Acetyl-CoA C-acetyltransferase

Overview
NameAcetyl-CoA C-acetyltransferase
Smed IDSMED30026577
Length (bp)1147
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acetyl-CoA C-acetyltransferase (SMED30026577) t-SNE clustered cells

Violin plots show distribution of expression levels for Acetyl-CoA C-acetyltransferase (SMED30026577) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acetyl-CoA C-acetyltransferase (SMED30026577) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acetyl-CoA C-acetyltransferase (SMED30026577) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026577

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30026577SMESG000057173.1 dd_Smed_v4_5627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026577SMESG000057173.1 dd_Smed_v4_5627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Human
Match: GOLGA7B (golgin A7 family member B [Source:HGNC Symbol;Acc:HGNC:31668])

HSP 1 Score: 115.546 bits (288), Expect = 2.498e-30
Identity = 54/128 (42.19%), Postives = 81/128 (63.28%), Query Frame = 1
Query:  118 PTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSR 501
              S   K FIQRD+S GT  +FQ    P ELD  IE ++F+E +  +N  +  AE +  ++ +E CL C TAY +FLC+ T+YEK +K++   IQ  N+K+F PR L++ +P+ERG+RV+  +I   R
Sbjct:   14 SASLATKVFIQRDYSDGTICQFQT-KFPPELDSRIERQLFEETVKTLNGFYAEAEKIGGSSYLEGCLACATAYFIFLCMETHYEKVLKKISRYIQEQNEKIFAPRGLLLTDPVERGMRVIEISIYEDR 140          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Human
Match: GOLGA7B (golgin A7 family member B [Source:HGNC Symbol;Acc:HGNC:31668])

HSP 1 Score: 115.546 bits (288), Expect = 2.960e-30
Identity = 54/127 (42.52%), Postives = 81/127 (63.78%), Query Frame = 1
Query:  121 TSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSR 501
             S   K FIQRD+S GT  +FQ    P ELD  IE ++F+E +  +N  +  AE +  ++ +E CL C TAY +FLC+ T+YEK +K++   IQ  N+K+F PR L++ +P+ERG+RV+  +I   R
Sbjct:   14 ASLATKVFIQRDYSDGTICQFQT-KFPPELDSRIERQLFEETVKTLNGFYAEAEKIGGSSYLEGCLACATAYFIFLCMETHYEKVLKKISRYIQEQNEKIFAPRGLLLTDPVERGMRVIEISIYEDR 139          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Human
Match: GOLGA7 (golgin A7 [Source:HGNC Symbol;Acc:HGNC:24876])

HSP 1 Score: 112.464 bits (280), Expect = 1.666e-29
Identity = 52/123 (42.28%), Postives = 79/123 (64.23%), Query Frame = 1
Query:  136 KTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRS 504
            K FIQRD+S GT  +FQ    P EL+  I+ + F+E +  +N ++  AE L   + +E CL CLTAY +FLC+ T+YEK +K++   IQ  N+K++ P+ L++ +P+ERGLRV+   I   R 
Sbjct:   11 KVFIQRDYSSGTRCQFQT-KFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRG 132          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Human
Match: GOLGA7 (golgin A7 [Source:HGNC Symbol;Acc:HGNC:24876])

HSP 1 Score: 112.464 bits (280), Expect = 1.666e-29
Identity = 52/123 (42.28%), Postives = 79/123 (64.23%), Query Frame = 1
Query:  136 KTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRS 504
            K FIQRD+S GT  +FQ    P EL+  I+ + F+E +  +N ++  AE L   + +E CL CLTAY +FLC+ T+YEK +K++   IQ  N+K++ P+ L++ +P+ERGLRV+   I   R 
Sbjct:   11 KVFIQRDYSSGTRCQFQT-KFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRG 132          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Human
Match: GOLGA7 (golgin A7 [Source:HGNC Symbol;Acc:HGNC:24876])

