LD G Y LNV VT+   +T   I + I  +T++M+     I+ +++ P                NI   R+ D++++    S                                             P   +DVL+ V   +      +  L+ +I +   D+ +I     +++F  +C     C    C   + V+  +   +     ++F++      + CLC    +G  C    + C   PC +   C  DP +   + C CP    G + + P    G+SS              I FTG  F+ + L E  N L M++    R     A +M  +       +++I++ G++    D  + P I   +S+  + DG+WH V L + G       +  +V+D +     +    ++  + +  +  G   ++  +     +   +     GC+  + LN Q+LP    P         V   +L++GC  +     C++  C+NGG+C            Y C+C   + G  CE+  + C  +PC++GG C+    GF C C    TG RCQ    C    +PC    TC +         AVC C    RG  CQ D+DEC   P  C+ G  +C N H  Y CNC+  YRG HCE
Sbjct:  452 VKVLGTNSNPPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVTYSIANLNHVPFVIDHFT-GTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCEGTI----PRDLGVGEQITTVSAIDADELQLVRYQIEAGN-ELDLFGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGENFATPLYINLTV--AASR----KPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFFDSYSVNTHTPQFGVTLPTGIEVKENLPVGANI--LFMNATDLDSG-FNGKLVYAISGGNDDSCFTI---DMETGVLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYFVEVS--EDKEVNSEIIQVEATDKDLGPSGHVTYAILTDTEKFSIDSMTGVVKIIQPLDREVQPVHYLKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGHFDVDKLSGAVRIVQQLDFEKKQLYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDTGRDGEIRYSIRDGS-GIGVFRIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFI-EVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLTYRITSGNPQGFFSIHPKTGLITTTSRKLDREQ-------QDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQK--FYKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYSIE-------EGNEHGRFSIEPKTG----VVSSKKF--SAAGEYDI----LSIKAVDNGRPQKSS------TTRLHI-EWISKPKPSSEPISFEESVFSFTVMESDPVAHMIG-VISVEPPGMPL--WFDIIGGNYDSHFDVDKGTGTIIVAKP--------------LDAEQKSSYNLTVEATDGTTTILTQ--VLIKVIDTNDHRPQF---STSKYEVAVPEDTEPEVEILQISA--------------------VDRDEKNKLIYTLQSSIDPASLKK-FRLDPATGALYTAEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYE---------------------------------------SAAVGSVVLQVTALDKDKGRNAEVLYSIESGNIG-NSFTIDPILGSIKTARELDRSHQVDYDLMVKATDKGDPPMSEMTSVRIAVTVAD----NASPKFTSKEYSAEISEAIRIGSFVGMVSAHSQSS-------VMYEIRDGNMGDAFNINPHSGSIITQRALDFETLP-MYSLTVQGTNMAGLSTN----TTVVVHVRDENDNPPVFT-QAEYSGFISESASVNSVV--------LTDRNVPLVIRATDADRESNALLVYQIVEPSVHNYFAIDPTTGAIRTVLSLDYEETHAF-HFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFSKSLYEVSLLLPTYRGVNVITVNATDADSKAFSQVMYSITEGNIGEKFSMDHKTGTIAIQN-----TTQLRSRYELTVRASDGRFTSMASVKINVKESRES---PLKFTQDAYSAVVKENSTEARTLAVITAIGNPLNEPLFYRILNPDRRFKISHTSGVLSTTGIPFDREQQETFDVVVEVTKEHEPSAVAHVVVKVTVEDQNDNAPVFVNLPYYAVVKVD-AEVGHVIRYVTAIDRDSGRNGDI---HYYLK--EHHDHFQI-GPSGDISLKKQFEHDTLNKEYLVTVVAKDGGSPAFSAEVLVPITVMNKAMPVFEKAFYSAEIPENIQMHSPVVHIQANSPEGLKVFYSITDGDPFSQFTINFNTG-------VVNVIAPLDFESHPAYKLSVRATDSLTGAHAEVFVDIIVEDINDNPPVFVQPSYSTTLSEASVIGTPVLQVRATDSDSEPNRGI--SYQLIGNHSK-SHDHFHIDSNTGLISLVRALDYEQSQQHRIFVRAVDGGMPALSSDVVVTVAVTDLNDNPPLFEQQVYEARISEHAAHGHFVMCVRACDADSSDLDKLEYSILSGNDHKSFIIDRETGIITLSNLRR-HTLKP---FYSLNVSVSDGVFRSSARVNVTVMGGNLHSPVFHQNEYEVELAENAPLHTLVVQVKASDRDSGIYSHVTYHIVNDFAKDRFYVNDRGQIFTLEK-LDRETPAEKVISIRLMAKDAGGKVAFCTVNVILTDDNDNAPQFRSTKYEVN-IGSSAAKGT---SVVKVFASDADEGSNADVTYAIEAD--SESVKENLEINKLTGLITTKESLI------GLEN--EFFTFFVRAVDSGSPPRESV------------VPVYIKILPPEVQLPRFSEPFYT---YTISEDTPIGTEIDLIRV---EHGGAVLYILVKGNTPESNRDEFFVIDRQNGRLKLEKSLDHETTKWYQFSILARCTLDDYEVVASIDVSIQVKDANDNSPVLESSPYEAFIVENLPGGSRVIQIRASDLDSGANGQVMYSLDQSQDADIIESFAINMETGWITTLKELDHEERASYQIKVVASDHGEKVQLSSTAIVGVTVTDVNDSPPRFTA-------EIYKGTVSEDDPPGGVIAILSTTDADTEEINRQVSYFITGGDALGQFAVENVQSDWRVYVKKPLDREQKDSYL-LTVTATDGTFSSKAR--VEVKVLDANDNSPVCEKTSYSDTIPEDALPGKLVMQVSATDADIRSNAE-ITYTLF-GSGAEKFKLNPDTGELRTLALLDREEQAVYNLLVKATDGGGRSCQAAIVLTLEDVNDNAPEF---TAEPYTITVFENTEPGTPLTRVQATDADTGLNRKISYSLVESADGQFSINERSGIIQLEKHLDRELQAVYTLTLKAVDQGLPRRLTATGTVVVSVLDINDNPPVFEYREYGASVSEDIVIGTEVLQVYAASRDIEANAEITYAIISGNEHGKFSIDSKTGAIFIIESLDYESSHEYYLTVEATDGGTPSLSDVATVNINVTDINDNSPVFSQDTYTTVVSEDAALEQPVI-TIMADDADGPSNSHIHYSII------EGNQGSP-------FTIDPVRGEVKVTKPLDRETISGYTLTVQAADNGNPPRVNTTTVNIDVSDVNDNAPLFSRDNYSVII----------QENKPVG--FSVLKLVVTDKDSSHNGPPFFFTIVSGNDENAF-----EVNQHGVLLTAATIKRKVKDHYLLHVKVADSGKPQLSSMTHIDIRVIEESIHPPAILPLEIFITAFGEEYSGGV---IGKIHATDQD-VYDTLMY------SLDPHM-DGLFSVSSTGGKLIAHRKLDIGQYLLNVSVTDGKFTTVADITVHIQQVTQEMLNHTVAIRFANLTPEEFVGDYWRNFQRALRNILGVRKNDIQIVSLQPS--------------------------------------------EPHSHLDVLLFV-ERSGGTHVSTKQLLHKINSSVTDVEEIIGVRILEVFQKLCAGLD-CPWKFCDEKVSVDENVMSTHSTAR-LSFVTPRHHRTAVCLCK---DGT-CPPVHHGCEDNPCPAGSECVADP-REEKYSCVCP---GGGFGKCP----GSSS--------------ITFTGNSFVKYRLLENENRLEMKLSMRLRTYSSHAVVMYARGTDYS--ILEIHT-GRLQYKFDCGSGPGIVSVQSIQ-VNDGQWHAVSLEVEG------NYAKLVLDEVHTASGTAPGALKTLNLDNYVFFGG--HLRQQGTKHGRGAQVASGFRGCMDSIYLNGQELPLNNKPRAYAHIEEWV---DLSHGCLLTATED-CSSSPCQNGGVC-----NPSPTGGYYCKCSALYVGTFCEVSVNPCSSNPCLYGGTCMVDNGGFVCQCRGLYTGQRCQLSPYCKD--DPCKNGGTCFDS-----LDGAVCQCDSGFRGERCQSDIDECAGNP--CRNG-ALCENTHGSYHCNCSQEYRGKHCE 4165          

HSP 2 Score: 247.669 bits (631), Expect = 2.459e-64
Identity = 441/1825 (24.16%), Postives = 747/1825 (40.93%), Query Frame = 3
Query: 6021 INAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERL----EIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTIL-FSILNG------KESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFD-GKFETSCNITINSFDNTRNKVLPLEKSQVVW--EIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSE--QPKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQP---ALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTG-HTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDP---SSSLSHSTTVLITVLDIN--------------------------DELPIFLKSSYSAS---------------VSENMPINHEIISISVL-LQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLD--TNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHX-----XXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDIND-----NIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDK--KKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYI-RAKKIMDFETQSQYRINVEYRVDNSPLMAT-RTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCK--------AYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDS----------ESQKESLHFLITNQNLNPFYAYFRVSE-SGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAP-VCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLV---VEPLTGRVIVNAPLDRE--FSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSI-APFLENAPHGSVIGKIHAVDADSGINRKIVYRILDES-KSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNF---FRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGK------VTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSK--TNVTIEIEDKNDNPPEFAQ 11135
            ++A D D G NG+  Y    R    F I   +GV+ L  ++D  +     +L I   D+G  KL     +    ++ + +E  N+C P       L    L   P+  ++ +   D   N  I   SI+ G      K  R F   P +   K+           P    + ++A D G       + +    + + +  P++    V+  EI E       +VL +A   +SH    ++Y+  S   +PK  +N  TG + +   + R+     +L V       S     V V V   N   P F    Y+  +  N    A   RV A+D D GENG V YSI  +      + F ID  +G ++       EL+ + +T+ I+A+D G P    +     + ++ ++D +PLF++      +P D      +TTV AI +     + Y I  GN+ +LF L+ ++  L     +   +G        FH+L I+ATD    ++ L  + TV  +   +N                          D   IF   SYS +               V EN+P+   I+ ++   L    N K+V +++    D S C    F I+  TG + +   LD E    +   I V   G         + V ++D NDN P+F+Q ++   +S +    S ++   ATD D   +  + Y +L +    F ID  +G ++  Q P   ++ P   V   ++   D             + V+   + ++PP F+   + + V E+    + I  + A D D  +  ++RY ++   +   F +D L+GA+ + + LD E+K ++ L V   D G     ++      ++ D     + PV   ++ E  V+     TG+   S++ + A D D      + Y +        +  +D  TG +        +++      +   L VY     V   PL S+          I V +++  + D   +   P+    IM   EN+P +  V        +      L    +  + Q  F I    G I    + +D E Q ++ + V    +  P  +T   +++ ++D+ND  P F    Y I + E           K        A DKD      + YS+ + +  E G  F I+ + G V S       E  ++++    + +    + T L I           W   P      I         +F   V+  +  ++D           E     L F I   N +   ++F V + +G +++  PLDAE+      L   A+D       + +  I+VID NDH P       ++ + E   P   I  + A DRD   + N L YTL    DP  L    ++P TG +     LD E      +  +V   DV  K+   +I++NV D ND+AP F   S      E+A  GSV+ ++ A+D D G N +++Y I   +  +SF+ID   G ++ A  LDR  Q ++ L+++A+D G PP S +T+V+I +   +++ P+F +      ++E   IG  +  + A S      + V Y+ I + N    F +   SG++   + LDFE    Y LTV+ ++     LST T V++ V D NDN P F    Y   I E+  V+ + +        + A D+D   N++L Y  +                + ++F I+P TG I      D EE   + F V V D G P   ++   NVT+ + D ND PP F++
Sbjct:  172 VSATDADIGTNGEFYYSFKDR-TDVFAIHPTSGVVVLTGRLDF-LETQLYELEILAADRGM-KLYGSSGVSSLAKLTVHVEQANECAPIITA-VTLSPSELDKDPTYAIITVEDCDQGANGEIASLSIVAGDLLQQFKTVRSF---PGSKAFKVKAVGAVDWDSHPYGYNLTLQAKDKGTPPQFSPVKVVHIISPQFRAGPVKFEMDVYRAEISEFAPPHTPVVLVKAIPSYSH----LRYVFKSAPGKPKFGLNHNTGLISILEPIRRQHTSHFELEVTTSDKRAS---ARVVVKVLGTNSNPPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVTYSIANLN----HVPFVIDHFTGTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDADELQLVRYQIEAGNELDLFGLNPSSGVLSLKHSLTDGLGA----KVSFHSLRITATDGENFATPLYINLTVAASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFF-DSYSVNTHTPQFGVTLPTGIEVKENLPVGANILFMNATDLDSGFNGKLV-YAISGGNDDS-C----FTIDMETGVLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYFVEVSEDKEVNSEIIQVEATDKDLGPSGHVTYAILTDTEK-FSIDSMTGVVKIIQ-PLDREVQP---VHYLKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGH-FDVDKLSGAVRIVQQLDFEKKQLYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVF-SSFVEKGVVKEDVPTGS---SVMTVSAHDEDTGRDGEIRYSIRDGS-GIGVFRIDEETGVIETSDRLDREST------SHYWLTVYATDQGVV--PLSSF----------IEVYIEVEDVNDNAPQTSEPVYYPEIM---ENSPKDVSVVQIEAFDPDSSSNDKLTYRITSGNPQGFFSIHPKTGLITTTSRKLDREQQDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKFYKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYSIEEGN--EHG-RFSIEPKTGVVSSKKFSAAGEYDILSIKAVDNGRPQKSSTTRLHIE----------WISKPKPSSEPI---------SFEESVFSFTVMESDPVAHMIGVISVEPPGMPLWFDIIGGNYD---SHFDVDKGTGTIIVAKPLDAEQ-KSSYNLTVEATDGTTTILTQVL--IKVIDTNDHRPQFSTSKYEVAVPEDTEPEVEILQISAVDRD---EKNKLIYTLQSSIDPASLKKFRLDPATGALYTAEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYESAAVGSVVLQVTALDKDKGRNAEVLYSIESGNIGNSFTIDPILGSIKTARELDRSHQVDYDLMVKATDKGDPPMSEMTSVRIAVTVADNASPKFTSKEYSAEISEAIRIGSFVGMVSAHS-----QSSVMYE-IRDGNMGDAFNINPHSGSIITQRALDFETLPMYSLTVQGTNMA--GLSTNTTVVVHVRDENDNPPVFTQAEYSGFISESASVNSVVLTDRNVPLVIRATDADRESNALLVYQIVE-------------PSVHNYFAIDPTTGAIRTVLSLDYEETHAFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFSK 1883          

