Phospholipid scramblase

Overview
NamePhospholipid scramblase
Smed IDSMED30026580
Length (bp)1248
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phospholipid scramblase (SMED30026580) t-SNE clustered cells

Violin plots show distribution of expression levels for Phospholipid scramblase (SMED30026580) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phospholipid scramblase (SMED30026580) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phospholipid scramblase (SMED30026580) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026580

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026580SMESG000023380.1 SmedASXL_010227SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30026580SMESG000047456.1 SMESG000047455.1 dd_Smed_v4_6988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026580SMESG000047456.1 SMESG000047455.1 dd_Smed_v4_6988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026580SMESG000047456.1 SMESG000047455.1 dd_Smed_v4_6988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30026580SMESG000047456.1 SMESG000047455.1 dd_Smed_v4_6988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30026580SMESG000047456.1 SMESG000047455.1 dd_Smed_v4_6988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026580SMESG000047456.1 SMESG000047455.1 dd_Smed_v6_6988_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 214.542 bits (545), Expect = 5.175e-66
Identity = 118/254 (46.46%), Postives = 161/254 (63.39%), Query Frame = 3
Query:  393 NPVITIKEYNQNIVTNYISKLPPPHPPC-----IDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRER 1139
             PV     YNQ +    +  +P P PP      ++YL+ IDQ+++ Q IE++EV++G ETNN Y+IKN+ GQ++Y A E ++ C +NC G  RPFT+ + DN   EVI + RP +C     C  CLQ    EIE+QAP G  +GYV Q    C  ++ I N  +E VLK++GP    C C G DV F + + D    VGKI+K W+ + +E FTDADNFGIQFP+DLD K+KAV++GA FLIDFMFFE+ G + 
Sbjct:   59 QPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSC-CCPCCLQ----EIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPC-VVCSCCG-DVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFESTGSQE 305          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 214.542 bits (545), Expect = 5.411e-66
Identity = 118/253 (46.64%), Postives = 161/253 (63.64%), Query Frame = 3
Query:  396 PVITIKEYNQNIVTNYISKLPPPHPPC-----IDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRER 1139
            PV     YNQ +    +  +P P PP      ++YL+ IDQ+++ Q IE++EV++G ETNN Y+IKN+ GQ++Y A E ++ C +NC G  RPFT+ + DN   EVI + RP +C     C  CLQ    EIE+QAP G  +GYV Q    C  ++ I N  +E VLK++GP    C C G DV F + + D    VGKI+K W+ + +E FTDADNFGIQFP+DLD K+KAV++GA FLIDFMFFE+ G + 
Sbjct:   67 PVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSC-CCPCCLQ----EIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPC-VVCSCCG-DVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFESTGSQE 312          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 200.675 bits (509), Expect = 1.078e-61
Identity = 106/216 (49.07%), Postives = 144/216 (66.67%), Query Frame = 3
Query:  489 TAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRE 1136
            + IDQ+++ Q IE++EV++G ETNN Y+IKN+ GQ++Y A E ++ C +NC G  RPFT+ + DN   EVI + RP +      C  CLQ    EIE+QAP G  +GYV Q    C  ++ I N  +E VLK++GP    C C G DV F + + D    VGKI+K W+ + +E FTDADNFGIQFP+DLD K+KAV++GA FLIDFMFFE+ G +
Sbjct:   22 SKIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLR-CSSCCCPCCLQ----EIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCV-VCSCCG-DVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFESTGSQ 230          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR3 (phospholipid scramblase 3 [Source:HGNC Symbol;Acc:HGNC:16495])

HSP 1 Score: 186.808 bits (473), Expect = 1.698e-55
Identity = 91/221 (41.18%), Postives = 136/221 (61.54%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKG 1130
            P  +++L  IDQ+++ Q  E +E   G ET N Y++++  GQ +  A E S  C + C G++RP  + L D  + EV++++RP  C       SC  C   E+EVQAP G T+G+V Q       +++I +  ++TVL++ GP +  C C G D  F +   D    VG+I+KQW  L +E  TDAD+FG+QFP+DLD ++KAV+LGA FLID+MFFE +G
Sbjct:   73 PSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDREVLRLLRPLHCGC-----SCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCW-TCGC-GTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRG 286          
BLAST of Phospholipid scramblase vs. Ensembl Human
Match: PLSCR3 (phospholipid scramblase 3 [Source:HGNC Symbol;Acc:HGNC:16495])

HSP 1 Score: 186.808 bits (473), Expect = 1.698e-55
Identity = 91/221 (41.18%), Postives = 136/221 (61.54%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKG 1130
            P  +++L  IDQ+++ Q  E +E   G ET N Y++++  GQ +  A E S  C + C G++RP  + L D  + EV++++RP  C       SC  C   E+EVQAP G T+G+V Q       +++I +  ++TVL++ GP +  C C G D  F +   D    VG+I+KQW  L +E  TDAD+FG+QFP+DLD ++KAV+LGA FLID+MFFE +G
Sbjct:   73 PSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDREVLRLLRPLHCGC-----SCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCW-TCGC-GTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRG 286          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-2 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:G5EEQ3])

HSP 1 Score: 153.68 bits (387), Expect = 1.209e-43
Identity = 89/261 (34.10%), Postives = 141/261 (54.02%), Query Frame = 3
Query:  348 PNYVCVLNKSMIHVQNPVITIKEYNQNIVTNYISKLPPPH--PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFEN 1124
            P+YV + ++++     P  +I+     I   ++  LP     P  ++YL  +D ++V Q  E++E+++G E+ N Y I+N  GQQ Y A E S   ++ C GSQR FT+H+ DN    V+ + R  +C     C  CL   ++   +++     LG V Q +   +  Y I++     +  ++G   C   C  +D  F +   D   P+G I K+W  L +E FTDAD F + FP+DLD K+KA++LGA FLIDF+ FEN
Sbjct:   10 PDYVEIEDRAI--TTEPGASIQAAPGAI---WMEALPAIEGIPAGLEYLAYLDTVMVHQVKEVLEILTGWESKNKYAIRNKNGQQCYYAFEESNAWERQCCGSQRGFTMHIVDNFNKNVLIVKRELRCCADSFC-GCLLGLQNICTIESLSTGLLGTVLQGYGCTNSFYNILDKDGNLIFLVDGQGCCTSCCC-EDKDFTIKTPDSSVPIGSITKKWGGLLREAFTDADTFAVTFPIDLDVKLKAILLGATFLIDFVEFEN 263          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 150.984 bits (380), Expect = 2.421e-42
Identity = 90/235 (38.30%), Postives = 127/235 (54.04%), Query Frame = 3
Query:  462 PHPPCI-------DYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIE--VQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRER 1139
            P PP I       +YLT +D ++V Q  E+IE+++  ET N Y +KN  G+Q Y A E S  C++ C G QR F +H+ DN + EV+ I R  KC   G C         + E  ++ P    LG ++Q     S  Y IM+     + +++GP  C   C   D  F +  ++  T VG I K+W   F+E FTDAD F + FP DLD K+K V++GA FLIDFM FE + + R
Sbjct:   52 PMPPAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCM-LCGCQDKEFPIKTANNGTVVGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFEQQSQNR 285          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 150.984 bits (380), Expect = 2.421e-42
Identity = 90/235 (38.30%), Postives = 127/235 (54.04%), Query Frame = 3
Query:  462 PHPPCI-------DYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIE--VQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRER 1139
            P PP I       +YLT +D ++V Q  E+IE+++  ET N Y +KN  G+Q Y A E S  C++ C G QR F +H+ DN + EV+ I R  KC   G C         + E  ++ P    LG ++Q     S  Y IM+     + +++GP  C   C   D  F +  ++  T VG I K+W   F+E FTDAD F + FP DLD K+K V++GA FLIDFM FE + + R
Sbjct:   52 PMPPAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCM-LCGCQDKEFPIKTANNGTVVGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFEQQSQNR 285          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 150.984 bits (380), Expect = 2.562e-42
Identity = 90/235 (38.30%), Postives = 127/235 (54.04%), Query Frame = 3
Query:  462 PHPPCI-------DYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIE--VQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRER 1139
            P PP I       +YLT +D ++V Q  E+IE+++  ET N Y +KN  G+Q Y A E S  C++ C G QR F +H+ DN + EV+ I R  KC   G C         + E  ++ P    LG ++Q     S  Y IM+     + +++GP  C   C   D  F +  ++  T VG I K+W   F+E FTDAD F + FP DLD K+K V++GA FLIDFM FE + + R
Sbjct:   52 PMPPAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCM-LCGCQDKEFPIKTANNGTVVGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFEQQSQNR 285          
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Match: scrm-1 (Phospholipid scramblase [Source:UniProtKB/TrEMBL;Acc:Q7JKP1])