HSP 1 Score: 112.464 bits (280), Expect = 1.666e-29
Identity = 52/123 (42.28%), Postives = 79/123 (64.23%), Query Frame = 1
Query:  136 KTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRS 504
            K FIQRD+S GT  +FQ    P EL+  I+ + F+E +  +N ++  AE L   + +E CL CLTAY +FLC+ T+YEK +K++   IQ  N+K++ P+ L++ +P+ERGLRV+   I   R 
Sbjct:   11 KVFIQRDYSSGTRCQFQT-KFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRG 132          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Celegans
Match: Y57G11C.33 (pep chromosome:WBcel235:IV:14657086:14658165:1 gene:WBGene00013323.1 transcript:Y57G11C.33b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y57G11C.33)

HSP 1 Score: 80.1073 bits (196), Expect = 1.056e-17
Identity = 44/116 (37.93%), Postives = 63/116 (54.31%), Query Frame = 1
Query:  130 CRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
            CRK FIQRD+S G +V+F E   P  L   +  +V++  I +IN IF  AE ++  T  E  LGC T Y  +    + Y + + EL   +   N +++      I NPMERGLRV+
Sbjct:   33 CRKIFIQRDYSKGLDVQF-EAEYPARLTEKVPRDVWENTIVRINRIFADAEAITPQTIFETVLGCFTCYASYAITKSTYRRKLDELQEFLNRENREIYHHVGFHIRNPMERGLRVL 147          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Celegans
Match: Y57G11C.33 (pep chromosome:WBcel235:IV:14657081:14658165:1 gene:WBGene00013323.1 transcript:Y57G11C.33a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y57G11C.33)

HSP 1 Score: 74.3294 bits (181), Expect = 1.372e-15
Identity = 44/120 (36.67%), Postives = 63/120 (52.50%), Query Frame = 1
Query:  130 CRK----TFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
            CRK     FIQRD+S G +V+F E   P  L   +  +V++  I +IN IF  AE ++  T  E  LGC T Y  +    + Y + + EL   +   N +++      I NPMERGLRV+
Sbjct:   33 CRKLNGQIFIQRDYSKGLDVQF-EAEYPARLTEKVPRDVWENTIVRINRIFADAEAITPQTIFETVLGCFTCYASYAITKSTYRRKLDELQEFLNRENREIYHHVGFHIRNPMERGLRVL 151          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Fly
Match: CG5447 (gene:FBgn0039427 transcript:FBtr0085012)

HSP 1 Score: 107.071 bits (266), Expect = 1.427e-27
Identity = 47/114 (41.23%), Postives = 77/114 (67.54%), Query Frame = 1
Query:  136 KTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
            K FIQRD+S GT V+F    LP EL+G+IE  VF+  I+++N  +  AE  S  T  E C+GC+TAYL+++C  T+YEK ++++   + + N++++  + L +++P  RGLRV+
Sbjct:   28 KVFIQRDYSEGTSVKFHT-RLPAELEGMIERHVFEATINRLNEFYAEAEEGSCGTYCEGCIGCITAYLIYMCSETHYEKTLRKISKFVASQNERIYNTKGLQLIDPTYRGLRVI 140          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Fly
Match: CG5447 (gene:FBgn0039427 transcript:FBtr0330152)

HSP 1 Score: 106.686 bits (265), Expect = 2.428e-27
Identity = 47/114 (41.23%), Postives = 77/114 (67.54%), Query Frame = 1
Query:  136 KTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
            K FIQRD+S GT V+F    LP EL+G+IE  VF+  I+++N  +  AE  S  T  E C+GC+TAYL+++C  T+YEK ++++   + + N++++  + L +++P  RGLRV+
Sbjct:   28 KVFIQRDYSEGTSVKFHT-RLPAELEGMIERHVFEATINRLNEFYAEAEEGSCGTYCEGCIGCITAYLIYMCSETHYEKTLRKISKFVASQNERIYNTKGLQLIDPTYRGLRVI 140          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Zebrafish
Match: golga7bb (golgin A7 family, member Bb [Source:ZFIN;Acc:ZDB-GENE-090312-173])

HSP 1 Score: 119.783 bits (299), Expect = 3.827e-32
Identity = 54/119 (45.38%), Postives = 79/119 (66.39%), Query Frame = 1
Query:  121 TSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
             S   K FIQRD+S GT  +FQ    P ELD  IE  +F+E +  +NC +  AE +S  + +E+CL C TAY +FLC+ T YEK +K++ + IQ  N+K+F PR L++ +P+ERG+RV+
Sbjct:   15 ASLATKVFIQRDYSDGTICKFQT-KFPTELDSRIERSLFEETVKTLNCYYAEAEKISGQSYLESCLACATAYFIFLCMETRYEKILKKISMYIQEQNEKIFAPRGLLLTDPIERGMRVI 132          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Zebrafish
Match: golga7bb (golgin A7 family, member Bb [Source:ZFIN;Acc:ZDB-GENE-090312-173])