HSP 3 Score: 230.335 bits (586), Expect = 4.590e-59
Identity = 447/1900 (23.53%), Postives = 772/1900 (40.63%), Query Frame = 3
Query: 5706 KPSTGK-LFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGK-FETSCNITINSFDNTRNKVLPLEKSQVVWEIPE---------NRNDVPDL----------------VLPRAKFYFSHQHPSIKYILLSEQPKVE---------------------INEITGSLKLKSALDRE--ERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKG--QPALSS--FTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS---STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDIND----ELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLD--TNSKLIYKVLN-EYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKN-HPPSFVMNEFHMSVSENFTVNSE--------IGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGK----WSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMAT-RTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDD-QGWVYSVSAVDYEETKLINLVVSASDKAGHVTN--TTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITT-------LQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKC----SFKILINVLDINDNAPRFVHT--SIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDES-KSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIK-KLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFL--NFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDK 11108
            K + GK  FG+  +TG I  +  + R   Q     +++V + D   S       V + +   N N P F         I E+A  G+ V                 ++A DPDEG+NG + Y I +     F ID +TG +S +  +D E++     L IR  D G P     E L   I + + ND  P FE+      +         +  +   D D    + + I  G E   F ++P++G L +  +     G   S   + I A DG+ F T   I +    + +   L  E++ V   + E         ++ DV D+                 LP          P    IL      ++                     I+  TG LK+ S LDRE  ++  + + V   G      +  + V+V D ND  P FL E Y   V  +    ++ I+V+A D D G +G V Y+I          KF+IDS +GV+ I     +E+    + + I+A D+   +P L S     V +D V+D  P F    YSV V ED  +  I+  ++A          + Y++ + + E  FD+D  +         +R+V +LD+E K  + L + A D    +S S+T  + V  ++       P+F        V E++P    ++++S   +       + +S++   D S      FRI+  TG I   + LD E+   +   +     G    ++   + + + D NDN P+  +P +   I   S +   VV   A D D  +N KL Y++ +      F I   +G I       +++      ++E  V  +           +  +  +N + P F+   + + + E    + +        + R++A+D D+     L Y +  G +   F ++  TG +  KK        +  ++ V  D G     +T  +H+  I+   P  E   +E              ES+      + D    H +    V PP    + F D I G         N +S+  ++     + V +      ++  Y+  +  T  + +I   V I ++ D     P  + S   +         V + +IS+ +   K    ++L  S  P  ++  F +D   G +   + +D E   Q+ + V  R  + P+      I++++ D+ND  P F +  Y   + E   +GS V+Q  A DKD +G++     LY ++S   G SF ID   G + +   +D       +L+V A+DK     +  T++ I+V   ++  P +T        EI+E     S  F  +V         S   + S+ + I + N+    A+     SG ++    LD E +  P+    +    +        + + V D ND+ PV  Q      I E  +  SV+ T       ++A D D  +    L Y ++E S      ++P TG +     LD E +   +F V   D+ + +     +  + ++V+DIND  P F  +   ++  L      +VI  ++A DADS    +++Y I + +    FS+D  TG + + +    + +  + L + ASD G+   +++ +VKI + +  +SP +F        V E++   + L  I AI + +  N  + Y+++     F++   SG L+      D E    + + V  + +  PS      V + V D NDN P F  LPY   +  +  V  + I  VTA D DSG N  +     Y+L E          H +H F+I P +G+I L   F  D   +  Y   V   D G PAFS++  V I + +K
Sbjct:  404 KSAPGKPKFGLNHNTGLISILEPIRR---QHTSHFELEVTTSDKRAS-----ARVVVKVLGTNSNPPEFT-QTSYKASIDENAPIGAAV---------------TRVSAMDPDEGENGYVTYSIANLNHVPFVIDHFTGTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVL-ATITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDADELQLVRYQIEAGNELDLFGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGENFATPLYINLTVAASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFFDSYSVNTHTPQFGVTLPTG-IEVKENLPVGANILFMNATDLDSGFNGKLVYAISGGNDDSCFTIDMETGVLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYFVEVSEDKEVNSEIIQVEATDKDLGPSGHVTYAI-----LTDTEKFSIDSMTGVVKIIQPLDREVQPVHY-LKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLD-HGEGHFDVDKLSG-------AVRIVQQLDFEKKQLYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDTGRDGEIRYSIR---DGSGIGV--FRIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLTYRITSGNPQGFFSIHPKTGLITTTSR-KLDREQQDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKFYKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYSIEEGNEHGRFSIEPKTGVVSSKKFSAAGEYDILSIKAV--DNGRPQKSSTTRLHIEWISKPKPSSEPISFE--------------ESVFSFTVMESD-PVAHMIGVISVEPP-GMPLWF-DIIGG---------NYDSHFDVDKGTGTIIVAK-PLDAEQKSSYNLTVEATDGTTTILTQVLIKVI-DTNDHRPQFSTSKYEVAVPEDTEPEVEILQISAVDRDEKNKLIYTLQSSIDPASLKK-FRLDPATGALYTAEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYESAAVGSVVLQVTALDKD-KGRNAEV--LYSIESGNIGNSFTIDPILGSIKTARELDRSHQVDYDLMVKATDKGDPPMSEMTSVRIAVTVADNASPKFTSKEY--SAEISEAIRIGS--FVGMV---------SAHSQSSVMYEIRDGNMGD--AFNINPHSGSIITQRALDFETL--PMYSLTVQGTNMAGLSTNTTVVVHVRDENDNPPVFTQAEYSGFISESASVNSVVLTDRNVPLVIRATDADRESN-ALLVYQIVEPSVHNYFAIDPTTGAIRTVLSLDYEETHAFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFSKSLYEVSLLLPTYRGVNVI-TVNATDADSKAFSQVMYSITEGNIGEKFSMDHKTGTIAIQNTT--QLRSRYELTVRASD-GR--FTSMASVKINVKESRESPLKFTQDAYSAVVKENSTEARTLAVITAIGNPL--NEPLFYRILNPDRRFKISHTSGVLSTTGIPFDREQQETFDVVVEVTKEHEPSAVAHVVVKVTVEDQNDNAPVFVNLPYYAVVKVDAEVGHV-IRYVTAIDRDSGRNGDIH----YYLKE----------HHDH-FQIGP-SGDISLKKQFEHDTLNK-EYLVTVVAKDGGSPAFSAEVLVPITVMNK 2179          

HSP 4 Score: 169.088 bits (427), Expect = 1.583e-40
Identity = 332/1388 (23.92%), Postives = 567/1388 (40.85%), Query Frame = 3
Query: 7308 ILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGK------LDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWIL-----VKYDGRFSPTNRAHMQVHIVDEND----------NPPKFIQPAFNATISLES-SQGSLVVIAMATDLDTNSKLIYKVLNEY--YNIFKIDQSSGFIRFNQVP---NIEKLLPSSGV-VEFQ--VLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMK------------GKWSLVPSSSPFDVQNDF------EIDSNYGYIRAKKIMDFET---------QSQYRINVEYRVDNSPLMATRTILI--DLIDQNDCPPIFDNS--------RYAIFISEDI------PLGSKVIQCKAYDKD--YEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYE--ETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRV-SESGEVLLLHPLDAEKILKPLQ-LKFLASDRLHWSKEEF---ILNIRVIDVNDHAP-VCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSI-APFL------ENAPHGSVIGKIHAVDADSGINRKIVYRILDESK-SSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLI-KKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPE-------NTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDK---NDNPPEFAQPSFRFLI 11156
            I Y I +G+ E LF  +    Y+    C +R+  K      L+ E +  +TLI+ A + ++       V + VLD ND  P+F  +SYS S+ EN  I   I  +S     +  +    +S K   D        F I+ T+G + +   LDF    ++E  IL     +K  G    ++ A + VH+   N+          +P +  +    A I++E   QG+   IA  + +  +    +K +  +     FK+ ++ G + ++  P   N+       G   +F    +VH  +              +  P  F M+ +   +SE    ++ +  + A  S    +  LRY          FGL+  TG + + + + R+  S  EL V  SD   K   A V++ V   N N P   Q  Y+ ++            ++ ++ A D D      + Y + +  L+     +D  TG VS      ++N +  L        VY +  +  +  L  YR    V++     T+ +N L D   +   I C     ++      I  +  I + E++              + L PSS    +++        ++  +   I A    +F T          S+  +N++        M    +L    L  Q D   IF +S        ++ + +   I      P+G+ ++   A D D  + GK V   S    DS      F ID + G +  +S +D E  +   +N+ V             L ++V D ND  P + +      +E++E  +  SE     + ++ A D D        + ++T+         F + S +G V ++ PLD E  ++P+  LK  A D+       F   +L + + DVND+ P   P    + + E +  G++I  L+AYD D   + + + Y+L++  + +   V+ L+G V +   LD E     N  V A D + K  S      V     +    +HT + + F+      E+ P GS +  + A D D+G + +I Y I D S    F ID +TG++  +  LDRE    + L + A+D G  P S+   V I + DVND+ PQ         + E++     ++ I+A   D   N +++Y++ +   Q FF +   +G +T   +KLD E   E+ L V  +D G P  ST   VI++++D NDN PQF    Y   +PE        +   +  + +V A D D G N+ L+YS    + E   + R         F I PKTG +         E       +   D+G P  SS T + IE   K   +  P  F +  F F +
Sbjct:   71 IRYKIVSGDSENLFKAE---EYVLGDFCFLRIRTKGGNTAILNREVRDHYTLIVKAVEKATDAEARAKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDV-------FAIHPTSGVVVLTGRLDFLETQLYELEILAADRGMKLYGSSGVSSLAKLTVHVEQANECAPIITAVTLSPSELDKDPTYAIITVEDCDQGANGEIASLSIVAGDLLQQFKTVRSFPGSKAFKV-KAVGAVDWDSHPYGYNLTLQAKDKGTPPQFSPVKVVHIIS-----------PQFRAGPVKFEMDVYRAEISEFAPPHTPVVLVKAIPS----YSHLRYVFKSAPGKPKFGLNHNTGLISILEPIRRQHTSHFELEVTTSD---KRASARVVVKVLGTNSNPPEFTQTSYKASI----DENAPIGAAVTRVSAMDPDEGENGYVTYSIAN--LNHVPFVIDHFTGTVS-----TSENLDYEL-----MPRVYTLRIRASDWGL-PYRREVEVLA-----TITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDADELQLVRYQIEAGNELDLFGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGENFATPLYINLTVAASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFFDSYSVNTHTPQFGVTLPTGIEVKENLPVGANILFMNATDLDSGFNGKLVYAISGGNDDSC-----FTIDMETGVLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYF--VEVSEDKEVNSE-----IIQVEATDKDLGPSGHVTYAILTDTE------KFSIDSMTGVVKIIQPLDRE--VQPVHYLKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPD-VGQSSQVRYSLLDHGEGH-FDVDKLSGAVRIVQQLDFEKKQLYNLTVRAKD-KGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDTGRDGEIRYSIRDGSGIGVFRIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLTYRITSGNPQGFFSIHPKTGLITTTSRKLDREQQDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKFYKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYS----IEEGNEHGR---------FSIEPKTGVVSSKKFSAAGEYDI--LSIKAVDNGRPQKSSTTRLHIEWISKPKPSSEPISFEESVFSFTV 1369          

HSP 5 Score: 154.451 bits (389), Expect = 3.687e-36
Identity = 244/1050 (23.24%), Postives = 419/1050 (39.90%), Query Frame = 3
Query: 5724 LFGVTRSTGCIITVSSLDREQIQ----DIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIE--YVILSRFASYFK-IDQYTGVLSLALK----IDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPS--IKYIL--LSEQPKVEINEITGSLKLKSALDREERPFV-QLLVLAKGWDGSYDY---INVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKK--FTIGIKANDKGQPALSSFTDVFVDIVSDKSPL---------------------------------FDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILY----------------TITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVL-ITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPT--NRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHD------FTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYG--NKHDFATVLIHVTDINDNIP-VIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVS 8621
            +F +  ++G ++    LD  + Q    +I++ D  ++ Y    S  +S+  + +H+   N+ AP          I + + +P           +L K     +I  ED D+G NG+I    ++       FK +  + G  +  +K    +D +      +L+++ +DKG+P   S  ++ + II       P KFE D Y   +     P  P++ ++      +   +F    GK    F ++  TG + I     P+  +  S   + +   D +   S  + +       N   P E +Q  ++   + N      + R       +  +  + Y +  L+  P V I+  TG++     LD E  P V  L + A  W   Y     +  T+++ + ND  P+F     E  +  +L    Q   V AID D  E   V Y I        DL F ++ +SGV++++   +  L  K    ++ I A D    A   + ++ V   + + P+                                 FD    +   P+  +       VK     G  IL+                 I+ GND+  F +D           V++++  LD E    +TL I+  D       +  +L +TVLD ND  P FL+ SY   VSE+  +N EII +    + +  S  V +++          ++ F I+  TG + I + LD E   +H   I  +      P   +   ++V + D NDNPP+FI P ++  +  +  +G++++   A D D   +S++ Y +L+     F +D+ SG +R  Q  + EK      +    V   D       + +    V V  V+   H P F        V E+    S +  + A D D  + G +RY +  G    +F +D  TG +     LDRE  S + L V  +D G      F  V I V D+NDN P   E  YY   +  S K       S++Q+ A D D S   ++ YR+ S
Sbjct:  195 VFAIHPTSGVVVLTGRLDFLETQLYELEILAADRGMKLYGS--SGVSSLAKLTVHVEQANECAPI---------ITAVTLSPS----------ELDKDPTYAIITVEDCDQGANGEIASLSIVAGDLLQQFKTVRSFPGSKAFKVKAVGAVDWDSHPYGYNLTLQAKDKGTPPQFSPVKV-VHIISPQFRAGPVKFEMDVYRAEISEFAPPHTPVVLVKAIPSYSHLRYVFKSAPGKPK--FGLNHNTGLISILE---PIRRQHTSHFELEVTTSDKR--ASARVVVKVLGTNSN---PPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVTYSIANLNHVPFV-IDHFTGTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDAD--ELQLVRYQIEAGNEL--DL-FGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGENFATPLYINLTV--AASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFFDSYSVNTHTPQFGVTLPTGIEVKENLPVGANILFMNATDLDSGFNGKLVYAISGGNDDSCFTIDMETG-------VLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYFVEVSEDKEVNSEIIQVEATDKDLGPSGHVTYAIL-------TDTEKFSIDSMTGVVKIIQPLDREVQPVHYLKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGHFDVDKLSGAVRIVQQLDFEK----KQLYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDTGRDGEIRYSIRDGSGIGVFRIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDV-----SVVQIEAFDPDSSSNDKLTYRITS 1181          

HSP 6 Score: 132.494 bits (332), Expect = 1.777e-29
Identity = 171/676 (25.30%), Postives = 284/676 (42.01%), Query Frame = 3
Query: 1557 TKKTFT----LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDI-SRTKISYYLFDQNKLPFRL----GEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGL---VSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRF-LDSFQIPMTLPENYDIKKRIVQIKATDADS---KDIQYRLV--NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRY--AIHGIHSDCFHCDTSTGAVHLLCKLSPLTEYRLIAV-VKDNGKPQALS-SQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRINNEG 3518
            T  TF+    + + V D N+  PV        T+ E+   G+ V+ + A D DI S  +I+Y LF      F+L    GE +   ++ +E       Q  + + V  TD G    RS  A   + + DVN+  PEF  +   IT+         +    A D D      I  S+   +  Q  FSI+  SG + L    KH        +T+ L+A D GL   +++   +  SV+D N                                       N P+F  R              + E+   GT V ++   + D + +   +E  + + S  E   FSI   DS +  I + + LD E+  +Y++T+   D G P         I V DINDN P F  D++     + E+  +++ ++ I A DAD      I Y ++  N    F I    G +++   LDRE    Y + + A+D    N     T T+ I V+D+NDN P+F++++YS+ + E+ P+G  +++L  TD D   N    +   + G   + F  +     +        + ++ L+ V V D+GKPQ  S +  D ++  + +HP   +P   E  ITA   E    G ++  I     D    + +Y++  H +G  LF +++ G
Sbjct: 3001 TDGTFSSKARVEVKVLDANDNSPVCEKTSYSDTIPEDALPGKLVMQVSATDADIRSNAEITYTLFGSGAEKFKLNPDTGELRTLALLDREE------QAVYNLLVKATDGGG---RSCQAAIVLTLEDVNDNAPEFTAEPYTITVFENTEPGTPLTRVQATDADTGLNRKISYSLVESADGQ--FSINERSGIIQLE---KHLDRELQAVYTLTLKAVDQGLPRRLTATGTVVVSVLDIN--------------------------------------DNPPVFEYREYG---------ASVSEDIVIGTEVLQVYAASRDIEAN---AEITYAIISGNEHGKFSI---DSKTGAIFIIESLDYESSHEYYLTVEATDGGTPSLSDVATVNINVTDINDNSPVFSQDTYT--TVVSEDAALEQPVITIMADDADGPSNSHIHYSIIEGNQGSPFTIDPVRGEVKVTKPLDRETISGYTLTVQAADNG--NPPRVNTTTVNIDVSDVNDNAPLFSRDNYSVIIQENKPVGFSVLKLVVTDKDSSHNGPPFFFTIVSGNDENAFEVNQHGVLLTAATIKRKVKDHYLLHVKVADSGKPQLSSMTHIDIRVIEESIHPPAILP--LEIFITAFGEE--YSGGVIGKIHATDQDVY-DTLMYSLDPHMDG--LFSVSSTG 3598          