HSP 1 Score: 150.984 bits (380), Expect = 2.646e-42
Identity = 90/235 (38.30%), Postives = 127/235 (54.04%), Query Frame = 3
Query:  462 PHPPCI-------DYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIE--VQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRER 1139
            P PP I       +YLT +D ++V Q  E+IE+++  ET N Y +KN  G+Q Y A E S  C++ C G QR F +H+ DN + EV+ I R  KC   G C         + E  ++ P    LG ++Q     S  Y IM+     + +++GP  C   C   D  F +  ++  T VG I K+W   F+E FTDAD F + FP DLD K+K V++GA FLIDFM FE + + R
Sbjct:   52 PMPPAIQGVPTGLEYLTYLDTIMVHQIKELIEIVTDWETKNKYVLKNANGEQCYYAFEESGCCERQCCGPQRGFVMHIVDNFKREVLTIKREFKCCGGGCCGCLACIGCCQQECIIETPSMGVLGIIRQRCGCMSSNYDIMDGDGNVIFQIDGPCCCM-LCGCQDKEFPIKTANNGTVVGAITKKWGGCFREAFTDADTFAVNFPGDLDVKLKGVLIGATFLIDFMEFEQQSQNR 285          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076302)

HSP 1 Score: 206.838 bits (525), Expect = 2.057e-64
Identity = 104/227 (45.81%), Postives = 148/227 (65.20%), Query Frame = 3
Query:  459 PPHPPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCL-QCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRE 1136
            P  P  ++YLT IDQL+V+Q +E++E  +G ETNN + IKN +GQ++Y A E ++ C +NC G  RPF + ++DN + EVI + RP  C       SCL  CC   IEV AP G  +G ++Q    CS  + I+N++ +TV+++ GP   +  C   DV F +++  G   +GKI+KQWS L +E+FTDAD FGI FP+DLD ++KAV+LGA FLID MFFE  G +
Sbjct:    8 PNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACS------SCLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLC--GDVEFNVVSLTG-EKIGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFEKAGNQ 225          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076303)

HSP 1 Score: 207.608 bits (527), Expect = 2.206e-63
Identity = 104/227 (45.81%), Postives = 148/227 (65.20%), Query Frame = 3
Query:  459 PPHPPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCL-QCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRE 1136
            P  P  ++YLT IDQL+V+Q +E++E  +G ETNN + IKN +GQ++Y A E ++ C +NC G  RPF + ++DN + EVI + RP  C       SCL  CC   IEV AP G  +G ++Q    CS  + I+N++ +TV+++ GP   +  C   DV F +++  G   +GKI+KQWS L +E+FTDAD FGI FP+DLD ++KAV+LGA FLID MFFE  G +
Sbjct:  107 PNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACS------SCLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLC--GDVEFNVVSLTG-EKIGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFEKAGNQ 324          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076301)

HSP 1 Score: 206.453 bits (524), Expect = 4.829e-62
Identity = 102/222 (45.95%), Postives = 146/222 (65.77%), Query Frame = 3
Query:  477 IDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCL-QCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRER 1139
            ++YLT IDQL+V+Q +E++E  +G ETNN + IKN +GQ++Y A E ++ C +NC G  RPF + ++DN + EVI + RP  C       SCL  CC   IEV AP G  +G ++Q    CS  + I+N++ +TV+++ GP   +  C   DV F +++  G   +GKI+KQWS L +E+FTDAD FGI FP+DLD ++KAV+LGA FLID MFFE  G + 
Sbjct:  197 LEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACS------SCLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLC--GDVEFNVVSLTGEK-IGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFEKAGNQE 409          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: scramb2 (gene:FBgn0035390 transcript:FBtr0073005)

HSP 1 Score: 191.045 bits (484), Expect = 7.005e-58
Identity = 105/263 (39.92%), Postives = 159/263 (60.46%), Query Frame = 3
Query:  342 EDPNYVCVLNKSMIHVQNPVITIKEYNQNIVTNYISKLPPPHPPC---IDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFE 1121
            +D N   VL     +V N        N N   N++S +P   P C   ++YLTA+DQL+V Q IE +E+++G ET N +K+KN++GQ +Y A E S+ C +N LG  RPF + + DN + EV+ + RP KC +    L C   C + +EV AP GQ +G V+Q+      ++ I N   +TVL++ GP  C C C  D    +L A++    +GKI+KQWS L +E+FTDAD F + FP++LD ++KA++  A+FLID +++E
Sbjct:   16 QDENGAVVLQPQAANVGN--------NANGPENWMS-IPVGMPNCPQGLEYLTALDQLLVSQKIEKLELLTGFETKNRFKVKNSLGQNVYFAYEESDCCTRNMLGRSRPFEMKILDNFQNEVLHLYRPFKCDI----LCCFPSCMNAVEVSAPPGQVIGSVEQVCTFMRPKFNIKNTCGDTVLQIEGP-VCPCKCFSDTNFKVLSANN--EEIGKISKQWSGLGRELFTDADYFSVTFPLNLDVRMKALIFAALFLIDAVYYE 262          
BLAST of Phospholipid scramblase vs. Ensembl Fly
Match: CG9084 (gene:FBgn0033582 transcript:FBtr0088197)

HSP 1 Score: 68.1662 bits (165), Expect = 1.699e-12
Identity = 54/228 (23.68%), Postives = 102/228 (44.74%), Query Frame = 3
Query:  480 DYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMN-NLKETVLKLNGP---SYCYCYCPGDDVPFILMASDGVTPVGKIAKQW--------SNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENK 1127
            D L  +  + +EQ  E+ + ++G+ + N Y +++ +G  I+ A ESS   ++   G+ RPF +HL D    E + + R    M        + C    +E+  P G  LG V Q        + I + +  +    + GP    +C C+    D  F + +   +     I  +W        +N++   F+DA          L  K +A++LG+ FL++++FF+ +
Sbjct:   69 DCLADLPSVHIEQTFELNDALTGVSSENRYVVRSPLGDAIFAANESSTEKNRLLWGAGRPFQMHLLDKTHQEAL-VFRKKLAM------GSMCCQAKSLEIWIPPGNLLGKVVQSPTFMQPEFFIEDESTGQLTFCVEGPVGLGFC-CFSLPKDCYFKIHSGGNMR--ASIDHKWLASKSQYTTNIY---FSDA---------KLTAKERALILGSAFLLEYLFFQTR 274          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: plscr3b (phospholipid scramblase 3b [Source:ZFIN;Acc:ZDB-GENE-040426-2517])

HSP 1 Score: 229.565 bits (584), Expect = 5.714e-72
Identity = 115/223 (51.57%), Postives = 156/223 (69.96%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCL-QCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGV-TPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKG 1130
            PP ++YLT IDQ+++ Q +E++E   G ETNN Y+IKN++GQ+IY AKE ++ C +NC G+ R F + + DN + EVI++IRP++      C+SC   CC  E+E+QAP G  +GYVKQ    C  +++IM   KETV+KL GP    C C G DV F L   DG   P+G+I+KQW+ L KE+FTDADNFGIQFP+D+D K+KAV++G  FLIDFMFFE  G
Sbjct:   90 PPGLEYLTQIDQILIHQKVELLEAFIGFETNNQYEIKNSLGQKIYSAKEKNDCCTRNCCGALRSFDMKIKDNMDREVIRLIRPYR------CVSCWCPCCLQEMEIQAPPGTPIGYVKQDWHPCYPKFSIMGPNKETVMKLEGPCMA-CNCCG-DVHFELKGKDGTGKPIGRISKQWTGLLKEVFTDADNFGIQFPLDMDVKMKAVLMGTCFLIDFMFFEKVG 304          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: plscr3b (phospholipid scramblase 3b [Source:ZFIN;Acc:ZDB-GENE-040426-2517])