HSP 1 Score: 118.627 bits (296), Expect = 1.295e-31
Identity = 54/118 (45.76%), Postives = 78/118 (66.10%), Query Frame = 1
Query:  121 TSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRV 474
             S   K FIQRD+S GT  +FQ    P ELD  IE  +F+E +  +NC +  AE +S  + +E+CL C TAY +FLC+ T YEK +K++ + IQ  N+K+F PR L++ +P+ERG+RV
Sbjct:   16 ASLATKVFIQRDYSDGTICKFQT-KFPTELDSRIERSLFEETVKTLNCYYAEAEKISGQSYLESCLACATAYFIFLCMETRYEKILKKISMYIQEQNEKIFAPRGLLLTDPIERGMRV 132          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Zebrafish
Match: golga7ba (golgin A7 family, member Ba [Source:ZFIN;Acc:ZDB-GENE-050417-14])

HSP 1 Score: 116.316 bits (290), Expect = 7.433e-31
Identity = 55/128 (42.97%), Postives = 79/128 (61.72%), Query Frame = 1
Query:  118 PTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSR 501
              S   K FIQRD++ GT  +FQ    P ELD  IE  +F++ +  +N  +  AE +   + IE CL CLT YL+FLCI T YEK +K++   IQ  N+KV+ PR L+I +P+ERG+RV+  ++   R
Sbjct:   14 SASLANKVFIQRDYTDGTVCKFQT-KFPSELDSRIERTLFEDTVKTLNTYYAEAEKIGGQSYIEGCLACLTVYLIFLCIETRYEKVLKKISRYIQEQNEKVYAPRGLLITDPIERGMRVIEISVYEDR 140          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Zebrafish
Match: golga7ba (golgin A7 family, member Ba [Source:ZFIN;Acc:ZDB-GENE-050417-14])

HSP 1 Score: 115.546 bits (288), Expect = 1.781e-30
Identity = 55/127 (43.31%), Postives = 79/127 (62.20%), Query Frame = 1
Query:  121 TSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSR 501
             S   K FIQRD++ GT  +FQ    P ELD  IE  +F++ +  +N  +  AE +   + IE CL CLT YL+FLCI T YEK +K++   IQ  N+KV+ PR L+I +P+ERG+RV+  ++   R
Sbjct:   31 ASLANKVFIQRDYTDGTVCKFQT-KFPSELDSRIERTLFEDTVKTLNTYYAEAEKIGGQSYIEGCLACLTVYLIFLCIETRYEKVLKKISRYIQEQNEKVYAPRGLLITDPIERGMRVIEISVYEDR 156          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Zebrafish
Match: golga7 (golgin A7 [Source:ZFIN;Acc:ZDB-GENE-040625-142])

HSP 1 Score: 111.694 bits (278), Expect = 2.183e-29
Identity = 53/128 (41.41%), Postives = 79/128 (61.72%), Query Frame = 1
Query:  121 TSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRS 504
             +   K F+QRD++ GT  +FQ    P EL+  I+   F+E I  +N ++  AE L   + +E CL CLTAY +FLC+ T+YEK +K++   IQ  N+K++ P  L++ +P+ERGLRVV   I   RS
Sbjct:   13 AAVASKVFVQRDYTSGTICKFQT-KFPAELESRIDKVQFEETIQTLNNLYAEAEKLGGRSYLEGCLACLTAYTIFLCMETHYEKVLKKIAKFIQEQNEKIYAPLGLLLTDPIERGLRVVEITIFEDRS 139          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Xenopus
Match: cacfd1 (calcium channel flower domain containing 1 [Source:Xenbase;Acc:XB-GENE-6257568])