HSP 7 Score: 102.449 bits (254), Expect = 1.785e-20
Identity = 76/213 (35.68%), Postives = 115/213 (53.99%), Query Frame = 3
Query:  231 ISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTKY--TASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFY-YLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRG 860
            I FT   YNV ++++   + YV H   +MGI   +   +I YKI  S +  N F+AE  ++GDF +LRIRTK   TA LNRE    Y L ++ +   K+T   +   + +V ++VLD ND  P+F   ++     EN +I T I  V+ATDAD G N E +Y + D++ +        F+I+P SG++    +L DF+       +I A  RG
Sbjct:   33 IQFTHFQYNVTVHENSAAKTYVGH-PRKMGIYILDPSWEIRYKIV-SGDSENLFKAEEYVLGDFCFLRIRTKGGNTAILNREVRDHYTLIVKAV--EKAT---DAEARAKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDV--------FAIHPTSGVVVLTGRL-DFLETQLYELEILAADRG 229          

HSP 8 Score: 96.6709 bits (239), Expect = 1.107e-18
Identity = 142/583 (24.36%), Postives = 250/583 (42.88%), Query Frame = 3
Query: 6771 LDREERPFVQLLVLA--KGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQ--------PALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKD--FIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPF-HTLIISATDPSSSLSHSTTVLITVLDINDEL-PI-FLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLV--VIAMATDLDTNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHD----FTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLD---RERKSMHELRVVVSDYGNKHDFATVL 8447
            L+RE R    L+V A  K  D       V V V D ND +P+F    Y   +  N +      RV A D D G NG   YS            FAI   SGV+ + +G    L  + + + I A D+G          +L+  T V V+  ++ +P+      S   P +  KD  + + TV+      +  + +++    + L       ++       ++ VG +D+++ P+ + L + A D  +    S   ++ ++       P+ F    Y A +SE  P +  +    VL++ + +   + +  K    S+P   + F +N  TG ISI E +  +     E  +    D R S    A + V ++  N NPP+F Q ++ A+I   +  G+ V  V AM  D   N  + Y + N  +  F ID  +G +  ++  + E L+P   V   ++   D    +   V    ++   ++ ++ P F       ++  +  V  +I  + A D+D+ +   +RY +  G + ++FGL+  +G L LK +L      + S H LR+  +D  N   FAT L
Sbjct:  109 LNREVRDHYTLIVKAVEKATDAEA-RAKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDV-----FAIHPTSGVVVL-TGRLDFLETQLYELEILAADRGMKLYGSSGVSSLAKLT-VHVEQANECAPIITAVTLS---PSELDKDPTYAIITVEDCDQGANGEIASLSIVAGDLLQQFKTVRSFPGSKAFKVKAVGAVDWDSHPYGYNLTLQAKDKGTPPQFSPVKVVHIISPQFRAGPVKFEMDVYRAEISEFAPPHTPV----VLVKAIPSYSHLRYVFK----SAPGKPK-FGLNHNTGLISILEPIRRQHTSHFELEVTTS-DKRAS----ARVVVKVLGTNSNPPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVTYSIANLNHVPFVIDHFTGTVSTSENLDYE-LMPR--VYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDADELQL--VRYQIEAGNELDLFGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGEN---FATPL 658          

HSP 9 Score: 90.5077 bits (223), Expect = 7.712e-17
Identity = 192/819 (23.44%), Postives = 325/819 (39.68%), Query Frame = 3
Query: 1566 TFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISR-TKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNE--YKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDN-IQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLV--SSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADR-LDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPE------NYDIKKR--IVQIKATDAD---SKDIQYRL--VNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPI-FTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDC-FHCDTSTGAVHLLCKLSP--LTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISL--FRIN-NEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVP 3941
            T  L++S+ DVN+ PP  +     + V+E+   G  ++ ++AYDPD+ + +++ Y L D  +  F + +    V IV++ LD E  Q  + + V   D G P++ S   + E+E+ DVNE  + P F     +  +    P    +    A D D  GRD  I+ SI   S     F I  E+G +    T         +++ + + A D G+V  SS + +   V D N                                 +N  ++++P++                 I E S K   V +I     D   +    +  + + S   Q  FSI      +  I    R LDRE  D++ + + V D G P      R  +++ D NDN P+FL  F   + LPE      +    KR  + ++ A D D   + ++ Y +   N    F I  +TG +  +        +Y  + I A D     +S T    +  I      ++PI F ++ +S  + E  P+   +  +      +     L + I G + D  F  D  TG + +   L     + Y L     D G    L+     Q+  + +  N + P         A+ E+  P   +  I     D E    +YT+    +  SL  FR++   G + T   +D E    + L + + D+ D  + +  A + + V+D+ND+ P      Y   V E+      ++ V A D D  +  E+ Y I SG+    F+I        + R +DR       +    YDL V  +D G P
Sbjct:  911 TVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGHFDVDKLSGAVRIVQQ-LDFEKKQ-LYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDT-GRDGEIRYSIRDGS-GIGVFRIDEETGVIE---TSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVN---------------------------------DNAPQTSEPVY--------------YPEIMENSPKDVSVVQIEAFDPDSSSN---DKLTYRITSGNPQGFFSI---HPKTGLITTTSRKLDREQQDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKF-YKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYSIEEGNEHGRFSIEPKTGVVSSKKF--SAAGEYDILSIKAVDNGRPQKSSTTRLHIEWISKPKPSSEPISFEESVFSFTVMESDPVAHMIGVISVEPPGM----PLWFDIIGGNYDSHFDVDKGTGTIIVAKPLDAEQKSSYNLTVEATD-GTTTILT-----QVLIKVIDTNDHRPQFSTSKYEVAVPEDTEPEVEILQISAVDRD-EKNKLIYTLQSSIDPASLKKFRLDPATGALYTAEKLDHEAIHQHVLTVMVRDQ-DVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYESAAVGSVVLQVTALDKDKGRNAEVLYSIESGNIGNSFTIDPILGSIKTARELDR-------SHQVDYDLMVKATDKGDP 1647          

HSP 10 Score: 82.4185 bits (202), Expect = 1.967e-14
Identity = 112/452 (24.78%), Postives = 186/452 (41.15%), Query Frame = 3
Query: 1566 TFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDI-SRTKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKD-IQYRL-VNFRRVFKIHSRTGWLRLRVNLD 2912
            T T+ +SV D+N+ PPV        +V E+  IG  VL + A   DI +  +I+Y +   N+      + K   + + E+LD E+    +++ V  TD G P + S +A   I + D+N+  P F   T    +S  A  +  +   +A+D D     +I  SI   +   P F+I P  G + +        +S    +T+ +QA D                      +G P +++    +I V       S +N                N P+F+ +  SVI I+E    G  V K+ +   DKD       F F + S  ++  F +   + H   ++ A  + R+  D Y + + V D G+P+       +I+V + + +PP  L          E Y     I +I ATD D  D + Y L  +   +F + S  G L     LD
Sbjct: 3215 TGTVVVSVLDINDNPPVFEYREYGASVSEDIVIGTEVLQVYAASRDIEANAEITYAIISGNEHGKFSIDSKTGAIFIIESLDYES-SHEYYLTVEATDGGTP-SLSDVATVNINVTDINDNSPVFSQDTYTTVVSEDAALEQPVITIMADDADGPSNSHIHYSIIEGNQGSP-FTIDPVRGEVKVTKPLDRETIS---GYTLTVQAAD----------------------NGNPPRVNTTTVNIDV-------SDVND---------------NAPLFSRDNYSVI-IQENKPVGFSVLKLVV--TDKDSSHNGPPFFFTIVSGNDENAFEV---NQHGV-LLTAATIKRKVKDHYLLHVKVADSGKPQLSSMTHIDIRVIEESIHPPAILPLEIFITAFGEEYS-GGVIGKIHATDQDVYDTLMYSLDPHMDGLFSVSSTGGKLIAHRKLD 3608          

HSP 11 Score: 68.1662 bits (165), Expect = 4.270e-10
Identity = 127/532 (23.87%), Postives = 227/532 (42.67%), Query Frame = 3
Query:  459 LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVK-YLSKYFDPDFNDYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNV---FLTPTGELNRYVLKLRAIFSPISTPAISVTIEAKDLSLNPKTSSTHLTIPLGNLRNIN----LLSVPEFVSVSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLE-GTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPD-ISRTKISYYLFDQNK-LPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLD 2021
            L+RE+   Y LT+     + + G F  S K +V +KVLD NDN P+    ++     E+A     +  V+ATDAD   N+EI Y L  S          F +NP +G +  +  L D    +  +  + A   G  S   C       L       N +AP+ + + Y    F+      P   +  TD D  LNR +  Y ++     +  +N     +     L+R   +L+A+++        +T++A D  L  + ++T   +   ++ +IN    +    E+   S+ E+ ++ + V  L+ +  S ++    ++ +  I   E G +S++      +G + + + L+ E   S E  LT+      +       T+ I+V D+N+  PV   +     V E+  + + V+ I A D D  S + I Y + + N+  PF +   +  V + K  LD ET+   + + V   D+G P  R       I+++DVN+  P F      + I    P    +   +  D D
Sbjct: 2986 LDREQKDSYLLTV-----TATDGTF--SSKARVEVKVLDANDNSPVCEKTSYSDTIPEDALPGKLVMQVSATDADIRSNAEITYTLFGSGAEK------FKLNPDTGELRTL-ALLDREEQAVYNLLVKATDGGGRS---CQAAIVLTLEDV----NDNAPEFTAEPYTITVFENTEPGTPLTRVQATDADTGLNR-KISYSLVESADGQFSINERSGIIQLEKHLDR---ELQAVYT--------LTLKAVDQGLPRRLTATGTVVV--SVLDINDNPPVFEYREY-GASVSEDIVIGTEV--LQVYAASRDIEANAEITYAIISGNEHGKFSID----SKTGAIFIIESLDYE--SSHEYYLTVEATDGGTPSLSDVATVNINVTDINDNSPVFSQDTYTTVVSEDAALEQPVITIMADDADGPSNSHIHYSIIEGNQGSPFTIDPVRGEVKVTKP-LDRETIS-GYTLTVQAADNGNP-PRVNTTTVNIDVSDVNDNAPLFSRDNYSVIIQENKPVGFSVLKLVVTDKD 3470          

HSP 12 Score: 67.3958 bits (163), Expect = 7.357e-10
Identity = 74/293 (25.26%), Postives = 125/293 (42.66%), Query Frame = 3
Query: 2721 PPRFLDSFQIPMTLPENYDIKK-----RIVQIKATDADSKDIQYRLVN------FRRVFKIHSRTGWLRLRVN------LDREKRDYYPIVIVASD--VDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRINNEGEIRTVS 3536
            PP     FQ  +T+ EN   K      R + I   D  S +I+Y++V+      F+    +     +LR+R        L+RE RD+Y +++ A +   D   R+          V D ND +P+F+  SYS++LPE+  I + + ++ ATDAD+  N +  Y+     +D F    ++G V L  +L  L    Y L  +  D G                K++ +  + SL +  +       C P     ++ P   DK+P   + T+     G +       GEI ++S
Sbjct:   31 PPIQFTHFQYNVTVHENSAAKTYVGHPRKMGIYILDP-SWEIRYKIVSGDSENLFKAEEYVLGDFCFLRIRTKGGNTAILNREVRDHYTLIVKAVEKATDAEARAKVRVQ-----VLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKD-RTDVFAIHPTSGVVVLTGRLDFLETQLYELEILAADRG---------------MKLYGSSGVSSLAKLTVHVEQANECAPIITAVTLSPSELDKDPTYAIITVEDCDQGAN-------GEIASLS 294          

HSP 13 Score: 65.0846 bits (157), Expect = 3.732e-9
Identity = 53/146 (36.30%), Postives = 69/146 (47.26%), Query Frame = 3
Query:  360 IRDSSEI----FNTFEAESKLVGDFFYLRIRTKYTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGII 785
            IR ++EI    F +   + KL  D   LR      A L+RE    YNL +      K+T     SC+  +V+ + D NDN P F  E +     EN    T +  V ATDAD G+N +I Y L +SA         FSIN  SGII
Sbjct: 3054 IRSNAEITYTLFGSGAEKFKLNPDTGELRT----LALLDREEQAVYNLLV------KATDGGGRSCQAAIVLTLEDVNDNAPEFTAEPYTITVFENTEPGTPLTRVQATDADTGLNRKISYSLVESA------DGQFSINERSGII 3183          

HSP 14 Score: 54.299 bits (129), Expect = 6.857e-6
Identity = 38/115 (33.04%), Postives = 62/115 (53.91%), Query Frame = 3
Query:  459 LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKL 803
            L+ E+   YNLT++    +       T+  TQV+IKV+D ND+ P F    +E    E+     +I  ++A D DE   +++ Y L QS+I   S+K  F ++P +G +Y  +KL
Sbjct: 1419 LDAEQKSSYNLTVEATDGT-------TTILTQVLIKVIDTNDHRPQFSTSKYEVAVPEDTEPEVEILQISAVDRDE--KNKLIYTL-QSSIDPASLK-KFRLDPATGALYTAEKL 1522          
BLAST of Ft-2 vs. Ensembl Mouse
Match: Fat1 (FAT atypical cadherin 1 [Source:MGI Symbol;Acc:MGI:109168])