HSP 1 Score: 229.565 bits (584), Expect = 5.714e-72
Identity = 115/223 (51.57%), Postives = 156/223 (69.96%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCL-QCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGV-TPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKG 1130
            PP ++YLT IDQ+++ Q +E++E   G ETNN Y+IKN++GQ+IY AKE ++ C +NC G+ R F + + DN + EVI++IRP++      C+SC   CC  E+E+QAP G  +GYVKQ    C  +++IM   KETV+KL GP    C C G DV F L   DG   P+G+I+KQW+ L KE+FTDADNFGIQFP+D+D K+KAV++G  FLIDFMFFE  G
Sbjct:   90 PPGLEYLTQIDQILIHQKVELLEAFIGFETNNQYEIKNSLGQKIYSAKEKNDCCTRNCCGALRSFDMKIKDNMDREVIRLIRPYR------CVSCWCPCCLQEMEIQAPPGTPIGYVKQDWHPCYPKFSIMGPNKETVMKLEGPCMA-CNCCG-DVHFELKGKDGTGKPIGRISKQWTGLLKEVFTDADNFGIQFPLDMDVKMKAVLMGTCFLIDFMFFEKVG 304          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 215.698 bits (548), Expect = 7.395e-68
Identity = 113/227 (49.78%), Postives = 150/227 (66.08%), Query Frame = 3
Query:  444 ISKLPPPHPPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFEN 1124
            + + P   PP ++YLT IDQL+V+Q +E+ EVI G ETNN Y +KN+MGQQ++   E ++ C++   G  R F IH+ DN   EV++++RP KC   G C     CC  E+E+Q+P G  +GYV Q       ++ I N  KE VLK+ GP +C C C   DV F +++ D  T VGKI+KQW+ L +E FTDADNFGI FPMDLD KIKAV+ GA FLIDFMFFE+
Sbjct:    4 VPQRPDGCPPGLEYLTQIDQLLVQQKVELAEVILGWETNNKYIVKNSMGQQVFYVAEENDCCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLKC---GSCFC--PCCLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGP-FCSCRC-CSDVNFDVLSLDESTKVGKISKQWTGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFEH 223          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 215.698 bits (548), Expect = 7.395e-68
Identity = 113/227 (49.78%), Postives = 150/227 (66.08%), Query Frame = 3
Query:  444 ISKLPPPHPPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFEN 1124
            + + P   PP ++YLT IDQL+V+Q +E+ EVI G ETNN Y +KN+MGQQ++   E ++ C++   G  R F IH+ DN   EV++++RP KC   G C     CC  E+E+Q+P G  +GYV Q       ++ I N  KE VLK+ GP +C C C   DV F +++ D  T VGKI+KQW+ L +E FTDADNFGI FPMDLD KIKAV+ GA FLIDFMFFE+
Sbjct:    4 VPQRPDGCPPGLEYLTQIDQLLVQQKVELAEVILGWETNNKYIVKNSMGQQVFYVAEENDCCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLKC---GSCFC--PCCLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGP-FCSCRC-CSDVNFDVLSLDESTKVGKISKQWTGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFEH 223          
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 215.698 bits (548), Expect = 7.395e-68
Identity = 113/227 (49.78%), Postives = 150/227 (66.08%), Query Frame = 3
Query:  444 ISKLPPPHPPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFEN 1124
            + + P   PP ++YLT IDQL+V+Q +E+ EVI G ETNN Y +KN+MGQQ++   E ++ C++   G  R F IH+ DN   EV++++RP KC   G C     CC  E+E+Q+P G  +GYV Q       ++ I N  KE VLK+ GP +C C C   DV F +++ D  T VGKI+KQW+ L +E FTDADNFGI FPMDLD KIKAV+ GA FLIDFMFFE+
Sbjct:    4 VPQRPDGCPPGLEYLTQIDQLLVQQKVELAEVILGWETNNKYIVKNSMGQQVFYVAEENDCCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLKC---GSCFC--PCCLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGP-FCSCRC-CSDVNFDVLSLDESTKVGKISKQWTGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFEH 223          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: insyn1 (inhibitory synaptic factor 1 [Source:Xenbase;Acc:XB-GENE-5931898])

HSP 1 Score: 219.164 bits (557), Expect = 9.574e-68
Identity = 108/219 (49.32%), Postives = 147/219 (67.12%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSY-CYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFE 1121
            PP ++YLT IDQ++V Q +E++EV++G ETNN Y+IKN++GQ++Y A E ++ C +NC G  RPF++ + DN   EV+++ RP +C        C  CC  ++EVQAP G T+GYV Q    C  ++ I +  ++ +LK+ GP   C C     DV F + + D    VG+I KQW+   KE FTDADNFGIQFPMDLD KIKAV+LGA FLIDFMFFE
Sbjct:  103 PPGLEYLTQIDQILVHQQVELLEVLTGFETNNKYEIKNSLGQRVYFAAEENDCCTRNCCGPSRPFSMTIVDNAGQEVMKLHRPCRCS-----ACCFPCCLQKLEVQAPPGTTVGYVIQNWHPCLPKFTIQDEREQGILKIKGPCIPCRCCA---DVKFEIKSMDESAVVGRITKQWTGFVKEAFTDADNFGIQFPMDLDVKIKAVLLGACFLIDFMFFE 313          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: insyn1 (inhibitory synaptic factor 1 [Source:Xenbase;Acc:XB-GENE-5931898])

HSP 1 Score: 218.779 bits (556), Expect = 1.648e-67
Identity = 108/219 (49.32%), Postives = 147/219 (67.12%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSY-CYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFE 1121
            PP ++YLT IDQ++V Q +E++EV++G ETNN Y+IKN++GQ++Y A E ++ C +NC G  RPF++ + DN   EV+++ RP +C        C  CC  ++EVQAP G T+GYV Q    C  ++ I +  ++ +LK+ GP   C C     DV F + + D    VG+I KQW+   KE FTDADNFGIQFPMDLD KIKAV+LGA FLIDFMFFE
Sbjct:  108 PPGLEYLTQIDQILVHQQVELLEVLTGFETNNKYEIKNSLGQRVYFAAEENDCCTRNCCGPSRPFSMTIVDNAGQEVMKLHRPCRCS-----ACCFPCCLQKLEVQAPPGTTVGYVIQNWHPCLPKFTIQDEREQGILKIKGPCIPCRCCA---DVKFEIKSMDESAVVGRITKQWTGFVKEAFTDADNFGIQFPMDLDVKIKAVLLGACFLIDFMFFE 318          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: ENSXETT00000012543.1 (phospholipid scramblase 2 [Source:NCBI gene;Acc:100489273])

HSP 1 Score: 201.06 bits (510), Expect = 3.031e-61
Identity = 101/218 (46.33%), Postives = 143/218 (65.60%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSY-CYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFF 1118
            PP ++YL+ IDQ++V Q +E++EV++G ETNN Y+IKN++GQ++Y A E ++ C +N  G  RPF + + DN   EV+++ RP +C        C  CC  ++EVQAP G  +GYV Q    C  ++ I +  ++ VLK++GP   C C     DV F +M+ D  + VG+I+KQW+   KE+FTD DNFGIQFPMDLD K KAV+LGA FLI   FF
Sbjct:   68 PPGLEYLSQIDQILVHQQVELLEVLTGFETNNKYEIKNSLGQRVYFAAEENDCCTRNYCGPSRPFAMTIVDNTGREVMKLHRPLRCS-----ACCFPCCLQKLEVQAPPGTVVGYVVQNWHPCLPKFTIQDEREQGVLKISGPCIPCRCC---TDVNFEVMSVDESSVVGRISKQWAGSVKEIFTDTDNFGIQFPMDLDIKTKAVLLGACFLIVSSFF 277          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: kpna6 (karyopherin alpha 6 (importin alpha 7) [Source:Xenbase;Acc:XB-GENE-946491])

HSP 1 Score: 148.288 bits (373), Expect = 1.110e-41
Identity = 82/193 (42.49%), Postives = 117/193 (60.62%), Query Frame = 3
Query:  525 EMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLI 1103
            ++  V  G E +N Y+IK+  GQ+ Y A E +E+ +KN  G  RPFT+ + ++   EVI IIRP +C+   HC  C  C   E+EVQAP+G T G++ Q  +    ++ I N  KE VL + GP Y    C GD V F +   +  + +GKI K WS    ++FT+ADNFGI+FP+DLD K+KA ++G  FLI
Sbjct:   15 DVFPVFLGTEKSNKYEIKDNFGQRFYFATEENEYFNKNFCGPVRPFTMRISNSRGQEVITIIRPLRCI---HC--CFPCYLQELEVQAPLGTTAGFIVQKWDPLLPKFIIQNESKEDVLIVIGP-YLTSSCFGD-VIFEVKTLNEESTIGKICKYWSGFVNDVFTNADNFGIEFPVDLDVKLKAALIGTCFLI 200          
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Match: kpna6 (karyopherin alpha 6 (importin alpha 7) [Source:Xenbase;Acc:XB-GENE-946491])

HSP 1 Score: 147.132 bits (370), Expect = 1.747e-41
Identity = 81/194 (41.75%), Postives = 115/194 (59.28%), Query Frame = 3
Query:  522 IEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLI 1103
             ++  V  G E +N Y+IK+  GQ+ Y A E +E+ +KN  G  RPFT+ + ++   EVI IIRP +C+   HC  C  C   E+EVQAP+G T G++ Q  +    ++ I N  KE VL + GP Y    C GD    I    +  + +GKI K WS    ++FT+ADNFGI+FP+DLD K+KA ++G  FLI
Sbjct:   13 FDVFPVFLGTEKSNKYEIKDNFGQRFYFATEENEYFNKNFCGPVRPFTMRISNSRGQEVITIIRPLRCI---HC--CFPCYLQELEVQAPLGTTAGFIVQKWDPLLPKFIIQNESKEDVLIVIGP-YLTSSCFGD---VIFETLNEESTIGKICKYWSGFVNDVFTNADNFGIEFPVDLDVKLKAALIGTCFLI 197          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr1 (phospholipid scramblase 1 [Source:MGI Symbol;Acc:MGI:893575])

HSP 1 Score: 222.246 bits (565), Expect = 5.390e-69
Identity = 111/220 (50.45%), Postives = 147/220 (66.82%), Query Frame = 3
Query:  477 IDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRE 1136
            ++YL  IDQL+V Q IE++EV++G ETNN Y+IKN++GQ++Y A E ++ C +NC G+ RPFT+ + DN   EV+ + RP +C     C  C  CC  EIE+QAP G  +GYV Q    C  ++ + N  K+ VLK+ GP      C   D+ F L + D  + VGKI+KQWS   +E FTDADNFGIQFP+DLD K+KAV+LGA FLIDFMFFE  G E
Sbjct:  108 LEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRC---SSC--CFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCC--SDIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNE 320          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr1 (phospholipid scramblase 1 [Source:MGI Symbol;Acc:MGI:893575])