HSP 1 Score: 112.849 bits (281), Expect = 2.181e-29
Identity = 51/128 (39.84%), Postives = 81/128 (63.28%), Query Frame = 1
Query:  118 PTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSR 501
              S   K FIQRD+S GT  +FQ    P EL+  IE ++F+E +  +N  +  AE +  ++ +E CL C+TAY +F C+ T+YEK +K++   IQ  N+K++ PR L+I +P+ERG+RV+  ++   R
Sbjct:   14 SASLATKVFIQRDYSDGTMCQFQT-KFPTELESRIEKQLFEETVKTLNMYYIEAEKIGGSSYLEGCLACVTAYFIFFCMETHYEKVLKKISKYIQEQNEKIYAPRGLLITDPVERGMRVIEISVYEDR 140          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Xenopus
Match: cacfd1 (calcium channel flower domain containing 1 [Source:Xenbase;Acc:XB-GENE-6257568])

HSP 1 Score: 111.309 bits (277), Expect = 1.088e-28
Identity = 50/123 (40.65%), Postives = 79/123 (64.23%), Query Frame = 1
Query:  121 TSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNI 489
             S   K FIQRD+S GT  +FQ    P EL+  IE ++F+E +  +N  +  AE +  ++ +E CL C+TAY +F C+ T+YEK +K++   IQ  N+K++ PR L+I +P+ERG+RV +  +
Sbjct:   15 ASLATKVFIQRDYSDGTMCQFQT-KFPTELESRIEKQLFEETVKTLNMYYIEAEKIGGSSYLEGCLACVTAYFIFFCMETHYEKVLKKISKYIQEQNEKIYAPRGLLITDPVERGMRVQMEQM 136          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Xenopus
Match: mafb (v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog B [Source:Xenbase;Acc:XB-GENE-6085859])

HSP 1 Score: 107.842 bits (268), Expect = 6.444e-28
Identity = 51/128 (39.84%), Postives = 80/128 (62.50%), Query Frame = 1
Query:  121 TSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRS 504
             +   K FIQRD++ GT  +FQ    P EL+  I+ + F+E +  +N ++  AE L   + +E CL C TAY +FLC+ T+YEK +K++   IQ  N+K++ P+ L++ +P+ERGLRV+   I   RS
Sbjct:    5 AAVAGKVFIQRDYTNGTLCQFQT-KFPSELENRIDRQQFEETVRTLNNMYAEAEKLGGPSYLEGCLACFTAYTIFLCMETHYEKVLKKIAKYIQEQNEKMYAPQGLLLTDPIERGLRVIEITIYEDRS 131          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Mouse
Match: Golga7b (golgi autoantigen, golgin subfamily a, 7B [Source:MGI Symbol;Acc:MGI:1918396])

HSP 1 Score: 115.931 bits (289), Expect = 1.336e-30
Identity = 55/128 (42.97%), Postives = 81/128 (63.28%), Query Frame = 1
Query:  118 PTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSR 501
              S   K FIQRD+S GT  +FQ    P ELD  IE ++F+E +  +N  +  AE +  ++ +E CL C TAY +FLC+ T+YEK +K++   IQ  N+KVF PR L++ +P+ERG+RV+  +I   R
Sbjct:   14 SASLATKVFIQRDYSDGTICQFQT-KFPPELDSRIERQLFEETVKTLNGFYAEAEKIGGSSYLEGCLACATAYFIFLCMETHYEKVLKKISRYIQEQNEKVFAPRGLLLTDPVERGMRVIEISIYEDR 140          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Mouse
Match: Golga7b (golgi autoantigen, golgin subfamily a, 7B [Source:MGI Symbol;Acc:MGI:1918396])

HSP 1 Score: 115.931 bits (289), Expect = 1.336e-30
Identity = 55/128 (42.97%), Postives = 81/128 (63.28%), Query Frame = 1
Query:  118 PTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSR 501
              S   K FIQRD+S GT  +FQ    P ELD  IE ++F+E +  +N  +  AE +  ++ +E CL C TAY +FLC+ T+YEK +K++   IQ  N+KVF PR L++ +P+ERG+RV+  +I   R
Sbjct:   14 SASLATKVFIQRDYSDGTICQFQT-KFPPELDSRIERQLFEETVKTLNGFYAEAEKIGGSSYLEGCLACATAYFIFLCMETHYEKVLKKISRYIQEQNEKVFAPRGLLLTDPVERGMRVIEISIYEDR 140          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Mouse
Match: Golga7 (golgi autoantigen, golgin subfamily a, 7 [Source:MGI Symbol;Acc:MGI:1931029])