HSP 1 Score: 1053.51 bits (2723), Expect = 0.000e+0
Identity = 1085/4101 (26.46%), Postives = 1827/4101 (44.55%), Query Frame = 3
Query: 1581 ISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDI--YVPHQTTRDSTINHPNNYEESNKPIFGMR-NIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXX-XXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSEND-----KSKLYLAYLPSDSINIVYDECIGSELLSIPVVDQLDPKGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNK----RATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPP--RINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPST-GKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILS-RFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNP--TILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKS-ALDREERPFVQLLV-LAKGWDGSYDYINVTVSVT-DENDYKPMFLSEKYEFLVHTNLSKEAQSIR-VKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVLN-EYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRE--RKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIA---FVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKV----NPIITCSIMTIQENNPLNHIVAMCRISSTEMKGK--WSLVPSSSPFDVQND-FEIDSNYGYIRAKKIMDFETQSQYRINVEYR--VDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHV---TNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPF----LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIV-LLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRT---LWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKP----------------NIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGARNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHCE 13637
            + V   N  PP         ++ EN  IG  V  + A DPD      ++Y + + N +PF +  F    V   ENLD E M R + +R+  +D G P  R V     I + ++N+  P F    C+ TI    P DL +G  I     +D D    ++  I + + +   F ++P SG LSL  +   G+ +K++  ++ + A D    ++ + +N +V  A SR    +P+ L C +  +   +  +  + + ++   + E+     + +  + P F   +P+ I ++E    G  +  + M   D D   +  + V+ +    +   F+I   D  +  + V   LDRE +DKY + I V D G P+   ++  ++ V D NDN P FL +S+ + ++  E+ ++   I+Q++ATD D   S  + Y ++     F I S TG +++   LDRE +  + + I A D       L +T  L + + D+NDN P F   +YS+ + EDLP G+ ++ L A D D+  +SQ+RY++       F  D  +GAV ++ +L    +  Y L    KD GKP +LSS    ++    V+ N + P     +    ++E+   G+ V ++     D      + Y+I   S GI +FRI+ E G I T   +DRE    YWL +Y  D+    ++  + EVYI+V D NDN P      Y   + EN      ++ ++A D D +   +L Y+I SG+  G+FSI   TG I+T+ R +DRE         D + L+V ++D+GVP +     + V I+D NDN P F+    F   R    E  +  R  +    + RV A D D   NA + Y+++         +    FS++ K+G     +SS  F  S  G   I    +++ A D G P   +      T RL++ E  + PK  ++     +S      + SD +  +    I  E   +P+    D  G + +   D   G  ++I AK                D+       +T+E T   T    Q  V I +   N + P F   S+   ++ + + T+P   I  + A                     + D    +IY++ +S DP +++K F ++   G L      +  +     + V  R++    +  + ++ +++ D N+  P F        +Y                                         +++G+++  ++A D+D GRN +++++I++ ++  N F +D   G I+  R L         L +  +D G PP   +    +AV + D    ++ P+    +    + E   + S +  +   S +        V+  I+    G  F +   +G IIT  +LD E +  + S+ +Q  +  GL +      +V +H+ D NDN P F    + +G ISESA+  S+V        L+     LVI A D D   N  + Y I+     +YF ID  TG +   L +D E   +F   ++++ D G+P+L ++    + + + D NDCPP F K  Y   L+LPT+    ++ +   D D      +++SI  G     FS+D  TG + I       + +  S   + +RA DG+F +  ++ IN  ++  +   PL+ +Q  +      N      L       +  +  + Y +L+   + +I+  +G L       DRE++    ++V + K  + S     V      D+ND  P+F++  Y  +V  + ++    IR V AID D+G NG +    YY+K   +   F I   SG I+++     + L K++ + + A D G PA S+   V + +++   P+F+K+ YS  +PE+      V  ++A S  G  + Y+IT+G+    F ++F          V+ ++  LD+E+ P + L + ATD  +       V I V DIND  P+F++ SYS ++SE   I   ++ +         ++ +  S +LI + S  S  HF I+  TG IS+   LD+E    H  ++     G  + ++   + V + D NDNPP F Q  + A IS  ++ G  V+   A D D++   KL Y +L+   +  F ID+ +G I  + +     L P        V V D      A V+V  +    H P F  NE+ + ++EN  +++ + ++ ASD D   +  + YH++  F  + F ++       L+K LDRE   + +  +R++  D G K  F TV + +TD NDN P      YEV  I S+ + GT   S++++ A D D      + Y + +   S+S+     ++ +TG ++ K S I      GL N       +  A      P  S             V V I IL  + ++     P  T    TI E+ P+   + + R+   E  G   + LV  ++P   +++ F ID   G ++ +K +D ET   Y+ ++  R  +D+  ++A+  + I + D ND  P+ ++S Y  FI E++P GS+VIQ +A D D      + YSL Q    +   SF I+ + GW+ ++  +D+EE     + V ASD    V   +   + ++V DVND  P +T        EI +      +    V+  LS  D D+E     + + IT  +    +A   V     V +  PLD E+    L L   A+D    SK    + ++V+D ND++PVC +      I E   PG ++  + A D D  +    +TYTL   S      + P TG +   A LDRE  +  N +V A D   + C   I++ + D+NDNAP F   +  P+     EN   G+ + ++ A DAD+G+NRKI Y +++ +   FSI+  +GI+++   LDRE Q  + L ++A D G P +   T   +V +LD+ND+PP F        V+ED  IG  ++ + A S DI  NAE++Y +I+  E   F ++S +G + +I+ LD+E S EY+LTV A+D G PSLS    V I V D+NDN P F    Y   + E+  + +  I  + A D+D   NS + YS +      + N  S        F I+P  GE+ +    DRE    Y   V   D+G P   + T V I++ D NDN P F++ ++  +I          QE K  G  F V +L + DKD   N  PF   +++    + F     E+    +LL A ++   V+    L V+V D+G+P L     + + VI  S  PP I PL +    F  E   G    I ++   D+   +D L +      +L   + +  F + S  G +     LD G Y LNV VT+   +T   I + I  +T++M+     I+ +++ P                NI   R+ D++++    S                                             P   +DVL+ V   +      +  L+ +I +   D+ +I     +++F  +C     C    C   + V+  +   +     ++F++      + CLC    +G  C    + C   PC +   C  DP +   + C CP    G + + P    G+SS              I FTG  F+ + L E  N L M++    R     A +M  +       +++I++ G++    D  + P I   +S+  + DG+WH V L + G       +  +V+D +     +    ++  + +  +  G   ++  +     +   +     GC+  + LN Q+LP    P         V   +L++GC  +     C++  C+NGG+C            Y C+C   + G  CE+  + C  +PC++GG C+    GF C C    TG RCQ    C    +PC    TC +         AVC C    RG  CQ D+DEC   P  C+ G  +C N H  Y CNC+  YRG HCE
Sbjct:  452 VKVLGTNSNPPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVTYSIANLNHVPFVIDHFT-GTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCEGTI----PRDLGVGEQITTVSAIDADELQLVRYQIEAGN-ELDLFGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGENFATPLYINLTV--AASR----KPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFFDSYSVNTHTPQFGVTLPTGIEVKENLPVGANI--LFMNATDLDSG-FNGKLVYAISGGNDDSCFTI---DMETGVLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYFVEVS--EDKEVNSEIIQVEATDKDLGPSGHVTYAILTDTEKFSIDSMTGVVKIIQPLDREVQPVHYLKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGHFDVDKLSGAVRIVQQLDFEKKQLYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDTGRDGEIRYSIRDGS-GIGVFRIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFI-EVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLTYRITSGNPQGFFSIHPKTGLITTTSRKLDREQ-------QDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQK--FYKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYSIE-------EGNEHGRFSIEPKTG----VVSSKKF--SAAGEYDI----LSIKAVDNGRPQKSS------TTRLHI-EWISKPKPSSEPISFEESVFSFTVMESDPVAHMIG-VISVEPPGMPL--WFDIIGGNYDSHFDVDKGTGTIIVAKP--------------LDAEQKSSYNLTVEATDGTTTILTQ--VLIKVIDTNDHRPQF---STSKYEVAVPEDTEPEVEILQISA--------------------VDRDEKNKLIYTLQSSIDPASLKK-FRLDPATGALYTAEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYE---------------------------------------SAAVGSVVLQVTALDKDKGRNAEVLYSIESGNIG-NSFTIDPILGSIKTARELDRSHQVDYDLMVKATDKGDPPMSEMTSVRIAVTVAD----NASPKFTSKEYSAEISEAIRIGSFVGMVSAHSQSS-------VMYEIRDGNMGDAFNINPHSGSIITQRALDFETLP-MYSLTVQGTNMAGLSTN----TTVVVHVRDENDNPPVFT-QAEYSGFISESASVNSVV--------LTDRNVPLVIRATDADRESNALLVYQIVEPSVHNYFAIDPTTGAIRTVLSLDYEETHAF-HFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFSKSLYEVSLLLPTYRGVNVITVNATDADSKAFSQVMYSITEGNIGEKFSMDHKTGTIAIQN-----TTQLRSRYELTVRASDGRFTSMASVKINVKESRES---PLKFTQDAYSAVVKENSTEARTLAVITAIGNPLNEPLFYRILNPDRRFKISHTSGVLSTTGIPFDREQQETFDVVVEVTKEHEPSAVAHVVVKVTVEDQNDNAPVFVNLPYYAVVKVD-AEVGHVIRYVTAIDRDSGRNGDI---HYYLK--EHHDHFQI-GPSGDISLKKQFEHDTLNKEYLVTVVAKDGGSPAFSAEVLVPITVMNKAMPVFEKAFYSAEIPENIQMHSPVVHIQANSPEGLKVFYSITDGDPFSQFTINFNTG-------VVNVIAPLDFESHPAYKLSVRATDSLTGAHAEVFVDIIVEDINDNPPVFVQPSYSTTLSEASVIGTPVLQVRATDSDSEPNRGI--SYQLIGNHSK-SHDHFHIDSNTGLISLVRALDYEQSQQHRIFVRAVDGGMPALSSDVVVTVAVTDLNDNPPLFEQQVYEARISEHAAHGHFVMCVRACDADSSDLDKLEYSILSGNDHKSFIIDRETGIITLSNLRR-HTLKP---FYSLNVSVSDGVFRSSARVNVTVMGGNLHSPVFHQNEYEVELAENAPLHTLVVQVKASDRDSGIYSHVTYHIVNDFAKDRFYVNDRGQIFTLEK-LDRETPAEKVISIRLMAKDAGGKVAFCTVNVILTDDNDNAPQFRSTKYEVN-IGSSAAKGT---SVVKVFASDADEGSNADVTYAIEAD--SESVKENLEINKLTGLITTKESLI------GLEN--EFFTFFVRAVDSGSPPRESV------------VPVYIKILPPEVQLPRFSEPFYT---YTISEDTPIGTEIDLIRV---EHGGAVLYILVKGNTPESNRDEFFVIDRQNGRLKLEKSLDHETTKWYQFSILARCTLDDYEVVASIDVSIQVKDANDNSPVLESSPYEAFIVENLPGGSRVIQIRASDLDSGANGQVMYSLDQSQDADIIESFAINMETGWITTLKELDHEERASYQIKVVASDHGEKVQLSSTAIVGVTVTDVNDSPPRFTA-------EIYKGTVSEDDPPGGVIAILSTTDADTEEINRQVSYFITGGDALGQFAVENVQSDWRVYVKKPLDREQKDSYL-LTVTATDGTFSSKAR--VEVKVLDANDNSPVCEKTSYSDTIPEDALPGKLVMQVSATDADIRSNAE-ITYTLF-GSGAEKFKLNPDTGELRTLALLDREEQAVYNLLVKATDGGGRSCQAAIVLTLEDVNDNAPEF---TAEPYTITVFENTEPGTPLTRVQATDADTGLNRKISYSLVESADGQFSINERSGIIQLEKHLDRELQAVYTLTLKAVDQGLPRRLTATGTVVVSVLDINDNPPVFEYREYGASVSEDIVIGTEVLQVYAASRDIEANAEITYAIISGNEHGKFSIDSKTGAIFIIESLDYESSHEYYLTVEATDGGTPSLSDVATVNINVTDINDNSPVFSQDTYTTVVSEDAALEQPVI-TIMADDADGPSNSHIHYSII------EGNQGSP-------FTIDPVRGEVKVTKPLDRETISGYTLTVQAADNGNPPRVNTTTVNIDVSDVNDNAPLFSRDNYSVII----------QENKPVG--FSVLKLVVTDKDSSHNGPPFFFTIVSGNDENAF-----EVNQHGVLLTAATIKRKVKDHYLLHVKVADSGKPQLSSMTHIDIRVIEESIHPPAILPLEIFITAFGEEYSGGV---IGKIHATDQD-VYDTLMY------SLDPHM-DGLFSVSSTGGKLIAHRKLDIGQYLLNVSVTDGKFTTVADITVHIQQVTQEMLNHTVAIRFANLTPEEFVGDYWRNFQRALRNILGVRKNDIQIVSLQPS--------------------------------------------EPHSHLDVLLFV-ERSGGTHVSTKQLLHKINSSVTDVEEIIGVRILEVFQKLCAGLD-CPWKFCDEKVSVDENVMSTHSTAR-LSFVTPRHHRTAVCLCK---DGT-CPPVHHGCEDNPCPAGSECVADP-REEKYSCVCP---GGGFGKCP----GSSS--------------ITFTGNSFVKYRLLENENRLEMKLSMRLRTYSSHAVVMYARGTDYS--ILEIHT-GRLQYKFDCGSGPGIVSVQSIQ-VNDGQWHAVSLEVEG------NYAKLVLDEVHTASGTAPGALKTLNLDNYVFFGG--HLRQQGTKHGRGAQVASGFRGCMDSIYLNGQELPLNNKPRAYAHIEEWV---DLSHGCLLTATED-CSSSPCQNGGVC-----NPSPTGGYYCKCSALYVGTFCEVSVNPCSSNPCLYGGTCMVDNGGFVCQCRGLYTGQRCQLSPYCKD--DPCKNGGTCFDS-----LDGAVCQCDSGFRGERCQSDIDECAGNP--CRNG-ALCENTHGSYHCNCSQEYRGKHCE 4165          

HSP 2 Score: 247.669 bits (631), Expect = 2.459e-64
Identity = 441/1825 (24.16%), Postives = 747/1825 (40.93%), Query Frame = 3
Query: 6021 INAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERL----EIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTIL-FSILNG------KESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFD-GKFETSCNITINSFDNTRNKVLPLEKSQVVW--EIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSE--QPKVEINEITGSLKLKSALDREERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQP---ALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTG-HTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDP---SSSLSHSTTVLITVLDIN--------------------------DELPIFLKSSYSAS---------------VSENMPINHEIISISVL-LQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLD--TNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHX-----XXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDIND-----NIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDK--KKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGKWSLVPSSSPFDVQNDFEIDSNYGYI-RAKKIMDFETQSQYRINVEYRVDNSPLMAT-RTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCK--------AYDKDYEGKDVIFYSLYQLDSVETGVSFRIDDQ-GWVYSVSAVDYEETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDS----------ESQKESLHFLITNQNLNPFYAYFRVSE-SGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAP-VCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLV---VEPLTGRVIVNAPLDRE--FSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSI-APFLENAPHGSVIGKIHAVDADSGINRKIVYRILDES-KSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNF---FRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGK------VTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSK--TNVTIEIEDKNDNPPEFAQ 11135
            ++A D D G NG+  Y    R    F I   +GV+ L  ++D  +     +L I   D+G  KL     +    ++ + +E  N+C P       L    L   P+  ++ +   D   N  I   SI+ G      K  R F   P +   K+           P    + ++A D G       + +    + + +  P++    V+  EI E       +VL +A   +SH    ++Y+  S   +PK  +N  TG + +   + R+     +L V       S     V V V   N   P F    Y+  +  N    A   RV A+D D GENG V YSI  +      + F ID  +G ++       EL+ + +T+ I+A+D G P    +     + ++ ++D +PLF++      +P D      +TTV AI +     + Y I  GN+ +LF L+ ++  L     +   +G        FH+L I+ATD    ++ L  + TV  +   +N                          D   IF   SYS +               V EN+P+   I+ ++   L    N K+V +++    D S C    F I+  TG + +   LD E    +   I V   G         + V ++D NDN P+F+Q ++   +S +    S ++   ATD D   +  + Y +L +    F ID  +G ++  Q P   ++ P   V   ++   D             + V+   + ++PP F+   + + V E+    + I  + A D D  +  ++RY ++   +   F +D L+GA+ + + LD E+K ++ L V   D G     ++      ++ D     + PV   ++ E  V+     TG+   S++ + A D D      + Y +        +  +D  TG +        +++      +   L VY     V   PL S+          I V +++  + D   +   P+    IM   EN+P +  V        +      L    +  + Q  F I    G I    + +D E Q ++ + V    +  P  +T   +++ ++D+ND  P F    Y I + E           K        A DKD      + YS+ + +  E G  F I+ + G V S       E  ++++    + +    + T L I           W   P      I         +F   V+  +  ++D           E     L F I   N +   ++F V + +G +++  PLDAE+      L   A+D       + +  I+VID NDH P       ++ + E   P   I  + A DRD   + N L YTL    DP  L    ++P TG +     LD E      +  +V   DV  K+   +I++NV D ND+AP F   S      E+A  GSV+ ++ A+D D G N +++Y I   +  +SF+ID   G ++ A  LDR  Q ++ L+++A+D G PP S +T+V+I +   +++ P+F +      ++E   IG  +  + A S      + V Y+ I + N    F +   SG++   + LDFE    Y LTV+ ++     LST T V++ V D NDN P F    Y   I E+  V+ + +        + A D+D   N++L Y  +                + ++F I+P TG I      D EE   + F V V D G P   ++   NVT+ + D ND PP F++
Sbjct:  172 VSATDADIGTNGEFYYSFKDR-TDVFAIHPTSGVVVLTGRLDF-LETQLYELEILAADRGM-KLYGSSGVSSLAKLTVHVEQANECAPIITA-VTLSPSELDKDPTYAIITVEDCDQGANGEIASLSIVAGDLLQQFKTVRSF---PGSKAFKVKAVGAVDWDSHPYGYNLTLQAKDKGTPPQFSPVKVVHIISPQFRAGPVKFEMDVYRAEISEFAPPHTPVVLVKAIPSYSH----LRYVFKSAPGKPKFGLNHNTGLISILEPIRRQHTSHFELEVTTSDKRAS---ARVVVKVLGTNSNPPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVTYSIANLN----HVPFVIDHFTGTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDADELQLVRYQIEAGNELDLFGLNPSSGVLSLKHSLTDGLGA----KVSFHSLRITATDGENFATPLYINLTVAASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFF-DSYSVNTHTPQFGVTLPTGIEVKENLPVGANILFMNATDLDSGFNGKLV-YAISGGNDDS-C----FTIDMETGVLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYFVEVSEDKEVNSEIIQVEATDKDLGPSGHVTYAILTDTEK-FSIDSMTGVVKIIQ-PLDREVQP---VHYLKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGH-FDVDKLSGAVRIVQQLDFEKKQLYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVF-SSFVEKGVVKEDVPTGS---SVMTVSAHDEDTGRDGEIRYSIRDGS-GIGVFRIDEETGVIETSDRLDREST------SHYWLTVYATDQGVV--PLSSF----------IEVYIEVEDVNDNAPQTSEPVYYPEIM---ENSPKDVSVVQIEAFDPDSSSNDKLTYRITSGNPQGFFSIHPKTGLITTTSRKLDREQQDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKFYKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYSIEEGN--EHG-RFSIEPKTGVVSSKKFSAAGEYDILSIKAVDNGRPQKSSTTRLHIE----------WISKPKPSSEPI---------SFEESVFSFTVMESDPVAHMIGVISVEPPGMPLWFDIIGGNYD---SHFDVDKGTGTIIVAKPLDAEQ-KSSYNLTVEATDGTTTILTQVL--IKVIDTNDHRPQFSTSKYEVAVPEDTEPEVEILQISAVDRD---EKNKLIYTLQSSIDPASLKKFRLDPATGALYTAEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYESAAVGSVVLQVTALDKDKGRNAEVLYSIESGNIGNSFTIDPILGSIKTARELDRSHQVDYDLMVKATDKGDPPMSEMTSVRIAVTVADNASPKFTSKEYSAEISEAIRIGSFVGMVSAHS-----QSSVMYE-IRDGNMGDAFNINPHSGSIITQRALDFETLPMYSLTVQGTNMA--GLSTNTTVVVHVRDENDNPPVFTQAEYSGFISESASVNSVVLTDRNVPLVIRATDADRESNALLVYQIVE-------------PSVHNYFAIDPTTGAIRTVLSLDYEETHAFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFSK 1883          