HSP 1 Score: 222.246 bits (565), Expect = 5.390e-69
Identity = 111/220 (50.45%), Postives = 147/220 (66.82%), Query Frame = 3
Query:  477 IDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRE 1136
            ++YL  IDQL+V Q IE++EV++G ETNN Y+IKN++GQ++Y A E ++ C +NC G+ RPFT+ + DN   EV+ + RP +C     C  C  CC  EIE+QAP G  +GYV Q    C  ++ + N  K+ VLK+ GP      C   D+ F L + D  + VGKI+KQWS   +E FTDADNFGIQFP+DLD K+KAV+LGA FLIDFMFFE  G E
Sbjct:  108 LEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRC---SSC--CFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCC--SDIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNE 320          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr2 (phospholipid scramblase 2 [Source:MGI Symbol;Acc:MGI:1270860])

HSP 1 Score: 216.468 bits (550), Expect = 4.835e-67
Identity = 111/240 (46.25%), Postives = 152/240 (63.33%), Query Frame = 3
Query:  420 NQNIVTNYISKLPPPHP-----PCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFEN 1124
            NQ IV      +P P P     P ++YL  IDQL++ Q +E++EV++G ETNN ++IKN++GQ +Y+A E ++ C +NC  + RPFT+ + D+   EV+ + RP KC     C  C  CC  EIE+QAP G  +GYV Q    C  +  + N+ +E VLK+ GP      C   D+ F + + D VT +GKI KQWS   KE FTD+DNFGIQFP+DL+ K+KAV LGA FLID+MFFE 
Sbjct:   73 NQTIVLANTQWMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLKC---SSC--CFPCCLQEIEIQAPPGVPIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCC--SDIDFEIKSLDEVTRIGKITKQWSGCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFEG 305          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr2 (phospholipid scramblase 2 [Source:MGI Symbol;Acc:MGI:1270860])

HSP 1 Score: 216.468 bits (550), Expect = 4.835e-67
Identity = 111/240 (46.25%), Postives = 152/240 (63.33%), Query Frame = 3
Query:  420 NQNIVTNYISKLPPPHP-----PCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFEN 1124
            NQ IV      +P P P     P ++YL  IDQL++ Q +E++EV++G ETNN ++IKN++GQ +Y+A E ++ C +NC  + RPFT+ + D+   EV+ + RP KC     C  C  CC  EIE+QAP G  +GYV Q    C  +  + N+ +E VLK+ GP      C   D+ F + + D VT +GKI KQWS   KE FTD+DNFGIQFP+DL+ K+KAV LGA FLID+MFFE 
Sbjct:   73 NQTIVLANTQWMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLKC---SSC--CFPCCLQEIEIQAPPGVPIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCC--SDIDFEIKSLDEVTRIGKITKQWSGCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFEG 305          
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Match: Plscr3 (phospholipid scramblase 3 [Source:MGI Symbol;Acc:MGI:1917560])

HSP 1 Score: 193.356 bits (490), Expect = 3.176e-58
Identity = 96/224 (42.86%), Postives = 140/224 (62.50%), Query Frame = 3
Query:  459 PPHPPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKG 1130
            P  PP +++L  IDQ+++ Q  E +E   G ET N Y++++  GQQ+  A E S  C + C G++RPF I L D  + EV++++RP  C       SC  C   E+EVQAP G T+G+V Q       +++I++  ++ VL++ GP +  C C G D  F +   D    VG+I+KQW  L +E  TDAD+FG+QFP+DLD K+KAV+LGA FLID+MFFE +G
Sbjct:   71 PGVPPGLEFLVQIDQILIHQKAERVETFLGWETCNMYELRSGTGQQLGQAAEESNCCARLCCGARRPFRIRLADPGDREVLRLLRPLHCGC-----SCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSILDADRQPVLRVVGPCW-TCGC-GTDTNFEVKTKDESRSVGRISKQWGGLLREALTDADDFGLQFPVDLDVKVKAVLLGATFLIDYMFFEKRG 287          
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Match: sp|Q3ZBG9|PLS2_BOVIN (Phospholipid scramblase 2 OS=Bos taurus OX=9913 GN=PLSCR2 PE=2 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 8.259e-69
Identity = 118/247 (47.77%), Postives = 157/247 (63.56%), Query Frame = 3
Query:  387 VQNPVITIKEYNQNIVTNYISKLPPPH-PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSY-CYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFE 1121
            VQ+  +T        V    + LPP + PP ++YLT IDQL++ Q IE++EV+ G ETNN Y+IKN++GQ+IY A E ++ C +NC G  RPFT+ + DN   EVI + RP +C        C  CC  EIE+QAP G  +GYV Q    C  ++ I N  +E VL+++GP   C C     D+ F + + D    VGKI+K W+ L KE+FTD DNFGIQFP+DLD K+KAV+LGA FLIDFMFFE
Sbjct:   50 VQHQPVTGHPGAPTQVPWMPAPLPPLNCPPGLEYLTQIDQLLIHQQIELLEVLIGFETNNKYEIKNSLGQRIYFAAEDTDCCTRNCCGPSRPFTMRILDNMGREVITLERPLRCT-----SCCFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTIQNERREDVLRISGPCVICSCCA---DIDFEVKSLDDKYVVGKISKHWTGLIKELFTDVDNFGIQFPLDLDVKMKAVMLGACFLIDFMFFE 288          
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Match: sp|Q9JJ00|PLS1_MOUSE (Phospholipid scramblase 1 OS=Mus musculus OX=10090 GN=Plscr1 PE=1 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 3.771e-68
Identity = 111/220 (50.45%), Postives = 147/220 (66.82%), Query Frame = 3
Query:  477 IDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRE 1136
            ++YL  IDQL+V Q IE++EV++G ETNN Y+IKN++GQ++Y A E ++ C +NC G+ RPFT+ + DN   EV+ + RP +C     C  C  CC  EIE+QAP G  +GYV Q    C  ++ + N  K+ VLK+ GP      C   D+ F L + D  + VGKI+KQWS   +E FTDADNFGIQFP+DLD K+KAV+LGA FLIDFMFFE  G E
Sbjct:  108 LEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRC---SSC--CFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCC--SDIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNE 320          
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Match: sp|P58195|PLS1_RAT (Phospholipid scramblase 1 OS=Rattus norvegicus OX=10116 GN=Plscr1 PE=1 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 1.457e-67
Identity = 109/220 (49.55%), Postives = 147/220 (66.82%), Query Frame = 3
Query:  477 IDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRE 1136
            ++YLT IDQ++V Q IE++EV++G ETNN Y+IKN++GQ++Y A E ++ C +NC G+ RPFT+ + DN   EV+ + RP +C        C  CC  EIE+QAP G  +GYV Q    C  ++ + N  ++ VLK+ GP      C   D+ F L + D  + VGKI+KQWS   +E FTDADNFGIQFP+DLD K+KAV+LGA FLIDFMFFE  G E
Sbjct:  116 LEYLTQIDQILVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNMGREVMTLERPLRCS-----SCCFPCCLQEIEIQAPPGVPVGYVIQTWHPCLPKFTLQNEKRQDVLKVVGPCVVCSCC--SDIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNE 328          
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Match: sp|Q9DCW2|PLS2_MOUSE (Phospholipid scramblase 2 OS=Mus musculus OX=10090 GN=Plscr2 PE=1 SV=3)