HSP 1 Score: 112.464 bits (280), Expect = 1.109e-29
Identity = 55/135 (40.74%), Postives = 82/135 (60.74%), Query Frame = 1
Query:  100 MSKHYTPTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRS 504
            M     P S   K FIQRD+S GT  +FQ    P EL+  I+ + F+E +  +N ++  AE L   + +E CL CLTAY +FLC+ T+YEK +K++   IQ  N+K++ P+ L++ +P+ERGLRV+   I   R 
Sbjct:    1 MRPQQAPVSG--KVFIQRDYSSGTRCQFQT-KFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRG 132          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Mouse
Match: Golga7 (golgi autoantigen, golgin subfamily a, 7 [Source:MGI Symbol;Acc:MGI:1931029])

HSP 1 Score: 112.464 bits (280), Expect = 1.109e-29
Identity = 55/135 (40.74%), Postives = 82/135 (60.74%), Query Frame = 1
Query:  100 MSKHYTPTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRS 504
            M     P S   K FIQRD+S GT  +FQ    P EL+  I+ + F+E +  +N ++  AE L   + +E CL CLTAY +FLC+ T+YEK +K++   IQ  N+K++ P+ L++ +P+ERGLRV+   I   R 
Sbjct:    1 MRPQQAPVSG--KVFIQRDYSSGTRCQFQT-KFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRG 132          
BLAST of Acetyl-CoA C-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q9D428|GOG7B_MOUSE (Golgin subfamily A member 7B OS=Mus musculus OX=10090 GN=GOLGA7B PE=1 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 9.344e-30
Identity = 55/128 (42.97%), Postives = 81/128 (63.28%), Query Frame = 1
Query:  118 PTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSR 501
              S   K FIQRD+S GT  +FQ    P ELD  IE ++F+E +  +N  +  AE +  ++ +E CL C TAY +FLC+ T+YEK +K++   IQ  N+KVF PR L++ +P+ERG+RV+  +I   R
Sbjct:   14 SASLATKVFIQRDYSDGTICQFQT-KFPPELDSRIERQLFEETVKTLNGFYAEAEKIGGSSYLEGCLACATAYFIFLCMETHYEKVLKKISRYIQEQNEKVFAPRGLLLTDPVERGMRVIEISIYEDR 140          
BLAST of Acetyl-CoA C-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q2TAP0|GOG7B_HUMAN (Golgin subfamily A member 7B OS=Homo sapiens OX=9606 GN=GOLGA7B PE=1 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 1.199e-29
Identity = 54/128 (42.19%), Postives = 81/128 (63.28%), Query Frame = 1
Query:  118 PTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSR 501
              S   K FIQRD+S GT  +FQ    P ELD  IE ++F+E +  +N  +  AE +  ++ +E CL C TAY +FLC+ T+YEK +K++   IQ  N+K+F PR L++ +P+ERG+RV+  +I   R
Sbjct:   14 SASLATKVFIQRDYSDGTICQFQT-KFPPELDSRIERQLFEETVKTLNGFYAEAEKIGGSSYLEGCLACATAYFIFLCMETHYEKVLKKISRYIQEQNEKIFAPRGLLLTDPVERGMRVIEISIYEDR 140          
BLAST of Acetyl-CoA C-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q5ZLC9|GOGA7_CHICK (Golgin subfamily A member 7 OS=Gallus gallus OX=9031 GN=GOLGA7 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 2.825e-29
Identity = 55/135 (40.74%), Postives = 82/135 (60.74%), Query Frame = 1
Query:  100 MSKHYTPTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRS 504
            M     P S   K FIQRD+S GT  +FQ    P EL+  I+ + F+E +  +N ++  AE L   + +E CL CLTAY +FLC+ T+YEK +K++   IQ  N+K++ P+ L++ +P+ERGLRV+   I   R 
Sbjct:    1 MRPQQAPVSG--KVFIQRDYSGGTRCQFQS-KFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKIAKFIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRG 132          
BLAST of Acetyl-CoA C-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q91W53|GOGA7_MOUSE (Golgin subfamily A member 7 OS=Mus musculus OX=10090 GN=Golga7 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 7.754e-29
Identity = 55/135 (40.74%), Postives = 82/135 (60.74%), Query Frame = 1
Query:  100 MSKHYTPTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRS 504
            M     P S   K FIQRD+S GT  +FQ    P EL+  I+ + F+E +  +N ++  AE L   + +E CL CLTAY +FLC+ T+YEK +K++   IQ  N+K++ P+ L++ +P+ERGLRV+   I   R 
Sbjct:    1 MRPQQAPVSG--KVFIQRDYSSGTRCQFQT-KFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRG 132          
BLAST of Acetyl-CoA C-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q7Z5G4|GOGA7_HUMAN (Golgin subfamily A member 7 OS=Homo sapiens OX=9606 GN=GOLGA7 PE=1 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 8.000e-29