HSP 3 Score: 230.335 bits (586), Expect = 4.590e-59
Identity = 447/1900 (23.53%), Postives = 772/1900 (40.63%), Query Frame = 3
Query: 5706 KPSTGK-LFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILSRFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGK-FETSCNITINSFDNTRNKVLPLEKSQVVWEIPE---------NRNDVPDL----------------VLPRAKFYFSHQHPSIKYILLSEQPKVE---------------------INEITGSLKLKSALDRE--ERPFVQLLVLAKGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKG--QPALSS--FTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAIS---STGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDIND----ELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLD--TNSKLIYKVLN-EYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKN-HPPSFVMNEFHMSVSENFTVNSE--------IGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMKGK----WSLVPSSSPFDVQNDFEIDSNYGYIRAKKIMDFETQSQYRINVEYRVDNSPLMAT-RTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRIDD-QGWVYSVSAVDYEETKLINLVVSASDKAGHVTN--TTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITT-------LQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKC----SFKILINVLDINDNAPRFVHT--SIAPFLENAPHGSVIGKIHAVDADSGINRKIVYRILDES-KSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMITEQNFFRLESLSGNLTLIK-KLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFL--NFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDK 11108
            K + GK  FG+  +TG I  +  + R   Q     +++V + D   S       V + +   N N P F         I E+A  G+ V                 ++A DPDEG+NG + Y I +     F ID +TG +S +  +D E++     L IR  D G P     E L   I + + ND  P FE+      +         +  +   D D    + + I  G E   F ++P++G L +  +     G   S   + I A DG+ F T   I +    + +   L  E++ V   + E         ++ DV D+                 LP          P    IL      ++                     I+  TG LK+ S LDRE  ++  + + V   G      +  + V+V D ND  P FL E Y   V  +    ++ I+V+A D D G +G V Y+I          KF+IDS +GV+ I     +E+    + + I+A D+   +P L S     V +D V+D  P F    YSV V ED  +  I+  ++A          + Y++ + + E  FD+D  +         +R+V +LD+E K  + L + A D    +S S+T  + V  ++       P+F        V E++P    ++++S   +       + +S++   D S      FRI+  TG I   + LD E+   +   +     G    ++   + + + D NDN P+  +P +   I   S +   VV   A D D  +N KL Y++ +      F I   +G I       +++      ++E  V  +           +  +  +N + P F+   + + + E    + +        + R++A+D D+     L Y +  G +   F ++  TG +  KK        +  ++ V  D G     +T  +H+  I+   P  E   +E              ES+      + D    H +    V PP    + F D I G         N +S+  ++     + V +      ++  Y+  +  T  + +I   V I ++ D     P  + S   +         V + +IS+ +   K    ++L  S  P  ++  F +D   G +   + +D E   Q+ + V  R  + P+      I++++ D+ND  P F +  Y   + E   +GS V+Q  A DKD +G++     LY ++S   G SF ID   G + +   +D       +L+V A+DK     +  T++ I+V   ++  P +T        EI+E     S  F  +V         S   + S+ + I + N+    A+     SG ++    LD E +  P+    +    +        + + V D ND+ PV  Q      I E  +  SV+ T       ++A D D  +    L Y ++E S      ++P TG +     LD E +   +F V   D+ + +     +  + ++V+DIND  P F  +   ++  L      +VI  ++A DADS    +++Y I + +    FS+D  TG + + +    + +  + L + ASD G+   +++ +VKI + +  +SP +F        V E++   + L  I AI + +  N  + Y+++     F++   SG L+      D E    + + V  + +  PS      V + V D NDN P F  LPY   +  +  V  + I  VTA D DSG N  +     Y+L E          H +H F+I P +G+I L   F  D   +  Y   V   D G PAFS++  V I + +K
Sbjct:  404 KSAPGKPKFGLNHNTGLISILEPIRR---QHTSHFELEVTTSDKRAS-----ARVVVKVLGTNSNPPEFT-QTSYKASIDENAPIGAAV---------------TRVSAMDPDEGENGYVTYSIANLNHVPFVIDHFTGTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVL-ATITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDADELQLVRYQIEAGNELDLFGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGENFATPLYINLTVAASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFFDSYSVNTHTPQFGVTLPTG-IEVKENLPVGANILFMNATDLDSGFNGKLVYAISGGNDDSCFTIDMETGVLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYFVEVSEDKEVNSEIIQVEATDKDLGPSGHVTYAI-----LTDTEKFSIDSMTGVVKIIQPLDREVQPVHY-LKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLD-HGEGHFDVDKLSG-------AVRIVQQLDFEKKQLYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDTGRDGEIRYSIR---DGSGIGV--FRIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLTYRITSGNPQGFFSIHPKTGLITTTSR-KLDREQQDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKFYKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYSIEEGNEHGRFSIEPKTGVVSSKKFSAAGEYDILSIKAV--DNGRPQKSSTTRLHIEWISKPKPSSEPISFE--------------ESVFSFTVMESD-PVAHMIGVISVEPP-GMPLWF-DIIGG---------NYDSHFDVDKGTGTIIVAK-PLDAEQKSSYNLTVEATDGTTTILTQVLIKVI-DTNDHRPQFSTSKYEVAVPEDTEPEVEILQISAVDRDEKNKLIYTLQSSIDPASLKK-FRLDPATGALYTAEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYESAAVGSVVLQVTALDKD-KGRNAEV--LYSIESGNIGNSFTIDPILGSIKTARELDRSHQVDYDLMVKATDKGDPPMSEMTSVRIAVTVADNASPKFTSKEY--SAEISEAIRIGS--FVGMV---------SAHSQSSVMYEIRDGNMGD--AFNINPHSGSIITQRALDFETL--PMYSLTVQGTNMAGLSTNTTVVVHVRDENDNPPVFTQAEYSGFISESASVNSVVLTDRNVPLVIRATDADRESN-ALLVYQIVEPSVHNYFAIDPTTGAIRTVLSLDYEETHAFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFSKSLYEVSLLLPTYRGVNVI-TVNATDADSKAFSQVMYSITEGNIGEKFSMDHKTGTIAIQNTT--QLRSRYELTVRASD-GR--FTSMASVKINVKESRESPLKFTQDAYSAVVKENSTEARTLAVITAIGNPL--NEPLFYRILNPDRRFKISHTSGVLSTTGIPFDREQQETFDVVVEVTKEHEPSAVAHVVVKVTVEDQNDNAPVFVNLPYYAVVKVDAEVGHV-IRYVTAIDRDSGRNGDIH----YYLKE----------HHDH-FQIGP-SGDISLKKQFEHDTLNK-EYLVTVVAKDGGSPAFSAEVLVPITVMNK 2179          

HSP 4 Score: 169.088 bits (427), Expect = 1.583e-40
Identity = 332/1388 (23.92%), Postives = 567/1388 (40.85%), Query Frame = 3
Query: 7308 ILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGK------LDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWIL-----VKYDGRFSPTNRAHMQVHIVDEND----------NPPKFIQPAFNATISLES-SQGSLVVIAMATDLDTNSKLIYKVLNEY--YNIFKIDQSSGFIRFNQVP---NIEKLLPSSGV-VEFQ--VLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAFVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKVNPIITCSIMTIQENNPLNHIVAMCRISSTEMK------------GKWSLVPSSSPFDVQNDF------EIDSNYGYIRAKKIMDFET---------QSQYRINVEYRVDNSPLMATRTILI--DLIDQNDCPPIFDNS--------RYAIFISEDI------PLGSKVIQCKAYDKD--YEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYE--ETKLINLVVSASDKAGHVTNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRV-SESGEVLLLHPLDAEKILKPLQ-LKFLASDRLHWSKEEF---ILNIRVIDVNDHAP-VCPQIPDLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSI-APFL------ENAPHGSVIGKIHAVDADSGINRKIVYRILDESK-SSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIVLLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLI-KKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPE-------NTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDK---NDNPPEFAQPSFRFLI 11156
            I Y I +G+ E LF  +    Y+    C +R+  K      L+ E +  +TLI+ A + ++       V + VLD ND  P+F  +SYS S+ EN  I   I  +S     +  +    +S K   D        F I+ T+G + +   LDF    ++E  IL     +K  G    ++ A + VH+   N+          +P +  +    A I++E   QG+   IA  + +  +    +K +  +     FK+ ++ G + ++  P   N+       G   +F    +VH  +              +  P  F M+ +   +SE    ++ +  + A  S    +  LRY          FGL+  TG + + + + R+  S  EL V  SD   K   A V++ V   N N P   Q  Y+ ++            ++ ++ A D D      + Y + +  L+     +D  TG VS      ++N +  L        VY +  +  +  L  YR    V++     T+ +N L D   +   I C     ++      I  +  I + E++              + L PSS    +++        ++  +   I A    +F T          S+  +N++        M    +L    L  Q D   IF +S        ++ + +   I      P+G+ ++   A D D  + GK V   S    DS      F ID + G +  +S +D E  +   +N+ V             L ++V D ND  P + +      +E++E  +  SE     + ++ A D D        + ++T+         F + S +G V ++ PLD E  ++P+  LK  A D+       F   +L + + DVND+ P   P    + + E +  G++I  L+AYD D   + + + Y+L++  + +   V+ L+G V +   LD E     N  V A D + K  S      V     +    +HT + + F+      E+ P GS +  + A D D+G + +I Y I D S    F ID +TG++  +  LDRE    + L + A+D G  P S+   V I + DVND+ PQ         + E++     ++ I+A   D   N +++Y++ +   Q FF +   +G +T   +KLD E   E+ L V  +D G P  ST   VI++++D NDN PQF    Y   +PE        +   +  + +V A D D G N+ L+YS    + E   + R         F I PKTG +         E       +   D+G P  SS T + IE   K   +  P  F +  F F +
Sbjct:   71 IRYKIVSGDSENLFKAE---EYVLGDFCFLRIRTKGGNTAILNREVRDHYTLIVKAVEKATDAEARAKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDV-------FAIHPTSGVVVLTGRLDFLETQLYELEILAADRGMKLYGSSGVSSLAKLTVHVEQANECAPIITAVTLSPSELDKDPTYAIITVEDCDQGANGEIASLSIVAGDLLQQFKTVRSFPGSKAFKV-KAVGAVDWDSHPYGYNLTLQAKDKGTPPQFSPVKVVHIIS-----------PQFRAGPVKFEMDVYRAEISEFAPPHTPVVLVKAIPS----YSHLRYVFKSAPGKPKFGLNHNTGLISILEPIRRQHTSHFELEVTTSD---KRASARVVVKVLGTNSNPPEFTQTSYKASI----DENAPIGAAVTRVSAMDPDEGENGYVTYSIAN--LNHVPFVIDHFTGTVS-----TSENLDYEL-----MPRVYTLRIRASDWGL-PYRREVEVLA-----TITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDADELQLVRYQIEAGNELDLFGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGENFATPLYINLTVAASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFFDSYSVNTHTPQFGVTLPTGIEVKENLPVGANILFMNATDLDSGFNGKLVYAISGGNDDSC-----FTIDMETGVLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYF--VEVSEDKEVNSE-----IIQVEATDKDLGPSGHVTYAILTDTE------KFSIDSMTGVVKIIQPLDRE--VQPVHYLKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPD-VGQSSQVRYSLLDHGEGH-FDVDKLSGAVRIVQQLDFEKKQLYNLTVRAKD-KGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDTGRDGEIRYSIRDGSGIGVFRIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLTYRITSGNPQGFFSIHPKTGLITTTSRKLDREQQDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKFYKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYS----IEEGNEHGR---------FSIEPKTGVVSSKKFSAAGEYDI--LSIKAVDNGRPQKSSTTRLHIEWISKPKPSSEPISFEESVFSFTV 1369          

HSP 5 Score: 154.451 bits (389), Expect = 3.687e-36
Identity = 244/1050 (23.24%), Postives = 419/1050 (39.90%), Query Frame = 3
Query: 5724 LFGVTRSTGCIITVSSLDREQIQ----DIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIE--YVILSRFASYFK-IDQYTGVLSLALK----IDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNPTILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPS--IKYIL--LSEQPKVEINEITGSLKLKSALDREERPFV-QLLVLAKGWDGSYDY---INVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKK--FTIGIKANDKGQPALSSFTDVFVDIVSDKSPL---------------------------------FDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILY----------------TITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVL-ITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPT--NRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDT--NSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHD------FTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRERKSMHELRVVVSDYG--NKHDFATVLIHVTDINDNIP-VIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVS 8621
            +F +  ++G ++    LD  + Q    +I++ D  ++ Y    S  +S+  + +H+   N+ AP          I + + +P           +L K     +I  ED D+G NG+I    ++       FK +  + G  +  +K    +D +      +L+++ +DKG+P   S  ++ + II       P KFE D Y   +     P  P++ ++      +   +F    GK    F ++  TG + I     P+  +  S   + +   D +   S  + +       N   P E +Q  ++   + N      + R       +  +  + Y +  L+  P V I+  TG++     LD E  P V  L + A  W   Y     +  T+++ + ND  P+F     E  +  +L    Q   V AID D  E   V Y I        DL F ++ +SGV++++   +  L  K    ++ I A D    A   + ++ V   + + P+                                 FD    +   P+  +       VK     G  IL+                 I+ GND+  F +D           V++++  LD E    +TL I+  D       +  +L +TVLD ND  P FL+ SY   VSE+  +N EII +    + +  S  V +++          ++ F I+  TG + I + LD E   +H   I  +      P   +   ++V + D NDNPP+FI P ++  +  +  +G++++   A D D   +S++ Y +L+     F +D+ SG +R  Q  + EK      +    V   D       + +    V V  V+   H P F        V E+    S +  + A D D  + G +RY +  G    +F +D  TG +     LDRE  S + L V  +D G      F  V I V D+NDN P   E  YY   +  S K       S++Q+ A D D S   ++ YR+ S
Sbjct:  195 VFAIHPTSGVVVLTGRLDFLETQLYELEILAADRGMKLYGS--SGVSSLAKLTVHVEQANECAPI---------ITAVTLSPS----------ELDKDPTYAIITVEDCDQGANGEIASLSIVAGDLLQQFKTVRSFPGSKAFKVKAVGAVDWDSHPYGYNLTLQAKDKGTPPQFSPVKV-VHIISPQFRAGPVKFEMDVYRAEISEFAPPHTPVVLVKAIPSYSHLRYVFKSAPGKPK--FGLNHNTGLISILE---PIRRQHTSHFELEVTTSDKR--ASARVVVKVLGTNSN---PPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVTYSIANLNHVPFV-IDHFTGTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDAD--ELQLVRYQIEAGNEL--DL-FGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGENFATPLYINLTV--AASRKPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFFDSYSVNTHTPQFGVTLPTGIEVKENLPVGANILFMNATDLDSGFNGKLVYAISGGNDDSCFTIDMETG-------VLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYFVEVSEDKEVNSEIIQVEATDKDLGPSGHVTYAIL-------TDTEKFSIDSMTGVVKIIQPLDREVQPVHYLKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGHFDVDKLSGAVRIVQQLDFEK----KQLYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDTGRDGEIRYSIRDGSGIGVFRIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDV-----SVVQIEAFDPDSSSNDKLTYRITS 1181          