HSP 1 Score: 216.468 bits (550), Expect = 3.382e-66
Identity = 111/240 (46.25%), Postives = 152/240 (63.33%), Query Frame = 3
Query:  420 NQNIVTNYISKLPPPHP-----PCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFEN 1124
            NQ IV      +P P P     P ++YL  IDQL++ Q +E++EV++G ETNN ++IKN++GQ +Y+A E ++ C +NC  + RPFT+ + D+   EV+ + RP KC     C  C  CC  EIE+QAP G  +GYV Q    C  +  + N+ +E VLK+ GP      C   D+ F + + D VT +GKI KQWS   KE FTD+DNFGIQFP+DL+ K+KAV LGA FLID+MFFE 
Sbjct:   73 NQTIVLANTQWMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLKC---SSC--CFPCCLQEIEIQAPPGVPIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCC--SDIDFEIKSLDEVTRIGKITKQWSGCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFEG 305          
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Match: sp|O15162|PLS1_HUMAN (Phospholipid scramblase 1 OS=Homo sapiens OX=9606 GN=PLSCR1 PE=1 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 2.598e-65
Identity = 118/253 (46.64%), Postives = 161/253 (63.64%), Query Frame = 3
Query:  396 PVITIKEYNQNIVTNYISKLPPPHPPC-----IDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRER 1139
            PV     YNQ +    +  +P P PP      ++YL+ IDQ+++ Q IE++EV++G ETNN Y+IKN+ GQ++Y A E ++ C +NC G  RPFT+ + DN   EVI + RP +C     C  CLQ    EIE+QAP G  +GYV Q    C  ++ I N  +E VLK++GP    C C G DV F + + D    VGKI+K W+ + +E FTDADNFGIQFP+DLD K+KAV++GA FLIDFMFFE+ G + 
Sbjct:   67 PVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSC-CCPCCLQ----EIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPC-VVCSCCG-DVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFESTGSQE 312          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: A0A075A1P0 (Phospholipid scramblase OS=Opisthorchis viverrini OX=6198 GN=T265_00773 PE=3 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 9.094e-91
Identity = 127/225 (56.44%), Postives = 174/225 (77.33%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRERG 1142
            PP ++YLT I+QL+V+Q  E+ E+++ IET N Y I NTMGQ +Y   E S FC + C  SQRP+T+H+ DN+ +EVI++ RP+KC     CLSC +CC+DE++V+AP+GQ +GYVKQI +GC+IRYAI ++  + VL+++GPSYC+C C G+D+ F +M++DG T VG+I KQWSN+ +EMFTDADNFGI FPMDLD +IKA ++GAVFLIDFMFFE+    R 
Sbjct:   10 PPGLEYLTQINQLLVKQKKELFEIMTDIETANRYVIVNTMGQTVYNCSEESNFCARQCCRSQRPYTMHVQDNSGMEVIRVKRPYKCYCCWECLSCSECCQDELQVEAPIGQLVGYVKQIQDGCNIRYAIKDSTGKQVLRIHGPSYCHCACFGEDINFKVMSADGNTEVGRITKQWSNIVQEMFTDADNFGIAFPMDLDVRIKATLIGAVFLIDFMFFEDNQPHRS 234          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: A0A267FIM7 (Phospholipid scramblase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000592g1 PE=3 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 4.030e-89
Identity = 122/224 (54.46%), Postives = 161/224 (71.88%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRER 1139
            PP + YL ++DQ++++Q  EMIE++ G ET N Y + N +GQQ++ AKE S  CD+ CLG+QRPF + + DN   EVI I RP+KCM +G C SC +CC D++ V+AP G+ +G V Q++EGCS  Y I +    TVL + GPSYC C+CPGDD+PF LM +DG   +GK+++QWSNL +E FTDADNFGI FPMDL   IKA +LGA FLIDFM+FE  G E 
Sbjct:   37 PPALQYLASLDQILIKQQKEMIEILIGWETANKYIVLNNVGQQVFFAKEDSSTCDRQCLGAQRPFEMLVTDNTGQEVIHISRPYKCMCYGQCFSCAKCCLDKVTVEAPPGRMVGTVTQVYEGCSANYTIQDAQGNTVLLIRGPSYCACHCPGDDIPFALMTTDGNNEIGKVSRQWSNLLQEYFTDADNFGITFPMDLHVDIKATILGACFLIDFMYFERSGNEH 260          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: G7YRN6 (Phospholipid scramblase OS=Clonorchis sinensis OX=79923 GN=CLF_108489 PE=3 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 1.006e-88
Identity = 122/224 (54.46%), Postives = 171/224 (76.34%), Query Frame = 3
Query:  459 PPHPPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKG 1130
            P  PP ++YLT I+QL+V+Q  E+ E+++ IE  N Y I NTMGQ ++  KE S FC + C   QRP+T+H++DN+  EVI+I RP+K +  G C SC +CC+DE+ V+APVGQ +GYVKQ+ +GC+IRY + +  +  VL ++GPSYC+C C G+D+ F++M++DG T VG+I KQWSN+ +E+FTDADNFGI FPMDLD ++KA ++GAVFLIDFMFFE+ G
Sbjct:   16 PNCPPGLEYLTQINQLLVKQKKELFEILTDIEVANRYIIVNTMGQTLFNCKEESNFCSRQCCKGQRPYTMHVHDNSGTEVIRIKRPYKYVCCGQCFSCAECCQDELTVEAPVGQVVGYVKQVQDGCNIRYMVKDASENVVLLIHGPSYCHCTCIGEDINFMIMSADGETEVGRITKQWSNIIQELFTDADNFGIAFPMDLDVRVKATLIGAVFLIDFMFFESNG 239          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: A0A1I8J971 (Phospholipid scramblase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 1.333e-88
Identity = 121/224 (54.02%), Postives = 161/224 (71.88%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRER 1139
            PP + YL ++DQ++++Q  EMIE++ G ET N Y + N +GQQ++ AKE S  CD+ CLG+QRPF + + DN   EVI I RP+KCM +G C SC +CC D++ V+AP G+ +G V Q++EGCS  Y I +    TVL + GPSYC C+CPGDD+PF LM +DG   +GK+++QWSNL +E FTDADNFGI FPMDL   IKA +LGA FLIDFM+FE  G + 
Sbjct:   27 PPALQYLASLDQILIKQQKEMIEILIGWETANKYIVLNNVGQQVFFAKEDSSTCDRQCLGAQRPFEMLVTDNTGQEVIHISRPYKCMCYGQCFSCAKCCLDKVTVEAPPGRMVGTVTQVYEGCSANYTIQDAQGNTVLLIRGPSYCACHCPGDDIPFALMTTDGNNEIGKVSRQWSNLLQEYFTDADNFGITFPMDLHVDIKATILGACFLIDFMYFERSGNKH 250          
BLAST of Phospholipid scramblase vs. TrEMBL
Match: A0A267GND1 (Phospholipid scramblase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000592g5 PE=3 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 1.547e-88
Identity = 121/224 (54.02%), Postives = 161/224 (71.88%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRER 1139
            PP + YL ++DQ++++Q  EMIE++ G ET N Y + N +GQQ++ AKE S  CD+ CLG+QRPF + + DN   EVI I RP+KCM +G C SC +CC D++ V+AP G+ +G V Q++EGCS  Y I +    TVL + GPSYC C+CPGDD+PF LM +DG   +GK+++QWSNL +E FTDADNFGI FPMDL   IKA +LGA FLIDFM+FE  G + 
Sbjct:   37 PPALQYLASLDQILIKQQKEMIEILIGWETANKYIVLNNVGQQVFFAKEDSSTCDRQCLGAQRPFEMLVTDNTGQEVIHISRPYKCMCYGQCFSCAKCCLDKVTVEAPPGRMVGTVTQVYEGCSANYTIQDAQGNTVLLIRGPSYCACHCPGDDIPFALMTTDGNNEIGKVSRQWSNLLQEYFTDADNFGITFPMDLHVDIKATILGACFLIDFMYFERSGNKH 260          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: plscr3b (phospholipid scramblase 2-like [Source:NCBI gene;Acc:103046260])

HSP 1 Score: 228.024 bits (580), Expect = 2.267e-71
Identity = 115/222 (51.80%), Postives = 153/222 (68.92%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCL-QCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKG 1130
            PP ++YLT IDQ+++ Q +E++E I G ETNN Y++KN+MGQ+IY AKE ++ C +NC GS R F + + DN + EVI++IRP +      C +C   CC  E+EVQAP G T+GYV Q    C  +++I    KETV+KL GP    C C G DV F L   DG   +G+I+KQWS L KE+FTD DNFGIQFP+D+D K+KAV++GA FLIDF+FFE  G
Sbjct:  102 PPGLEYLTQIDQVLIHQKVELLEAIIGFETNNQYEVKNSMGQKIYKAKEKNDCCTRNCCGSLRSFDMKIKDNTDREVIRLIRPFR------CATCWCPCCLQEMEVQAPPGTTIGYVTQDWHPCYPKFSIKGPNKETVMKLEGPCLA-CNCCG-DVNFELKGKDGGKSIGRISKQWSGLLKEVFTDTDNFGIQFPLDMDVKMKAVLMGACFLIDFIFFEKVG 315          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: plscr3b (phospholipid scramblase 2-like [Source:NCBI gene;Acc:103046260])

HSP 1 Score: 228.024 bits (580), Expect = 2.267e-71
Identity = 115/222 (51.80%), Postives = 153/222 (68.92%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCL-QCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKG 1130
            PP ++YLT IDQ+++ Q +E++E I G ETNN Y++KN+MGQ+IY AKE ++ C +NC GS R F + + DN + EVI++IRP +      C +C   CC  E+EVQAP G T+GYV Q    C  +++I    KETV+KL GP    C C G DV F L   DG   +G+I+KQWS L KE+FTD DNFGIQFP+D+D K+KAV++GA FLIDF+FFE  G
Sbjct:  102 PPGLEYLTQIDQVLIHQKVELLEAIIGFETNNQYEVKNSMGQKIYKAKEKNDCCTRNCCGSLRSFDMKIKDNTDREVIRLIRPFR------CATCWCPCCLQEMEVQAPPGTTIGYVTQDWHPCYPKFSIKGPNKETVMKLEGPCLA-CNCCG-DVNFELKGKDGGKSIGRISKQWSGLLKEVFTDTDNFGIQFPLDMDVKMKAVLMGACFLIDFIFFEKVG 315          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: si:ch211-71m22.5 (si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-65])