Identity = 52/123 (42.28%), Postives = 79/123 (64.23%), Query Frame = 1
Query:  136 KTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRS 504
            K FIQRD+S GT  +FQ    P EL+  I+ + F+E +  +N ++  AE L   + +E CL CLTAY +FLC+ T+YEK +K++   IQ  N+K++ P+ L++ +P+ERGLRV+   I   R 
Sbjct:   11 KVFIQRDYSSGTRCQFQT-KFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRG 132          
BLAST of Acetyl-CoA C-acetyltransferase vs. TrEMBL
Match: A0A4S2MAQ0 (Erf4 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001418 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 5.047e-37
Identity = 64/119 (53.78%), Postives = 87/119 (73.11%), Query Frame = 1
Query:  121 TSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
            ++ C + FIQRDFS GT VRFQ  P+P +L G I P  + EA+ Q+N +FD AE +S   C EN LGCLTAYL FLCI T+YEK +K++ L +++LN KVF+P  L++++P ERGLRV+
Sbjct:   34 STVCDRIFIQRDFSEGTAVRFQTSPMPFQLRGRINPTRYAEAVGQLNKLFDEAEAISPAVCFENALGCLTAYLAFLCINTHYEKILKKVTLTVEDLNQKVFLPSGLLMIDPSERGLRVI 152          
BLAST of Acetyl-CoA C-acetyltransferase vs. TrEMBL
Match: A0A0V0J4K5 (Golgin subfamily A member 7 OS=Schistocephalus solidus OX=70667 GN=GOGA7 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 7.961e-36
Identity = 70/159 (44.03%), Postives = 96/159 (60.38%), Query Frame = 1
Query:   97 PMSKHYTPTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRSDINIIFFSHWLPF*IEVCIFDSN 573
            P S+ +  T+ C +TF+QRDFS GT VRFQ  PLP  L G I PE F +AI ++N +FD AE+LS     EN   CL AY+LFLC+PT+YE+ ++++   +  LN +VFVP+ L++++P ERGLRV                        IE+CI DSN
Sbjct:    2 PDSRQFN-TANCERTFVQRDFSEGTAVRFQTSPLPPRLSGKISPEEFAKAISELNQLFDEAESLSAAVVCENITACLFAYMLFLCMPTHYERVLEKISYRVIQLNSEVFVPKGLLMIDPAERGLRV------------------------IEICIMDSN 135          
BLAST of Acetyl-CoA C-acetyltransferase vs. TrEMBL
Match: A0A504Z195 (Golgi autoantigen golgin subfamily a 7 OS=Fasciola gigantica OX=46835 GN=FGIG_10222 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 8.330e-36
Identity = 62/127 (48.82%), Postives = 89/127 (70.08%), Query Frame = 1
Query:   97 PMSKHYTPTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
            P        +TC + FIQRDFS GT VRFQ  P+P +L G I P  F +AI ++N +FD AE+++ +  +EN LGCLTAYL FLCI T+YEK ++ + L +++LN+ VF+P  L++++P ERGLRV+
Sbjct:    4 PAEDRTQQQTTCDRVFIQRDFSEGTAVRFQTSPMPFQLRGRINPSRFADAISRLNKLFDEAESITPSVFMENMLGCLTAYLAFLCIRTHYEKVLQRVTLAVKDLNETVFIPSGLLMIDPAERGLRVI 130          
BLAST of Acetyl-CoA C-acetyltransferase vs. TrEMBL
Match: A0A183MYM7 (Erf4 domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS21152 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 2.870e-35
Identity = 59/119 (49.58%), Postives = 88/119 (73.95%), Query Frame = 1
Query:  121 TSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
            T  C + FIQRD+S GT VRFQ  P+P +L G I P  + +AI ++N +FD AET++ + C+EN  GCLTAYL+FLC+ T+Y+K + ++ L + +LN+K+F+P  L++++P ERGLRVV
Sbjct:   11 TVPCERIFIQRDYSSGTAVRFQTLPMPLQLRGRIPPNRYADAIARLNKLFDEAETINSSVCLENLFGCLTAYLIFLCMKTHYDKVLHKVTLAVADLNEKLFLPNGLLMIDPSERGLRVV 129          
BLAST of Acetyl-CoA C-acetyltransferase vs. TrEMBL
Match: A0A183NWU5 (Erf4 domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS6581 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 4.027e-35
Identity = 58/118 (49.15%), Postives = 88/118 (74.58%), Query Frame = 1
Query:  124 STCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
            + C + FIQRD+S GT VRFQ  P+P +L G I P  + +AI ++N +FD AET++ + C+EN  GCLTAYL+FLC+ T+Y+K + ++ L + +LN+K+F+P  L++++P ERGLRVV
Sbjct:   12 APCERIFIQRDYSSGTAVRFQTLPMPLQLRGRIPPNRYADAIARLNKLFDEAETINSSVCLENLFGCLTAYLIFLCMKTHYDKVLHKVTLAVADLNEKLFLPNGLLMIDPSERGLRVV 129          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Cavefish
Match: golga7ba (golgin A7 family, member Ba [Source:ZFIN;Acc:ZDB-GENE-050417-14])