HSP 6 Score: 132.494 bits (332), Expect = 1.777e-29
Identity = 171/676 (25.30%), Postives = 284/676 (42.01%), Query Frame = 3
Query: 1557 TKKTFT----LRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDI-SRTKISYYLFDQNKLPFRL----GEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGL---VSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRF-LDSFQIPMTLPENYDIKKRIVQIKATDADS---KDIQYRLV--NFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRY--AIHGIHSDCFHCDTSTGAVHLLCKLSPLTEYRLIAV-VKDNGKPQALS-SQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRINNEG 3518
            T  TF+    + + V D N+  PV        T+ E+   G+ V+ + A D DI S  +I+Y LF      F+L    GE +   ++ +E       Q  + + V  TD G    RS  A   + + DVN+  PEF  +   IT+         +    A D D      I  S+   +  Q  FSI+  SG + L    KH        +T+ L+A D GL   +++   +  SV+D N                                       N P+F  R              + E+   GT V ++   + D + +   +E  + + S  E   FSI   DS +  I + + LD E+  +Y++T+   D G P         I V DINDN P F  D++     + E+  +++ ++ I A DAD      I Y ++  N    F I    G +++   LDRE    Y + + A+D    N     T T+ I V+D+NDN P+F++++YS+ + E+ P+G  +++L  TD D   N    +   + G   + F  +     +        + ++ L+ V V D+GKPQ  S +  D ++  + +HP   +P   E  ITA   E    G ++  I     D    + +Y++  H +G  LF +++ G
Sbjct: 3001 TDGTFSSKARVEVKVLDANDNSPVCEKTSYSDTIPEDALPGKLVMQVSATDADIRSNAEITYTLFGSGAEKFKLNPDTGELRTLALLDREE------QAVYNLLVKATDGGG---RSCQAAIVLTLEDVNDNAPEFTAEPYTITVFENTEPGTPLTRVQATDADTGLNRKISYSLVESADGQ--FSINERSGIIQLE---KHLDRELQAVYTLTLKAVDQGLPRRLTATGTVVVSVLDIN--------------------------------------DNPPVFEYREYG---------ASVSEDIVIGTEVLQVYAASRDIEAN---AEITYAIISGNEHGKFSI---DSKTGAIFIIESLDYESSHEYYLTVEATDGGTPSLSDVATVNINVTDINDNSPVFSQDTYT--TVVSEDAALEQPVITIMADDADGPSNSHIHYSIIEGNQGSPFTIDPVRGEVKVTKPLDRETISGYTLTVQAADNG--NPPRVNTTTVNIDVSDVNDNAPLFSRDNYSVIIQENKPVGFSVLKLVVTDKDSSHNGPPFFFTIVSGNDENAFEVNQHGVLLTAATIKRKVKDHYLLHVKVADSGKPQLSSMTHIDIRVIEESIHPPAILP--LEIFITAFGEE--YSGGVIGKIHATDQDVY-DTLMYSLDPHMDG--LFSVSSTG 3598          

HSP 7 Score: 102.449 bits (254), Expect = 1.785e-20
Identity = 76/213 (35.68%), Postives = 115/213 (53.99%), Query Frame = 3
Query:  231 ISFTKPLYNVGIYQDQDVRKYVAHYDFQMGIEKPEEEGKITYKIRDSSEIFNTFEAESKLVGDFFYLRIRTKY--TASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFY-YLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRG 860
            I FT   YNV ++++   + YV H   +MGI   +   +I YKI  S +  N F+AE  ++GDF +LRIRTK   TA LNRE    Y L ++ +   K+T   +   + +V ++VLD ND  P+F   ++     EN +I T I  V+ATDAD G N E +Y + D++ +        F+I+P SG++    +L DF+       +I A  RG
Sbjct:   33 IQFTHFQYNVTVHENSAAKTYVGH-PRKMGIYILDPSWEIRYKIV-SGDSENLFKAEEYVLGDFCFLRIRTKGGNTAILNREVRDHYTLIVKAV--EKAT---DAEARAKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDV--------FAIHPTSGVVVLTGRL-DFLETQLYELEILAADRG 229          

HSP 8 Score: 96.6709 bits (239), Expect = 1.107e-18
Identity = 142/583 (24.36%), Postives = 250/583 (42.88%), Query Frame = 3
Query: 6771 LDREERPFVQLLVLA--KGWDGSYDYINVTVSVTDENDYKPMFLSEKYEFLVHTNLSKEAQSIRVKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQ--------PALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKD--FIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPF-HTLIISATDPSSSLSHSTTVLITVLDINDEL-PI-FLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLV--VIAMATDLDTNSKLIYKVLNEYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHD----FTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLD---RERKSMHELRVVVSDYGNKHDFATVL 8447
            L+RE R    L+V A  K  D       V V V D ND +P+F    Y   +  N +      RV A D D G NG   YS            FAI   SGV+ + +G    L  + + + I A D+G          +L+  T V V+  ++ +P+      S   P +  KD  + + TV+      +  + +++    + L       ++       ++ VG +D+++ P+ + L + A D  +    S   ++ ++       P+ F    Y A +SE  P +  +    VL++ + +   + +  K    S+P   + F +N  TG ISI E +  +     E  +    D R S    A + V ++  N NPP+F Q ++ A+I   +  G+ V  V AM  D   N  + Y + N  +  F ID  +G +  ++  + E L+P   V   ++   D    +   V    ++   ++ ++ P F       ++  +  V  +I  + A D+D+ +   +RY +  G + ++FGL+  +G L LK +L      + S H LR+  +D  N   FAT L
Sbjct:  109 LNREVRDHYTLIVKAVEKATDAEA-RAKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDV-----FAIHPTSGVVVL-TGRLDFLETQLYELEILAADRGMKLYGSSGVSSLAKLT-VHVEQANECAPIITAVTLS---PSELDKDPTYAIITVEDCDQGANGEIASLSIVAGDLLQQFKTVRSFPGSKAFKVKAVGAVDWDSHPYGYNLTLQAKDKGTPPQFSPVKVVHIISPQFRAGPVKFEMDVYRAEISEFAPPHTPV----VLVKAIPSYSHLRYVFK----SAPGKPK-FGLNHNTGLISILEPIRRQHTSHFELEVTTS-DKRAS----ARVVVKVLGTNSNPPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVTYSIANLNHVPFVIDHFTGTVSTSENLDYE-LMPR--VYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCEGTIPRDLGVGEQITTVSAIDADELQL--VRYQIEAGNELDLFGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGEN---FATPL 658          

HSP 9 Score: 90.5077 bits (223), Expect = 7.712e-17
Identity = 192/819 (23.44%), Postives = 325/819 (39.68%), Query Frame = 3
Query: 1566 TFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISR-TKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNE--YKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDN-IQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLV--SSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADR-LDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPE------NYDIKKR--IVQIKATDAD---SKDIQYRL--VNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPI-FTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDC-FHCDTSTGAVHLLCKLSP--LTEYRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISL--FRIN-NEGEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXXXXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVP 3941
            T  L++S+ DVN+ PP  +     + V+E+   G  ++ ++AYDPD+ + +++ Y L D  +  F + +    V IV++ LD E  Q  + + V   D G P++ S   + E+E+ DVNE  + P F     +  +    P    +    A D D  GRD  I+ SI   S     F I  E+G +    T         +++ + + A D G+V  SS + +   V D N                                 +N  ++++P++                 I E S K   V +I     D   +    +  + + S   Q  FSI      +  I    R LDRE  D++ + + V D G P      R  +++ D NDN P+FL  F   + LPE      +    KR  + ++ A D D   + ++ Y +   N    F I  +TG +  +        +Y  + I A D     +S T    +  I      ++PI F ++ +S  + E  P+   +  +      +     L + I G + D  F  D  TG + +   L     + Y L     D G    L+     Q+  + +  N + P         A+ E+  P   +  I     D E    +YT+    +  SL  FR++   G + T   +D E    + L + + D+ D  + +  A + + V+D+ND+ P      Y   V E+      ++ V A D D  +  E+ Y I SG+    F+I        + R +DR       +    YDL V  +D G P
Sbjct:  911 TVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGHFDVDKLSGAVRIVQQ-LDFEKKQ-LYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDT-GRDGEIRYSIRDGS-GIGVFRIDEETGVIE---TSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVN---------------------------------DNAPQTSEPVY--------------YPEIMENSPKDVSVVQIEAFDPDSSSN---DKLTYRITSGNPQGFFSI---HPKTGLITTTSRKLDREQQDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKF-YKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYSIEEGNEHGRFSIEPKTGVVSSKKF--SAAGEYDILSIKAVDNGRPQKSSTTRLHIEWISKPKPSSEPISFEESVFSFTVMESDPVAHMIGVISVEPPGM----PLWFDIIGGNYDSHFDVDKGTGTIIVAKPLDAEQKSSYNLTVEATD-GTTTILT-----QVLIKVIDTNDHRPQFSTSKYEVAVPEDTEPEVEILQISAVDRD-EKNKLIYTLQSSIDPASLKKFRLDPATGALYTAEKLDHEAIHQHVLTVMVRDQ-DVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYESAAVGSVVLQVTALDKDKGRNAEVLYSIESGNIGNSFTIDPILGSIKTARELDR-------SHQVDYDLMVKATDKGDP 1647          

HSP 10 Score: 82.4185 bits (202), Expect = 1.967e-14
Identity = 112/452 (24.78%), Postives = 186/452 (41.15%), Query Frame = 3
Query: 1566 TFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDI-SRTKISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDIYVPHQTTRDSTINHPNNYEESNKPIFGMRNIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFLDSFQIPMTLPENYDIKKRIVQIKATDADSKD-IQYRL-VNFRRVFKIHSRTGWLRLRVNLD 2912
            T T+ +SV D+N+ PPV        +V E+  IG  VL + A   DI +  +I+Y +   N+      + K   + + E+LD E+    +++ V  TD G P + S +A   I + D+N+  P F   T    +S  A  +  +   +A+D D     +I  SI   +   P F+I P  G + +        +S    +T+ +QA D                      +G P +++    +I V       S +N                N P+F+ +  SVI I+E    G  V K+ +   DKD       F F + S  ++  F +   + H   ++ A  + R+  D Y + + V D G+P+       +I+V + + +PP  L          E Y     I +I ATD D  D + Y L  +   +F + S  G L     LD
Sbjct: 3215 TGTVVVSVLDINDNPPVFEYREYGASVSEDIVIGTEVLQVYAASRDIEANAEITYAIISGNEHGKFSIDSKTGAIFIIESLDYES-SHEYYLTVEATDGGTP-SLSDVATVNINVTDINDNSPVFSQDTYTTVVSEDAALEQPVITIMADDADGPSNSHIHYSIIEGNQGSP-FTIDPVRGEVKVTKPLDRETIS---GYTLTVQAAD----------------------NGNPPRVNTTTVNIDV-------SDVND---------------NAPLFSRDNYSVI-IQENKPVGFSVLKLVV--TDKDSSHNGPPFFFTIVSGNDENAFEV---NQHGV-LLTAATIKRKVKDHYLLHVKVADSGKPQLSSMTHIDIRVIEESIHPPAILPLEIFITAFGEEYS-GGVIGKIHATDQDVYDTLMYSLDPHMDGLFSVSSTGGKLIAHRKLD 3608          

HSP 11 Score: 68.1662 bits (165), Expect = 4.270e-10
Identity = 127/532 (23.87%), Postives = 227/532 (42.67%), Query Frame = 3
Query:  459 LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKLFDFVGGSKLSAKIYAIHRGDLSLIKCDXXXXXXXXXXXXAHNVHAPKISVK-YLSKYFDPDFNDYPFAEITVTDEDERLNRNRNPYPILIRHHPKSPVNV---FLTPTGELNRYVLKLRAIFSPISTPAISVTIEAKDLSLNPKTSSTHLTIPLGNLRNIN----LLSVPEFVSVSIPENAIVNSSVCLLKTFIXXXXXXXXXXXXFRWIPDLE-GTYSVNDXXXXXXXXXXXXKDLNAEDFGSPERNLTIAVAMNDSLETKKTFTLRISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPD-ISRTKISYYLFDQNK-LPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIAEDLD 2021
            L+RE+   Y LT+     + + G F  S K +V +KVLD NDN P+    ++     E+A     +  V+ATDAD   N+EI Y L  S          F +NP +G +  +  L D    +  +  + A   G  S   C       L       N +AP+ + + Y    F+      P   +  TD D  LNR +  Y ++     +  +N     +     L+R   +L+A+++        +T++A D  L  + ++T   +   ++ +IN    +    E+   S+ E+ ++ + V  L+ +  S ++    ++ +  I   E G +S++      +G + + + L+ E   S E  LT+      +       T+ I+V D+N+  PV   +     V E+  + + V+ I A D D  S + I Y + + N+  PF +   +  V + K  LD ET+   + + V   D+G P  R       I+++DVN+  P F      + I    P    +   +  D D
Sbjct: 2986 LDREQKDSYLLTV-----TATDGTF--SSKARVEVKVLDANDNSPVCEKTSYSDTIPEDALPGKLVMQVSATDADIRSNAEITYTLFGSGAEK------FKLNPDTGELRTL-ALLDREEQAVYNLLVKATDGGGRS---CQAAIVLTLEDV----NDNAPEFTAEPYTITVFENTEPGTPLTRVQATDADTGLNR-KISYSLVESADGQFSINERSGIIQLEKHLDR---ELQAVYT--------LTLKAVDQGLPRRLTATGTVVV--SVLDINDNPPVFEYREY-GASVSEDIVIGTEV--LQVYAASRDIEANAEITYAIISGNEHGKFSID----SKTGAIFIIESLDYE--SSHEYYLTVEATDGGTPSLSDVATVNINVTDINDNSPVFSQDTYTTVVSEDAALEQPVITIMADDADGPSNSHIHYSIIEGNQGSPFTIDPVRGEVKVTKP-LDRETIS-GYTLTVQAADNGNP-PRVNTTTVNIDVSDVNDNAPLFSRDNYSVIIQENKPVGFSVLKLVVTDKD 3470          