HSP 1 Score: 214.927 bits (546), Expect = 2.753e-67
Identity = 108/250 (43.20%), Postives = 156/250 (62.40%), Query Frame = 3
Query:  429 IVTNYISKLPPPHPPC--------------IDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRE 1136
            +  +Y+S   PP  P               ++YLT IDQ+++ Q +E++E + G ETNN Y +KN++GQQ++LA E ++FC +   G  R F +HL DN   EV+ + RP  C     C  C  CC  E+EVQ+P GQ +GYV Q       ++ I +  K++V+++ GP +C C C   DV F +M+ DG + +G+I+KQW+ +  EM TDADNFG+QFPMDLD KIKAV+L A FLIDFM+FEN  ++
Sbjct:    3 LYASYVSGYVPPQAPVMMPAPQCPPGCPPGLEYLTQIDQILIHQKVELMEAMLGWETNNQYVVKNSLGQQVFLAAEENDFCTRTMCGPMRSFVLHLQDNTGREVLTLTRPLNC---SSC--CFPCCLQELEVQSPPGQPIGYVIQKWHPYLPKFTIKDERKQSVMQIVGP-FCDCNC-CSDVNFEVMSLDGASVIGRISKQWTGMEAEMLTDADNFGVQFPMDLDVKIKAVILSACFLIDFMYFENSPKQ 245          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: plscr3b (phospholipid scramblase 2-like [Source:NCBI gene;Acc:103046260])

HSP 1 Score: 216.468 bits (550), Expect = 7.743e-67
Identity = 110/218 (50.46%), Postives = 148/218 (67.89%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCL-QCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFF 1118
            PP ++YLT IDQ+++ Q +E++E I G ETNN Y++KN+MGQ+IY AKE ++ C +NC GS R F + + DN + EVI++IRP +C       +C   CC  E+EVQAP G T+GYV Q    C  +++I    KETV+KL GP    C C G DV F L   DG   +G+I+KQWS L KE+FTD DNFGIQFP+D+D K+KAV++GA FLI  +F 
Sbjct:  102 PPGLEYLTQIDQVLIHQKVELLEAIIGFETNNQYEVKNSMGQKIYKAKEKNDCCTRNCCGSLRSFDMKIKDNTDREVIRLIRPFRCA------TCWCPCCLQEMEVQAPPGTTIGYVTQDWHPCYPKFSIKGPNKETVMKLEGPCLA-CNCCG-DVNFELKGKDGGKSIGRISKQWSGLLKEVFTDTDNFGIQFPLDMDVKMKAVLMGACFLIVSIFL 311          
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Match: plscr3b (phospholipid scramblase 2-like [Source:NCBI gene;Acc:103046260])

HSP 1 Score: 215.698 bits (548), Expect = 1.159e-65
Identity = 109/213 (51.17%), Postives = 146/213 (68.54%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCL-QCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLI 1103
            PP ++YLT IDQ+++ Q +E++E I G ETNN Y++KN+MGQ+IY AKE ++ C +NC GS R F + + DN + EVI++IRP +C       +C   CC  E+EVQAP G T+GYV Q    C  +++I    KETV+KL GP    C C G DV F L   DG   +G+I+KQWS L KE+FTD DNFGIQFP+D+D K+KAV++GA FLI
Sbjct:  102 PPGLEYLTQIDQVLIHQKVELLEAIIGFETNNQYEVKNSMGQKIYKAKEKNDCCTRNCCGSLRSFDMKIKDNTDREVIRLIRPFRCA------TCWCPCCLQEMEVQAPPGTTIGYVTQDWHPCYPKFSIKGPNKETVMKLEGPCLA-CNCCG-DVNFELKGKDGGKSIGRISKQWSGLLKEVFTDTDNFGIQFPLDMDVKMKAVLMGACFLI 306          
BLAST of Phospholipid scramblase vs. Ensembl Nematostella
Match: EDO31512 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXP9])

HSP 1 Score: 208.379 bits (529), Expect = 1.622e-65
Identity = 106/217 (48.85%), Postives = 144/217 (66.36%), Query Frame = 3
Query:  477 IDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENK 1127
            ++YLT IDQL++ Q +E+ E+ +G E  N Y+I N++GQQ+Y AKE ++ C + C G  RPF + + DN   EVI + RP +C  F      LQ     IEVQAP G  +GYV+Q    C  ++ I +  ++T+L + GP  C C C  D V F ++++DG  PVGK+ KQW+ L KE FTDA+NFGI FPMDLD K+KAV+LGAVFLIDFMFFE +
Sbjct:   14 LEYLTQIDQLLIRQQVELFELFTGCEMKNKYQITNSLGQQVYFAKEDTDCCTRQCCGPARPFEMEITDNTGREVIHLSRPLRCACFCCWCC-LQ----TIEVQAPRGNVVGYVEQEFYICKPKFTIKDANRQTILTMTGP-ICACRCCAD-VEFPVLSADGTVPVGKVTKQWTGLIKEAFTDAENFGITFPMDLDVKMKAVMLGAVFLIDFMFFETQ 223          
BLAST of Phospholipid scramblase vs. Ensembl Nematostella
Match: EDO46109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR56])

HSP 1 Score: 200.29 bits (508), Expect = 1.570e-56
Identity = 95/210 (45.24%), Postives = 137/210 (65.24%), Query Frame = 3
Query:  477 IDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSC-LQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLI 1103
            ++YLT +DQL+++Q +E++E  +G ETNN YKI N +GQQ++ A E ++ C + C G  RPF I + DN + EVI + RP +C       SC   CC  E+EVQ+P G  +GY  Q    C  +Y + +  ++T+L++ GP   +  C   DV F ++++DG   VGK++KQWS L KE FTDADNFG+ FPMDLD K+KAV++G  FLI
Sbjct:   87 LEYLTMVDQLLIKQQVELLEAFTGFETNNKYKITNNLGQQVFFAAEDTDCCTRQCCGPSRPFDIKIMDNTQREVIHLTRPLRCS------SCWFPCCLQEVEVQSPPGTVVGYCCQSWSICIPKYTLQDANRQTILQIEGPLCTFNIC--GDVEFQVLSADGQNQVGKVSKQWSGLVKEAFTDADNFGVTFPMDLDVKMKAVIIGTAFLI 288          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: plscr3b (phospholipid scramblase 2 [Source:NCBI gene;Acc:101157328])

HSP 1 Score: 214.542 bits (545), Expect = 1.391e-66
Identity = 126/280 (45.00%), Postives = 170/280 (60.71%), Query Frame = 3
Query:  312 FQFTEKNRNLEDPNYVCVLNKSMIHVQNPVITIK-----EYNQNIVTNYISKLPPPH-PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGR 1133
            F +        DPN       +M + Q P +  +     EY   +V      L P   PP ++YL  IDQ+++ Q +E++E   G ETNN Y+IKN +GQ+IY AKE ++ C +NC G+ R F + + DN + EVI++IRP +C+    C  CLQ    E+EVQAP G T+GYVKQ       +++I    KET+++L GP +  C C G DV F L   D  TP+G+I KQWS L KE+FTD DNFGIQFP+DLD K+KAV++GA FLIDFMFFE  G 
Sbjct:   10 FPYPAPGGGYGDPNQAPPPGFNMGYNQGPPVMYQPGQGPEYGAPLVGAAPVPLVPIGIPPGLEYLAQIDQILIHQKVELLEAFIGFETNNQYEIKNNLGQKIYTAKEKNDCCTRNCCGALRSFDMKIKDNTDREVIRLIRPFRCVSC-CCPCCLQ----EMEVQAPPGTTVGYVKQDWHPFLPKFSIQGANKETLMRLEGPCFA-CNCCG-DVSFELKGKD-ETPIGRITKQWSGLLKEVFTDTDNFGIQFPLDLDVKMKAVLMGACFLIDFMFFEKVGE 281          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: plscr3b (phospholipid scramblase 2 [Source:NCBI gene;Acc:101157328])

HSP 1 Score: 214.542 bits (545), Expect = 1.391e-66
Identity = 126/280 (45.00%), Postives = 170/280 (60.71%), Query Frame = 3
Query:  312 FQFTEKNRNLEDPNYVCVLNKSMIHVQNPVITIK-----EYNQNIVTNYISKLPPPH-PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGR 1133
            F +        DPN       +M + Q P +  +     EY   +V      L P   PP ++YL  IDQ+++ Q +E++E   G ETNN Y+IKN +GQ+IY AKE ++ C +NC G+ R F + + DN + EVI++IRP +C+    C  CLQ    E+EVQAP G T+GYVKQ       +++I    KET+++L GP +  C C G DV F L   D  TP+G+I KQWS L KE+FTD DNFGIQFP+DLD K+KAV++GA FLIDFMFFE  G 
Sbjct:   10 FPYPAPGGGYGDPNQAPPPGFNMGYNQGPPVMYQPGQGPEYGAPLVGAAPVPLVPIGIPPGLEYLAQIDQILIHQKVELLEAFIGFETNNQYEIKNNLGQKIYTAKEKNDCCTRNCCGALRSFDMKIKDNTDREVIRLIRPFRCVSC-CCPCCLQ----EMEVQAPPGTTVGYVKQDWHPFLPKFSIQGANKETLMRLEGPCFA-CNCCG-DVSFELKGKD-ETPIGRITKQWSGLLKEVFTDTDNFGIQFPLDLDVKMKAVLMGACFLIDFMFFEKVGE 281          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: si:ch73-206p6.1 (phospholipid scramblase 1 [Source:NCBI gene;Acc:101170797])