HSP 1 Score: 115.931 bits (289), Expect = 5.641e-31
Identity = 54/127 (42.52%), Postives = 81/127 (63.78%), Query Frame = 1
Query:  121 TSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSR 501
             S   K FIQRD+S GT  +FQ    P ELD  IE  +F++ +  +N  +  AE +  ++ +E CL C+TAYL+FLC+ T YEK +K++   IQ  N+K++ PR L+I +P+ERG+RV+  +I   R
Sbjct:    6 ASLANKVFIQRDYSEGTVCKFQT-KFPSELDSRIEKTLFEDTVKTLNNYYAEAEKIGGHSYLEGCLACITAYLIFLCMETRYEKVLKKISRYIQEQNEKIYAPRGLLITDPIERGMRVIEISIYEDR 131          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Cavefish
Match: golga7 (golgin A7 [Source:ZFIN;Acc:ZDB-GENE-040625-142])

HSP 1 Score: 114.005 bits (284), Expect = 2.427e-30
Identity = 54/128 (42.19%), Postives = 80/128 (62.50%), Query Frame = 1
Query:  121 TSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRS 504
             +   K F+QRD++ GT  +FQ    P EL+  IE + F+E +  +N ++  AE L   + +E CL CLTAY +FLC+ T+YEK +K++   IQ  N+KV+ P  L++ +P+ERGLRVV   I   RS
Sbjct:   14 AAIASKVFVQRDYTSGTICKFQT-KFPSELETRIEKQQFEETVQTLNNLYAEAEKLGGKSYLEGCLACLTAYTIFLCMETHYEKVLKKIAKYIQEQNEKVYAPLGLLLTDPIERGLRVVEITIFEDRS 140          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Cavefish
Match: golga7 (golgin A7 [Source:ZFIN;Acc:ZDB-GENE-040625-142])

HSP 1 Score: 113.235 bits (282), Expect = 8.866e-30
Identity = 54/128 (42.19%), Postives = 80/128 (62.50%), Query Frame = 1
Query:  121 TSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRS 504
             +   K F+QRD++ GT  +FQ    P EL+  IE + F+E +  +N ++  AE L   + +E CL CLTAY +FLC+ T+YEK +K++   IQ  N+KV+ P  L++ +P+ERGLRVV   I   RS
Sbjct:   36 AAIASKVFVQRDYTSGTICKFQT-KFPSELETRIEKQQFEETVQTLNNLYAEAEKLGGKSYLEGCLACLTAYTIFLCMETHYEKVLKKIAKYIQEQNEKVYAPLGLLLTDPIERGLRVVEITIFEDRS 162          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Cavefish
Match: golga7bb (golgin A7 family, member Bb [Source:ZFIN;Acc:ZDB-GENE-090312-173])