HSP 12 Score: 67.3958 bits (163), Expect = 7.357e-10
Identity = 74/293 (25.26%), Postives = 125/293 (42.66%), Query Frame = 3
Query: 2721 PPRFLDSFQIPMTLPENYDIKK-----RIVQIKATDADSKDIQYRLVN------FRRVFKIHSRTGWLRLRVN------LDREKRDYYPIVIVASD--VDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFVYTISGHSNGISLFRINNEGEIRTVS 3536
            PP     FQ  +T+ EN   K      R + I   D  S +I+Y++V+      F+    +     +LR+R        L+RE RD+Y +++ A +   D   R+          V D ND +P+F+  SYS++LPE+  I + + ++ ATDAD+  N +  Y+     +D F    ++G V L  +L  L    Y L  +  D G                K++ +  + SL +  +       C P     ++ P   DK+P   + T+     G +       GEI ++S
Sbjct:   31 PPIQFTHFQYNVTVHENSAAKTYVGHPRKMGIYILDP-SWEIRYKIVSGDSENLFKAEEYVLGDFCFLRIRTKGGNTAILNREVRDHYTLIVKAVEKATDAEARAKVRVQ-----VLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKD-RTDVFAIHPTSGVVVLTGRLDFLETQLYELEILAADRG---------------MKLYGSSGVSSLAKLTVHVEQANECAPIITAVTLSPSELDKDPTYAIITVEDCDQGAN-------GEIASLS 294          

HSP 13 Score: 65.0846 bits (157), Expect = 3.732e-9
Identity = 53/146 (36.30%), Postives = 69/146 (47.26%), Query Frame = 3
Query:  360 IRDSSEI----FNTFEAESKLVGDFFYLRIRTKYTASLNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGII 785
            IR ++EI    F +   + KL  D   LR      A L+RE    YNL +      K+T     SC+  +V+ + D NDN P F  E +     EN    T +  V ATDAD G+N +I Y L +SA         FSIN  SGII
Sbjct: 3054 IRSNAEITYTLFGSGAEKFKLNPDTGELRT----LALLDREEQAVYNLLV------KATDGGGRSCQAAIVLTLEDVNDNAPEFTAEPYTITVFENTEPGTPLTRVQATDADTGLNRKISYSLVESA------DGQFSINERSGII 3183          

HSP 14 Score: 54.299 bits (129), Expect = 6.857e-6
Identity = 38/115 (33.04%), Postives = 62/115 (53.91%), Query Frame = 3
Query:  459 LNRERIGFYNLTIQGLFESKSTGKFETSCKTQVVIKVLDRNDNCPMFVNENFEFIAQENASIATQIGTVTATDADEGMNSEIFYYLDQSAITSDSVKFPFSINPFSGIIYPVQKL 803
            L+ E+   YNLT++    +       T+  TQV+IKV+D ND+ P F    +E    E+     +I  ++A D DE   +++ Y L QS+I   S+K  F ++P +G +Y  +KL
Sbjct: 1419 LDAEQKSSYNLTVEATDGT-------TTILTQVLIKVIDTNDHRPQFSTSKYEVAVPEDTEPEVEILQISAVDRDE--KNKLIYTL-QSSIDPASLK-KFRLDPATGALYTAEKL 1522          
BLAST of Ft-2 vs. Ensembl Mouse
Match: Fat1 (FAT atypical cadherin 1 [Source:MGI Symbol;Acc:MGI:109168])

HSP 1 Score: 1048.88 bits (2711), Expect = 0.000e+0
Identity = 1088/4119 (26.41%), Postives = 1829/4119 (44.40%), Query Frame = 3
Query: 1581 ISVQDVNEFPPVVMNNGSVITVKENTEIGETVLIIQAYDPDISRTK-ISYYLFDQNKLPFRLGEFKRNVVIVKENLDAETMQRRFFIRVLVTDSGAPIARSVIAHYEIEIADVNEYKPEFVYKTCQITISRQAPYDLKIGHFIA--EDLDRDGRDNIQISIASVSFQQPCFSIHPESGTLSLLCTFKHGMLSKLTNFTIGLQANDSGLVSSKMALNFSVVDANSRSLSGRPIKLDCVKNDI--YVPHQTTRDSTINHPNNYEESNKPIFGMR-NIPIFATNIPSVIHIREESAKGTIVQKITMKTADKDRDPYESEFVFGVWSEEEQMVFSIARTDSHSADIVVADRLDRETVDKYHMTIAVCDQGQPKNCIFKRFEIQVEDINDNPPRFL-DSFQIPMTLPENYDIKKRIVQIKATDAD---SKDIQYRLVNFRRVFKIHSRTGWLRLRVNLDREKRDYYPIVIVASDVDFYNRSXXXXXXXXXXVADINDNKPIFTKNSYSLALPEDLPIGSFLVQLHATDADLDDNSQLRYAIHGIHSDCFHCDTSTGAVHLLCKLSPLTE--YRLIAVVKDNGKPQALSSQADFQIYPQKVHPNRYIPSLKEPIITAAIRENCLPGTLVTSIRPETSDKEPQSFV-YTISGHSNGISLFRINNE-GEIRTVSSIDREKEESYWLYIYIEDRNDEIINKILAEVYIKVTDENDNCPMPERAFYKASVAENLQGIHHLITVKATDADMNKKTELKYKIISGDTWGYFXXX-XXXXXXXXXXXXDREPLKSTCAFTDFYDLKVMISDSGVPEQXXXXXXXXXXXXXXXXAPSFINDNVFVFNRYLSTELINYHRLKNTNILIGRVTAVDIDYDLNATVRYTMQPPRVANLNASTLELFSVDVKSGHLFANISSSIFDNSQNGTVQIPTFKINVWAYDLGAPTMWTRSPAEVTIRLYLSENATDPKSEN-----DKSKLYLAYLPSDS----INIVYDECIGSELLSIPVVDQL------------DP----KGTSLEVQIDDADGPFSVIWAKRSGSPSYKTEAILLVADSLVNQGEKVTLEITIRNTKFYVQHNVTIFIKFYNKNFPTFNLPSSEPLQINIEDHTKPPKSIYIVKARVAPTEFPXXXXXXXXXXXXXXXDLFEPIIYSISASNDPIAVQKLFHINSNNGDLRLISPANAYSNQTFDIIVEARNK----RATYMKLQIHILDTNNMYPEFLVSREQSNMYMETLRNLAKSQSSVLNEMDKLSIQRHLDNSLIFSFTWIDVGSSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPST-GKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILS-RFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNP--TILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKS-ALDREERPFVQLLV-LAKGWDGSYDYINVTVSVT-DENDYKPMFLSEKYEFLVHTNLSKEAQSIR-VKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTN--SKLIYKVLN-EYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRE--RKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIA---FVDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKV----NPIITCSIMTIQENNPLNHIVAMCRISSTEMKGK--WSLVPSSSPFDVQND-FEIDSNYGYIRAKKIMDFETQSQYRINVEYR--VDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHV---TNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPF----LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIV-LLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRT---LWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKP----------------NIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGARNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSGFKCICPDGLTGPRCQWGKSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHCE 13637
            + V   N  PP         ++ EN  IG  V  + A DPD      ++Y + + N +PF +  F    V   ENLD E M R + +R+  +D G P  R V     I + ++N+  P F    C+ TI    P DL +G  I     +D D    ++  I + + +   F ++P SG LSL  +   G+ +K++  ++ + A D    ++ + +N +V  A SR    +P+ L C +  +   +  +  + + ++   + E+     + +  + P F   +P+ I ++E    G  +  + M   D D   +  + V+ +    +   F+I   D  +  + V   LDRE +DKY + I V D G P+   ++  ++ V D NDN P FL +S+ + ++  E+ ++   I+Q++ATD D   S  + Y ++     F I S TG +++   LDRE +  + + I A D       L +T  L + + D+NDN P F   +YS+ + EDLP G+ ++ L A D D+  +SQ+RY++       F  D  +GAV ++ +L    +  Y L    KD GKP +LSS    ++    V+ N + P     +    ++E+   G+ V ++     D      + Y+I   S GI +FRI+ E G I T   +DRE    YWL +Y  D+    ++  + EVYI+V D NDN P      Y   + EN      ++ ++A D D +   +L Y+I SG+  G+FSI   TG I+T+ R +DRE         D + L+V ++D+GVP +     + V I+D NDN P F+    F   R    E  +  R  +    + RV A D D   NA + Y+++         +    FS++ K+G     +SS  F  S  G   I    +++ A D G P   +      T RL++ E  + PK  +     ++S      + SD     I ++  E  G  L    + D L            DP    +G + +   D   G  ++I AK                D+       +T+E T   T    Q  V I +   N + P F   S+   ++ + + T+P   I  + A                     + D    +IY++ +S DP +++K F ++   G L      +  +     + V  R++    +  + ++ +++ D N+  P F        +Y                                         +++G+++  ++A D+D GRN +++++I++ ++  N F +D   G I+  R L         L +  +D G PP     + +V I      ++ P+    +    + E   + S +  +   S +        V+  I+    G  F +   +G IIT  +LD E +  + S+ +Q  +  GL +      +V +H+ D NDN P F    + +G ISESA+  S+V        L+     LVI A D D   N  + Y I+     +YF ID  TG +   L +D E   +F   ++++ D G+P+L ++    + + + D NDCPP F K  Y   L+LPT+    ++ +   D D      +++SI  G     FS+D  TG + I       + +  S   + +RA DG+F +  ++ IN  ++  +   PL+ +Q  +      N      L       +  +  + Y +L+   + +I+  +G L       DRE++    ++V + K  + S     V      D+ND  P+F++  Y  +V  + ++    IR V AID D+G NG +    YY+K   +   F I   SG I+++     + L K++ + + A D G PA S+   V + +++   P+F+K+ YS  +PE+      V  ++A S  G  + Y+IT+G+    F ++F          V+ ++  LD+E+ P + L + ATD  +       V I V DIND  P+F++ SYS ++SE   I   ++ +         ++ +  S +LI + S  S  HF I+  TG IS+   LD+E    H  ++     G  + ++   + V + D NDNPP F Q  + A IS  ++ G  V+   A D D++   KL Y +L+   +  F ID+ +G I  + +     L P        V V D      A V+V  +    H P F  NE+ + ++EN  +++ + ++ ASD D   +  + YH++  F  + F ++       L+K LDRE   + +  +R++  D G K  F TV + +TD NDN P      YEV  I S+ + GT   S++++ A D D      + Y + +   S+S+     ++ +TG ++ K S I      GL N       +  A      P  S             V V I IL  + ++     P  T    TI E+ P+   + + R+   E  G   + LV  ++P   +++ F ID   G ++ +K +D ET   Y+ ++  R  +D+  ++A+  + I + D ND  P+ ++S Y  FI E++P GS+VIQ +A D D      + YSL Q    +   SF I+ + GW+ ++  +D+EE     + V ASD    V   +   + ++V DVND  P +T        EI +      +    V+  LS  D D+E     + + IT  +    +A   V     V +  PLD E+    L L   A+D    SK    + ++V+D ND++PVC +      I E   PG ++  + A D D  +    +TYTL   S      + P TG +   A LDRE  +  N +V A D   + C   I++ + D+NDNAP F   +  P+     EN   G+ + ++ A DAD+G+NRKI Y +++ +   FSI+  +GI+++   LDRE Q  + L ++A D G P +   T   +V +LD+ND+PP F        V+ED  IG  ++ + A S DI  NAE++Y +I+  E   F ++S +G + +I+ LD+E S EY+LTV A+D G PSLS    V I V D+NDN P F    Y   + E+  + +  I  + A D+D   NS + YS +      + N  S        F I+P  GE+ +    DRE    Y   V   D+G P   + T V I++ D NDN P F++ ++  +I          QE K  G  F V +L + DKD   N  PF   +++    + F     E+    +LL A ++   V+    L V+V D+G+P L     + + VI  S  PP I PL +    F  E   G    I ++   D+   +D L +      +L   + +  F + S  G +     LD G Y LNV VT+   +T   I + I  +T++M+     I+ +++ P                NI   R+ D++++    S                                             P   +DVL+ V   +      +  L+ +I +   D+ +I     +++F  +C     C    C   + V+  +   +     ++F++      + CLC    +G  C    + C   PC +   C  DP +   + C CP    G + + P    G+SS              I FTG  F+ + L E  N L M++    R     A +M  +       +++I++ G++    D  + P I   +S+  + DG+WH V L + G       +  +V+D +     +    ++  + +  +  G   ++  +     +   +     GC+  + LN Q+LP    P         V   +L++GC  +     C++  C+NGG+C            Y C+C   + G  CE+  + C  +PC++GG C+    GF C C    TG RCQ    C    +PC    TC +         AVC C    RG  CQ D+DEC   P  C+ G  +C N H  Y CNC+  YRG HCE
Sbjct:  452 VKVLGTNSNPPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVTYSIANLNHVPFVIDHFT-GTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCEGTI----PRDLGVGEQITTVSAIDADELQLVRYQIEAGN-ELDLFGLNPSSGVLSLKHSLTDGLGAKVSFHSLRITATDGENFATPLYINLTV--AASR----KPVNLQCEETGVAKMLAEKLLQANKLHSQGDVEDIFFDSYSVNTHTPQFGVTLPTGIEVKENLPVGANI--LFMNATDLDSG-FNGKLVYAISGGNDDSCFTI---DMETGVLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYFVEVS--EDKEVNSEIIQVEATDKDLGPSGHVTYAILTDTEKFSIDSMTGVVKIIQPLDREVQPVHYLKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIPPNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGHFDVDKLSGAVRIVQQLDFEKKQLYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDVPTGSSVMTVSAHDEDTGRDGEIRYSIRDGS-GIGVFRIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFI-EVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLTYRITSGNPQGFFSIHPKTGLITTTSRKLDREQ-------QDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQK--FYKIRLPEREKADGDRSASKREPLYRVIAADKDEGPNAELSYSIE-------EGNEHGRFSIEPKTG----VVSSKKF--SAAGEYDI----LSIKAVDNGRPQKSS------TTRLHI-EWISKPKPSSEPISFEESVFSFTVMESDPVAHMIGVISVEPPGMPLWFDIIGDALAREVFYIFQLTCDPNCTAEGGNYDSHFDVDKGTGTIIVAKP--------------LDAEQKSSYNLTVEATDGTTTILTQ--VLIKVIDTNDHRPQF---STSKYEVAVPEDTEPEVEILQISA--------------------VDRDEKNKLIYTLQSSIDPASLKK-FRLDPATGALYTAEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYE---------------------------------------SAAVGSVVLQVTALDKDKGRNAEVLYSIESGNIG-NSFTIDPILGSIKTARELDRSHQVDYDLMVKATDKGDPPM--SEMTSVRIAVTVADNASPKFTSKEYSAEISEAIRIGSFVGMVSAHSQSS-------VMYEIRDGNMGDAFNINPHSGSIITQRALDFETLP-MYSLTVQGTNMAGLSTN----TTVVVHVRDENDNPPVFT-QAEYSGFISESASVNSVV--------LTDRNVPLVIRATDADRESNALLVYQIVEPSVHNYFAIDPTTGAIRTVLSLDYEETHAF-HFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFSKSLYEVSLLLPTYRGVNVITVNATDADSKAFSQVMYSITEGNIGEKFSMDHKTGTIAIQN-----TTQLRSRYELTVRASDGRFTSMASVKINVKESRES---PLKFTQDAYSAVVKENSTEARTLAVITAIGNPLNEPLFYRILNPDRRFKISHTSGVLSTTGIPFDREQQETFDVVVEVTKEHEPSAVAHVVVKVTVEDQNDNAPVFVNLPYYAVVKVD-AEVGHVIRYVTAIDRDSGRNGDI---HYYLK--EHHDHFQI-GPSGDISLKKQFEHDTLNKEYLVTVVAKDGGSPAFSAEVLVPITVMNKAMPVFEKAFYSAEIPENIQMHSPVVHIQANSPEGLKVFYSITDGDPFSQFTINFNTG-------VVNVIAPLDFESHPAYKLSVRATDSLTGAHAEVFVDIIVEDINDNPPVFVQPSYSTTLSEASVIGTPVLQVRATDSDSEPNRGI--SYQLIGNHSK-SHDHFHIDSNTGLISLVRALDYEQSQQHRIFVRAVDGGMPALSSDVVVTVAVTDLNDNPPLFEQQVYEARISEHAAHGHFVMCVRACDADSSDLDKLEYSILSGNDHKSFIIDRETGIITLSNLRR-HTLKP---FYSLNVSVSDGVFRSSARVNVTVMGGNLHSPVFHQNEYEVELAENAPLHTLVVQVKASDRDSGIYSHVTYHIVNDFAKDRFYVNDRGQIFTLEK-LDRETPAEKVISIRLMAKDAGGKVAFCTVNVILTDDNDNAPQFRSTKYEVN-IGSSAAKGT---SVVKVFASDADEGSNADVTYAIEAD--SESVKENLEINKLTGLITTKESLI------GLEN--EFFTFFVRAVDSGSPPRESV------------VPVYIKILPPEVQLPRFSEPFYT---YTISEDTPIGTEIDLIRV---EHGGAVLYILVKGNTPESNRDEFFVIDRQNGRLKLEKSLDHETTKWYQFSILARCTLDDYEVVASIDVSIQVKDANDNSPVLESSPYEAFIVENLPGGSRVIQIRASDLDSGANGQVMYSLDQSQDADIIESFAINMETGWITTLKELDHEERASYQIKVVASDHGEKVQLSSTAIVGVTVTDVNDSPPRFTA-------EIYKGTVSEDDPPGGVIAILSTTDADTEEINRQVSYFITGGDALGQFAVENVQSDWRVYVKKPLDREQKDSYL-LTVTATDGTFSSKAR--VEVKVLDANDNSPVCEKTSYSDTIPEDALPGKLVMQVSATDADIRSNAE-ITYTLF-GSGAEKFKLNPDTGELRTLALLDREEQAVYNLLVKATDGGGRSCQAAIVLTLEDVNDNAPEF---TAEPYTITVFENTEPGTPLTRVQATDADTGLNRKISYSLVESADGQFSINERSGIIQLEKHLDRELQAVYTLTLKAVDQGLPRRLTATGTVVVSVLDINDNPPVFEYREYGASVSEDIVIGTEVLQVYAASRDIEANAEITYAIISGNEHGKFSIDSKTGAIFIIESLDYESSHEYYLTVEATDGGTPSLSDVATVNINVTDINDNSPVFSQDTYTTVVSEDAALEQPVI-TIMADDADGPSNSHIHYSII------EGNQGSP-------FTIDPVRGEVKVTKPLDRETISGYTLTVQAADNGNPPRVNTTTVNIDVSDVNDNAPLFSRDNYSVII----------QENKPVG--FSVLKLVVTDKDSSHNGPPFFFTIVSGNDENAF-----EVNQHGVLLTAATIKRKVKDHYLLHVKVADSGKPQLSSMTHIDIRVIEESIHPPAILPLEIFITAFGEEYSGGV---IGKIHATDQD-VYDTLMY------SLDPHM-DGLFSVSSTGGKLIAHRKLDIGQYLLNVSVTDGKFTTVADITVHIQQVTQEMLNHTVAIRFANLTPEEFVGDYWRNFQRALRNILGVRKNDIQIVSLQPS--------------------------------------------EPHSHLDVLLFV-ERSGGTHVSTKQLLHKINSSVTDVEEIIGVRILEVFQKLCAGLD-CPWKFCDEKVSVDENVMSTHSTAR-LSFVTPRHHRTAVCLCK---DGT-CPPVHHGCEDNPCPAGSECVADP-REEKYSCVCP---GGGFGKCP----GSSS--------------ITFTGNSFVKYRLLENENRLEMKLSMRLRTYSSHAVVMYARGTDYS--ILEIHT-GRLQYKFDCGSGPGIVSVQSIQ-VNDGQWHAVSLEVEG------NYAKLVLDEVHTASGTAPGALKTLNLDNYVFFGG--HLRQQGTKHGRGAQVASGFRGCMDSIYLNGQELPLNNKPRAYAHIEEWV---DLSHGCLLTATED-CSSSPCQNGGVC-----NPSPTGGYYCKCSALYVGTFCEVSVNPCSSNPCLYGGTCMVDNGGFVCQCRGLYTGQRCQLSPYCKD--DPCKNGGTCFDS-----LDGAVCQCDSGFRGERCQSDIDECAGNP--CRNG-ALCENTHGSYHCNCSQEYRGKHCE 4188          