HSP 1 Score: 197.208 bits (500), Expect = 1.692e-60
Identity = 100/215 (46.51%), Postives = 140/215 (65.12%), Query Frame = 3
Query:  483 YLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCL-QCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFEN 1124
            Y   +DQL+++Q +E++E + G E+NN Y+I+N MGQ ++ A E ++   + C G  R FTIH+ DN   E+I + RP KCM      SC   CC  E+EVQ+P G T+GYV Q       ++ + N   E VLK++GP +C   C   DV F ++  D V  +GKI+KQW+ L +E FTD+DNFGIQFP+DLD ++KAV++GA FLIDFMFFE 
Sbjct:   37 YCCQVDQLLMKQKVELVEALVGFESNNKYEIRNVMGQNVFYAVEENDCLSRQCCGPLRSFTIHVLDNFGQEIITVTRPLKCM------SCFFPCCLQELEVQSPPGNTVGYVIQQWHPFFPKFIVANEHNEPVLKIHGP-FCGWSCL-PDVDFEILTMDEVNKIGKISKQWTGLLREAFTDSDNFGIQFPLDLDVRMKAVMIGACFLIDFMFFET 243          
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Match: si:ch73-206p6.1 (phospholipid scramblase 1 [Source:NCBI gene;Acc:101170797])

HSP 1 Score: 197.208 bits (500), Expect = 1.692e-60
Identity = 100/215 (46.51%), Postives = 140/215 (65.12%), Query Frame = 3
Query:  483 YLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCL-QCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFEN 1124
            Y   +DQL+++Q +E++E + G E+NN Y+I+N MGQ ++ A E ++   + C G  R FTIH+ DN   E+I + RP KCM      SC   CC  E+EVQ+P G T+GYV Q       ++ + N   E VLK++GP +C   C   DV F ++  D V  +GKI+KQW+ L +E FTD+DNFGIQFP+DLD ++KAV++GA FLIDFMFFE 
Sbjct:   37 YCCQVDQLLMKQKVELVEALVGFESNNKYEIRNVMGQNVFYAVEENDCLSRQCCGPLRSFTIHVLDNFGQEIITVTRPLKCM------SCFFPCCLQELEVQSPPGNTVGYVIQQWHPFFPKFIVANEHNEPVLKIHGP-FCGWSCL-PDVDFEILTMDEVNKIGKISKQWTGLLREAFTDSDNFGIQFPLDLDVRMKAVMIGACFLIDFMFFET 243          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000047456.1 (SMESG000047456.1)

HSP 1 Score: 296.59 bits (758), Expect = 5.854e-101
Identity = 140/140 (100.00%), Postives = 140/140 (100.00%), Query Frame = 3
Query:  726 MLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRERGT 1145
            MLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRERGT
Sbjct:    1 MLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRERGT 140          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000050651.1 (SMESG000050651.1)

HSP 1 Score: 283.108 bits (723), Expect = 4.054e-94
Identity = 128/223 (57.40%), Postives = 169/223 (75.78%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRE 1136
            P  ++YLT IDQL++ Q +E+ E++SG ETNN Y +KN  GQ+IY AKE ++ C +N  G  RPF IH+ D    EVIQI RP  C   G C SC +CC+DE++V+AP GQ +GYVKQ++EGC IRY+I N  +E VL+L+GPSY  CYCPGDD P  L+++DG   +GK++KQWSNL +E+FTDADNFGIQFPMDLD KIKAV++G+VFL+DFM+FE   ++
Sbjct:   10 PIGLEYLTLIDQLLIHQQVELFEILSGYETNNRYILKNIFGQKIYYAKEDTDCCIRNLTGPNRPFVIHVSDYLNHEVIQIRRPCTCNCCGQCFSCSECCQDEVQVEAPPGQIVGYVKQLYEGCEIRYSISNENREIVLRLHGPSYFKCYCPGDDFPLKLLSADGSVELGKVSKQWSNLVRELFTDADNFGIQFPMDLDVKIKAVIIGSVFLLDFMYFEQANKQ 232          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000050651.1 (SMESG000050651.1)

HSP 1 Score: 283.878 bits (725), Expect = 3.553e-93
Identity = 128/223 (57.40%), Postives = 169/223 (75.78%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRE 1136
            P  ++YLT IDQL++ Q +E+ E++SG ETNN Y +KN  GQ+IY AKE ++ C +N  G  RPF IH+ D    EVIQI RP  C   G C SC +CC+DE++V+AP GQ +GYVKQ++EGC IRY+I N  +E VL+L+GPSY  CYCPGDD P  L+++DG   +GK++KQWSNL +E+FTDADNFGIQFPMDLD KIKAV++G+VFL+DFM+FE   ++
Sbjct:  100 PIGLEYLTLIDQLLIHQQVELFEILSGYETNNRYILKNIFGQKIYYAKEDTDCCIRNLTGPNRPFVIHVSDYLNHEVIQIRRPCTCNCCGQCFSCSECCQDEVQVEAPPGQIVGYVKQLYEGCEIRYSISNENREIVLRLHGPSYFKCYCPGDDFPLKLLSADGSVELGKVSKQWSNLVRELFTDADNFGIQFPMDLDVKIKAVIIGSVFLLDFMYFEQANKQ 322          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000050656.1 (SMESG000050656.1)

HSP 1 Score: 264.618 bits (675), Expect = 1.301e-86
Identity = 120/235 (51.06%), Postives = 169/235 (71.91%), Query Frame = 3
Query:  432 VTNYISKLPPPHPPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRE 1136
            VT   + + P  PP ++YLT I+QL+V+Q  ++IEV +  +TNN Y + N +GQ ++ AKE +  C +   GS R F I++YDN+   V++I RP KC   G C +C +C +DE+EVQAP G+ +GYVKQ++EGC +RYAI++  K  +L+L+GP YC+CYCPGDD P  +M ++G   +GKI KQWS   +E++T ADNFG+QFPMDLD K KA+VL AVFLIDFM+FENK ++
Sbjct:   17 VTWVTAPVVPGCPPGLEYLTQINQLLVKQLFDLIEVFTEYDTNNKYLVNNILGQSVFYAKEENGCCMRYWCGSNRSFVIYVYDNSNQVVMEIRRPLKCHYMGPCCNCSKCSRDELEVQAPPGEVIGYVKQLYEGCQVRYAILDKDKNIILRLHGPHYCFCYCPGDDYPVGVMTANGDLEIGKITKQWSGWAQELYTTADNFGVQFPMDLDVKYKAIVLAAVFLIDFMYFENKNKD 251          
BLAST of Phospholipid scramblase vs. Planmine SMEST
Match: SMESG000043802.1 (SMESG000043802.1)