HSP 2 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 776/3014 (25.75%), Postives = 1313/3014 (43.56%), Query Frame = 3
Query: 4980 FHINSNNGDLRLISPANAYSNQTFDIIVEARNKRATYM-KLQIHILDTNNMYPEF-----------------------LVSREQSNMYMETLR-------------NLAKSQSSVLNEMDKLSIQRHLDNSLI----------FSFTWIDVG---------------------SSIGTLLTSISATDQDYGRNGQLVFAIKNDSVALNYFEMDQNNGDIRVQRSLTAIRNRLLFLTIVVSDLGQPPRINRSVVAVEIRDKRMSHSLPQLEESQLDLVVHENTSVNSILHCXXXXXXXXXXXXAQYVVLSIKPST-GKLFGVTRSTGCIITVSSLDREQIQDIVSMDIQVQSYDGLVSRYNSIISVKIHIADVNDNAPRFLGPLKLNGIISESANPGSLVFLQSDGEKLSKSLKALVINAEDPDEGKNGQIEYVILS-RFASYFKIDQYTGVLSLALKIDREVVGSFVDLSIRLQDKGSPKLLSQERLEIMIIIEDENDCPPKFEKDFYLQVLILPTFPSAPLLQLRVHDPDLNP--TILFSILNGKESRFFSIDPTTGWLKISTNDIPVSGKFPSVVLINIRAFDGKFETSCNITINSFDNTRNKVLPLEKSQVVWEIPENRNDVPDLVLPRAKFYFSHQHPSIKYILLSEQPKVEINEITGSLKLKS-ALDREERPFVQLLV-LAKGWDGSYDYINVTVSVT-DENDYKPMFLSEKYEFLVHTNLSKEAQSIR-VKAIDLDAGENGTVIYSIYYVKPFAYDLKFAIDSNSGVITIQSGPSKELLGKKFTIGIKANDKGQPALSSFTDVFVDIVSDKSPLFDKSKYSVIVPEDALKDFIVTTVKAISSTGHTILYTITNGNDEELFDLDFTAAYLQPGPCVIRLVGKLDYETKPFHTLIISATDPSSSLSHSTTVLITVLDINDELPIFLKSSYSASVSENMPINHEIISISVLLQKVSNSKIVEFSLKLIEDSSPCSSQHFRINGTTGTISIKENLDFEACMIHEFWILVKYDGRFSPTNRAHMQVHIVDENDNPPKFIQPAFNATISLESSQGSLVVIAMATDLDTNS--KLIYKVLN-EYYNIFKIDQSSGFIRFNQVPNIEKLLPSSGVVEFQVLVHDFTHXXXXXXXXXXXXIKNHPPSFVMNEFHMSVSENFTVNSEIGRIVASDSDKNKFGRLRYHVIGGFDSEIFGLDSLTGALLLKKTLDRE--RKSMHELRVVVSDYGNKHDFATVLIHVTDINDNIPVIEQAYYEVTVILSTKSTGTTLESILQLHAKDRDVSPRHRMDYRLVSPPLSQSIAF---VDSITGAVSLKPSWINQNSNLGLNNTKSKLEVYQIAFQVCEEPLYSYRIATTVISCSINVTVKINILYDKKKV----NPIITCSIMTIQENNPLNHIVAMCRISSTEMKGK--WSLVPSSSPFDVQNDF-EIDSNYGYIRAKKIMDFETQSQYRINVEYR--VDNSPLMATRTILIDLIDQNDCPPIFDNSRYAIFISEDIPLGSKVIQCKAYDKDYEGKDVIFYSLYQLDSVETGVSFRID-DQGWVYSVSAVDYEETKLINLVVSASDKAGHV---TNTTLTISVYDVNDEIPYWTKNPPVDGIEITETCDGCSETFPRVVYRLSAKDNDSESQKESLHFLITNQNLNPFYAYFRVSESGEVLLLHPLDAEKILKPLQLKFLASDRLHWSKEEFILNIRVIDVNDHAPVCPQIP-DLMIFEGITPGSVITTLQAYDRDSSAKYNTLTYTLMECSDPYLLVVEPLTGRVIVNAPLDREFSSTVNFVVHALDVESKKCSFKILINVLDINDNAPRFVHTSIAPF----LENAPHGSVIGKIHAVDADSGINRKIVYRILDESKSSFSIDRDTGIMRVASLLDRERQPEHHLVIEASDCGKPPKSNITNVKIV-LLDVNDSPPQFINIPIKLRVAEDTEIGKVLITIKAISDDIGVNAEVSYQMIT--EQNFFRLESLSGNLTLIKKLDFELSREYFLTVRASDKGYPSLSTTTGXXXXXXXXXXXXXXXXFLPYVFNIPENTLVSKLTIGKVTAYDSDSGLNSMLTYSFLYWLPEQKWNNRSTLNHIEHFFRINPKTGEIFLNFVPDREEQPTYKFQVSVTDHGIPAFSSKTNVTIEIEDKNDNPPEFAQPSFRFLIQVDRSGIIPDQELKKNGDMFEVGRLHIKDKDGPTNSNPFQCKLLNAETVSPFLVKTDELTDECILLVAGSLYLGVRT---LWVQVTDNGQPSLYCRVQVAVNVIRLSNIPPEIEPLNVTYVYFHSETIIGKELEIARVLVRDRSPAFDMLTFEFVYNETLKSRVNNNFFKIDSFTGAITTTEMLDSGMYSLNVKVTNVTLSTEKVIFIKIVALTKDMIRSACVIQVSSMKP----------------NIFFARRLDLKLIHFLKSVMASKLAYIIXXXXXXXXXXXXXXXXXXDRSFSRVSNRRIRRQLAPDDVVDVLIAVYNENEYRFFKSSALVDRIKTLTPDLTKIFQASSVKIFNNVCDDKHICVEGQCQTTIIVNPKLPPINFQVHGVTFLSLDFSYESSCLCTKHFEGVRCEIPMNKCAHKPCGSFRVCRPDPTKSPGFVCECPELKSGKYCERPSIIEGNSSCLDEQCILAKVSEPIHFTGGGFIIWYLREKGNALRMEVIFSFRVLQKPAPLMEIQWNSIRSILIDINSDGKVLISADHKTVPLIDLYESVNPMADGKWHNVRLSILGVVNMPDWWLHVVIDGLQPRLLSLSSWIEGDHFNQTILIGARNYISTREYNLEKSVILDESMTGCIQDVILNNQKLPYQQLPAPVPSSSLGVLSKNLNYGCSESLMRSLCAAGVCKNGGLCLIRDYENDNKRSYVCQCQETFTGRNCEIPNSICRHSPCVHGGKCVDTKSG-FKCICPDGLTGPRCQWG-KSCSSLLNPCPTFATCIEKTINSLYSSAVCDCSQTLRGYMCQIDVDECQIQPPLCKPGRGICHNLHSGYQCNCTLGYRGHHCEID 13643
            F ++   G + +  P +A    ++++ VEA +   T + ++ I ++DTN+  P+F                        V R++ N  + TL+             + A        ++D  +I +H+   ++          F+   ++V                      +++G+++  ++A D+D GRN +++++I++ ++  N F +D   G I+  R L         L +  +D G PP     + +V I      ++ P+    +    + E   + S +  +   S +        V+  I+    G  F +   +G IIT  +LD E +  + S+ +Q  +  GL +      +V +H+ D NDN P F    + +G ISESA+  S+V        L+     LVI A D D   N  + Y I+     +YF ID  TG +   L +D E   +F   ++++ D G+P+L ++    + + + D NDCPP F K  Y   L+LPT+    ++ +   D D      +++SI  G     FS+D  TG + I       + +  S   + +RA DG+F +  ++ IN  ++  +   PL+ +Q  +      N      L       +  +  + Y +L+   + +I+  +G L       DRE++    ++V + K  + S     V      D+ND  P+F++  Y  +V  + ++    IR V AID D+G NG + Y   Y+K   +   F I   SG I+++     + L K++ + + A D G PA S+   V + +++   P+F+K+ YS  +PE+      V  ++A S  G  + Y+IT+G+    F ++F          V+ ++  LD+E+ P + L + ATD  +       V I V DIND  P+F++ SYS ++SE   I   ++ +         ++ +  S +LI + S  S  HF I+  TG IS+   LD+E    H  ++     G  + ++   + V + D NDNPP F Q  + A IS  ++ G  V+   A D D++   KL Y +L+   +  F ID+ +G I  + +     L P        V V D      A V+V  +    H P F  NE+ + ++EN  +++ + ++ ASD D   +  + YH++  F  + F ++       L+K LDRE   + +  +R++  D G K  F TV + +TD NDN P      YEV  I S+ + GT   S++++ A D D      + Y + +   S+S+     ++ +TG ++ K S I      GL N       +  A      P  S             V V I IL  + ++     P  T    TI E+ P+   + + R+   E  G   + LV  ++P   +++F  ID   G ++ +K +D ET   Y+ ++  R  +D+  ++A+  + I + D ND  P+ ++S Y  FI E++P GS+VIQ +A D D      + YSL Q    +   SF I+ + GW+ ++  +D+EE     + V ASD    V   +   + ++V DVND  P +T        EI +      +    V+  LS  D D+E     + + IT  +    +A   V     V +  PLD E+    L L   A+D    SK    + ++V+D ND++PVC +      I E   PG ++  + A D D  +    +TYTL   S      + P TG +   A LDRE  +  N +V A D   + C   I++ + D+NDNAP F   +  P+     EN   G+ + ++ A DAD+G+NRKI Y +++ +   FSI+  +GI+++   LDRE Q  + L ++A D G P +   T   +V +LD+ND+PP F        V+ED  IG  ++ + A S DI  NAE++Y +I+  E   F ++S +G + +I+ LD+E S EY+LTV A+D G PSLS    V I V D+NDN P F    Y   + E+  + +  I  + A D+D   NS + YS +      + N  S        F I+P  GE+ +    DRE    Y   V   D+G P   + T V I++ D NDN P F++ ++  +IQ          E K  G  F V +L + DKD   N  PF   +++    + F     E+    +LL A ++   V+    L V+V D+G+P L     + + VI  S  PP I PL +    F  E   G    I ++   D+   +D L +      +L   ++   F + S  G +     LD G Y LNV VT+   +T   I + I  +T++M+     I+ +++ P                NI   R+ D++++    S                                             P   +DVL+ V          +  L+ +I +   D+ +I     +++F  +C     C    C   + V+  +   +     ++F++      + CLC    +G  C    + C   PC +   C  DP +   + C CP    G + + P    G+SS              I FTG  F+ + L E  N L M++    R     A +M  +       +++I++ G++    D  + P I   +S+  + DG+WH V L + G       +  +V+D +     +    ++  + +  +  G   ++  +     +   +     GC+  + LN Q+LP    P         V   +L++GC                    L+   E+                         C  SPC +GG C  + +G + C C     G  C+     CSS  NPC    TC+           VC C     G  CQ+    C+  P  CK G G C +   G  C C  G+RG  C+ D
Sbjct: 1427 FDVDKGTGTIIVAKPLDAEQKSSYNLTVEATDGTTTILTQVLIKVIDTNDHRPQFSTSKYEVAVPEDTEPEVEILQISAVDRDEKNKLIYTLQSSIDPASLKKFRLDPATGALYTAEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYESAAVGSVVLQVTALDKDKGRNAEVLYSIESGNIG-NSFTIDPILGSIKTARELDRSHQVDYDLMVKATDKGDPPM--SEMTSVRIAVTVADNASPKFTSKEYSAEISEAIRIGSFVGMVSAHSQSS-------VMYEIRDGNMGDAFNINPHSGSIITQRALDFETLP-MYSLTVQGTNMAGLSTN----TTVVVHVRDENDNPPVFT-QAEYSGFISESASVNSVV--------LTDRNVPLVIRATDADRESNALLVYQIVEPSVHNYFAIDPTTGAIRTVLSLDYEETHAF-HFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFSKSLYEVSLLLPTYRGVNVITVNATDADSKAFSQVMYSITEGNIGEKFSMDHKTGTIAIQN-----TTQLRSRYELTVRASDGRFTSMASVKINVKESRES-