HSP 1 Score: 200.29 bits (508), Expect = 9.007e-60
Identity = 106/223 (47.53%), Postives = 142/223 (63.68%), Query Frame = 3
Query:  468 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNTMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHK--CMLFGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVLKLNGPSYCYCYCP--GDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADNFGIQFPMDLDTKIKAVVLGAVFLIDFMFFEN 1124
            PP ++YLT +DQ++V Q IE++EV +  ET N Y+IKN++GQQ+Y A E S+ C + C G QR F +H+ DN   EVI+ +R  K       HC + +  C  E+ V+AP GQ +G V Q        YAI N  +ET+L++ GP  C C  P    D  F + +SD  T +G+I+KQWS    E FTDADNFG+ FP+DLD K+KA +L AVFLIDFMFFEN
Sbjct:  181 PPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSLGQQVYYAAEESDVCARQCCGPQRGFVMHITDNMGTEVIRAMREFKCCAGPCCHCCAGIDMCAQELTVEAPPGQAIGRVIQQSSCLEPSYAIQNADEETMLQIRGP-ICICQGPCCTWDQEFKVFSSDMSTELGRISKQWSGFVHEYFTDADNFGVSFPIDLDVKMKATMLAAVFLIDFMFFEN 402          
The following BLAST results are available for this feature:
BLAST of Phospholipid scramblase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLSCR15.175e-6646.46phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
PLSCR15.411e-6646.64phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
PLSCR11.078e-6149.07phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
PLSCR31.698e-5541.18phospholipid scramblase 3 [Source:HGNC Symbol;Acc:... [more]
PLSCR31.698e-5541.18phospholipid scramblase 3 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scrm-21.209e-4334.10Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-12.421e-4238.30Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-12.421e-4238.30Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-12.562e-4238.30Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
scrm-12.646e-4238.30Phospholipid scramblase [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scramb12.057e-6445.81gene:FBgn0052056 transcript:FBtr0076302[more]
scramb12.206e-6345.81gene:FBgn0052056 transcript:FBtr0076303[more]
scramb14.829e-6245.95gene:FBgn0052056 transcript:FBtr0076301[more]
scramb27.005e-5839.92gene:FBgn0035390 transcript:FBtr0073005[more]
CG90841.699e-1223.68gene:FBgn0033582 transcript:FBtr0088197[more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plscr3b5.714e-7251.57phospholipid scramblase 3b [Source:ZFIN;Acc:ZDB-GE... [more]
plscr3b5.714e-7251.57phospholipid scramblase 3b [Source:ZFIN;Acc:ZDB-GE... [more]
si:ch211-71m22.17.395e-6849.78si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-71m22.17.395e-6849.78si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-71m22.17.395e-6849.78si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
insyn19.574e-6849.32inhibitory synaptic factor 1 [Source:Xenbase;Acc:X... [more]
insyn11.648e-6749.32inhibitory synaptic factor 1 [Source:Xenbase;Acc:X... [more]
ENSXETT00000012543.13.031e-6146.33phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
kpna61.110e-4142.49karyopherin alpha 6 (importin alpha 7) [Source:Xen... [more]
kpna61.747e-4141.75karyopherin alpha 6 (importin alpha 7) [Source:Xen... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plscr15.390e-6950.45phospholipid scramblase 1 [Source:MGI Symbol;Acc:M... [more]
Plscr15.390e-6950.45phospholipid scramblase 1 [Source:MGI Symbol;Acc:M... [more]
Plscr24.835e-6746.25phospholipid scramblase 2 [Source:MGI Symbol;Acc:M... [more]
Plscr24.835e-6746.25phospholipid scramblase 2 [Source:MGI Symbol;Acc:M... [more]
Plscr33.176e-5842.86phospholipid scramblase 3 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Phospholipid scramblase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3ZBG9|PLS2_BOVIN8.259e-6947.77Phospholipid scramblase 2 OS=Bos taurus OX=9913 GN... [more]
sp|Q9JJ00|PLS1_MOUSE3.771e-6850.45Phospholipid scramblase 1 OS=Mus musculus OX=10090... [more]
sp|P58195|PLS1_RAT1.457e-6749.55Phospholipid scramblase 1 OS=Rattus norvegicus OX=... [more]
sp|Q9DCW2|PLS2_MOUSE3.382e-6646.25Phospholipid scramblase 2 OS=Mus musculus OX=10090... [more]
sp|O15162|PLS1_HUMAN2.598e-6546.64Phospholipid scramblase 1 OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Phospholipid scramblase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A075A1P09.094e-9156.44Phospholipid scramblase OS=Opisthorchis viverrini ... [more]
A0A267FIM74.030e-8954.46Phospholipid scramblase OS=Macrostomum lignano OX=... [more]
G7YRN61.006e-8854.46Phospholipid scramblase OS=Clonorchis sinensis OX=... [more]
A0A1I8J9711.333e-8854.02Phospholipid scramblase OS=Macrostomum lignano OX=... [more]
A0A267GND11.547e-8854.02Phospholipid scramblase OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plscr3b2.267e-7151.80phospholipid scramblase 2-like [Source:NCBI gene;A... [more]
plscr3b2.267e-7151.80phospholipid scramblase 2-like [Source:NCBI gene;A... [more]
si:ch211-71m22.52.753e-6743.20si:ch211-71m22.5 [Source:ZFIN;Acc:ZDB-GENE-130531-... [more]
plscr3b7.743e-6750.46phospholipid scramblase 2-like [Source:NCBI gene;A... [more]
plscr3b1.159e-6551.17phospholipid scramblase 2-like [Source:NCBI gene;A... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholipid scramblase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholipid scramblase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO315121.622e-6548.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461091.570e-5645.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phospholipid scramblase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
plscr3b1.391e-6645.00phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
plscr3b1.391e-6645.00phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
si:ch73-206p6.11.692e-6046.51phospholipid scramblase 1 [Source:NCBI gene;Acc:10... [more]
si:ch73-206p6.11.692e-6046.51phospholipid scramblase 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Phospholipid scramblase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047456.15.854e-101100.00SMESG000047456.1[more]
SMESG000050651.14.054e-9457.40SMESG000050651.1[more]
SMESG000050651.13.553e-9357.40SMESG000050651.1[more]
SMESG000050656.11.301e-8651.06SMESG000050656.1[more]
SMESG000043802.19.007e-6047.53SMESG000043802.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026580 ID=SMED30026580|Name=Phospholipid scramblase|organism=Schmidtea mediterranea sexual|type=transcript|length=1248bp
GTTCTCTCAATTTTCATAAATAATAGACAAAAAACTCATCTTGATAAAAA
TTAAAATTGCCTTTAAAATAGCATTTATAAAAGGTAAAAAAGTTACAAAA
AATTGCAATGAAAATATTTTCCATTGACAACAATTTTTATGAGTTTAATG
ATAAAATAATTCATTGCAGTTAGCTTTTGTTTTAAAACAGGCCGGAAATA
TGTATTAATGGGATTTTTGCACTTGTCCAAGCATGGAATATATATATAAT
TATTTAAATAATTATTAGAGTATTTTCTGATATGGAATTCGGAATGAGTG
CAATTGAAGGTTTTCAATTTACAGAAAAAAATAGGAATCTAGAAGATCCT
AATTACGTTTGCGTTTTAAATAAATCTATGATCCATGTTCAAAATCCAGT
TATTACCATTAAAGAATATAACCAAAATATAGTAACTAATTATATTTCAA
AACTGCCCCCTCCGCATCCTCCTTGCATAGATTATTTAACAGCAATTGAC
CAACTGATTGTCGAGCAAAATATAGAAATGATTGAAGTGATCAGTGGTAT
AGAAACCAACAATAGCTACAAAATAAAAAATACAATGGGCCAACAAATTT
ACCTTGCGAAAGAAAGCTCTGAATTTTGTGATAAAAATTGTTTGGGTTCT
CAGAGACCATTTACCATACACCTTTATGATAATAATGAGGTTGAAGTTAT
TCAGATAATTCGACCGCATAAATGTATGTTATTTGGTCATTGCCTGAGTT
GTCTGCAATGCTGCAAAGATGAAATAGAGGTTCAAGCTCCAGTTGGACAA
ACATTAGGATACGTAAAACAGATTCATGAAGGTTGTTCAATTCGATATGC
AATAATGAACAATTTAAAAGAAACTGTTTTGAAGCTGAATGGTCCATCAT
ATTGTTATTGCTATTGTCCCGGTGATGATGTTCCATTTATATTAATGGCC
TCTGATGGAGTTACACCGGTTGGTAAAATAGCTAAACAATGGTCTAACCT
TTTCAAGGAAATGTTCACTGACGCGGACAATTTCGGAATTCAATTTCCAA
TGGACCTTGATACGAAAATCAAAGCTGTTGTGCTAGGAGCGGTGTTTTTA
ATAGATTTCATGTTTTTTGAGAACAAAGGACGTGAAAGGGGCACATAAAA
CTGAAAAGAAATCTTATCCTGAGTGTGCACTTAATTATTTTAACAATTCA
AATGAGAGTAATTTATTATTGTAAGACATTTTTGAAATTCAAAGGAAA
back to top

protein sequence of SMED30026580-orf-1

>SMED30026580-orf-1 ID=SMED30026580-orf-1|Name=SMED30026580-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=289bp
MEFGMSAIEGFQFTEKNRNLEDPNYVCVLNKSMIHVQNPVITIKEYNQNI
VTNYISKLPPPHPPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKN
TMGQQIYLAKESSEFCDKNCLGSQRPFTIHLYDNNEVEVIQIIRPHKCML
FGHCLSCLQCCKDEIEVQAPVGQTLGYVKQIHEGCSIRYAIMNNLKETVL
KLNGPSYCYCYCPGDDVPFILMASDGVTPVGKIAKQWSNLFKEMFTDADN
FGIQFPMDLDTKIKAVVLGAVFLIDFMFFENKGRERGT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005552Scramblase
Vocabulary: molecular function
TermDefinition
GO:0001077transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0003677DNA binding
GO:0005154epidermal growth factor receptor binding
GO:0005509calcium ion binding
GO:0005515protein binding
GO:0017124SH3 domain binding
GO:0017128phospholipid scramblase activity
GO:0019899enzyme binding
GO:0042609CD4 receptor binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005794Golgi apparatus
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031012extracellular matrix
GO:0045121membrane raft
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0006366transcription from RNA polymerase II promoter
GO:0006659phosphatidylserine biosynthetic process
GO:0006915apoptotic process
GO:0006953acute-phase response
GO:0010628positive regulation of gene expression
GO:0017121phospholipid scrambling
GO:0030168platelet activation
GO:0033003regulation of mast cell activation
GO:0035456response to interferon-beta
GO:0045071negative regulation of viral genome replication
GO:0045089positive regulation of innate immune response
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0051607defense response to virus
GO:0060368regulation of Fc receptor mediated stimulatory signaling pathway
GO:2000373positive regulation of DNA topoisomerase (ATP-hydrolyzing) activity