HSP 1 Score: 112.464 bits (280), Expect = 1.365e-29
Identity = 54/127 (42.52%), Postives = 78/127 (61.42%), Query Frame = 1
Query:  121 TSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSR 501
             S   K FIQRD+S GT  RF     P ELD  IE  +F+E I  +N  +  AE +   + +E CL C +AY++FLC+ T YEK +K++   IQ  N+K++ PR L+I +P+ERG+RV+  +I   R
Sbjct:   15 ASLATKVFIQRDYSEGTLCRFHT-KFPAELDSRIERTLFEETIKTLNNYYAEAEKIGGRSYLEGCLACASAYIIFLCMETRYEKVLKKISTYIQEQNEKIYAPRGLLITDPIERGMRVIEISIFEDR 140          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Cavefish
Match: golga7bb (golgin A7 family, member Bb [Source:ZFIN;Acc:ZDB-GENE-090312-173])

HSP 1 Score: 111.694 bits (278), Expect = 1.139e-28
Identity = 52/119 (43.70%), Postives = 75/119 (63.03%), Query Frame = 1
Query:  121 TSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
             S   K FIQRD+S GT  RF     P ELD  IE  +F+E I  +N  +  AE +   + +E CL C +AY++FLC+ T YEK +K++   IQ  N+K++ PR L+I +P+ERG+RV+
Sbjct:   68 ASLATKVFIQRDYSEGTLCRFHT-KFPAELDSRIERTLFEETIKTLNNYYAEAEKIGGRSYLEGCLACASAYIIFLCMETRYEKVLKKISTYIQEQNEKIYAPRGLLITDPIERGMRVI 185          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Sea Lamprey
Match: golga7ba (golgin A7 family, member Ba [Source:ZFIN;Acc:ZDB-GENE-050417-14])

HSP 1 Score: 90.8929 bits (224), Expect = 5.865e-23
Identity = 35/86 (40.70%), Postives = 60/86 (69.77%), Query Frame = 1
Query:  220 IEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
            IE  +F++ +   N ++  AE +  ++ +E+CLGCLT Y LF+C+ T YEK ++++   +Q  N+K++ PR L+I +P+ERGLRV+
Sbjct:    2 IEKNLFEDTVRTFNKLYTEAEKIGAHSYVESCLGCLTGYTLFMCMETRYEKVLRKISKYVQEQNEKIYAPRGLLITDPIERGLRVI 87          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Nematostella
Match: EDO32344 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVB8])

HSP 1 Score: 116.316 bits (290), Expect = 6.453e-32
Identity = 58/114 (50.88%), Postives = 74/114 (64.91%), Query Frame = 1
Query:  136 KTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
            K F+QRD+S GT  RFQ    P EL+  I+  +F + ++ IN I D AE + + + IE CLGCLTAYL++ CI T Y + +K L   I   N  VFVPR LMI +PMERGLRVV
Sbjct:    3 KVFLQRDYSHGTACRFQT-KFPPELENKIDRGIFDQTVNTINSILDDAEKVGVQSYIEGCLGCLTAYLIYSCIQTQYARNLKRLTEYITEQNQTVFVPRGLMITHPMERGLRVV 115          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Medaka
Match: GOLGA7 (golgin A7 [Source:NCBI gene;Acc:101164159])

HSP 1 Score: 117.472 bits (293), Expect = 1.290e-31
Identity = 55/123 (44.72%), Postives = 80/123 (65.04%), Query Frame = 1
Query:  136 KTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRS 504
            K FIQRD++ GT  +FQ    P EL+  I+ + F+E +  +N ++  AE L   + +E CL CLTAY +FLC+ T+YEK +K++   IQ  NDKV+ PR L++ +P+ERGLRV+   I   RS
Sbjct:   19 KVFIQRDYTNGTLCQFQT-KFPSELETKIDKQQFEETVRTLNNLYAEAEKLGSQSYVEGCLACLTAYTIFLCMETHYEKVLKKIAKYIQEQNDKVYAPRGLLLTDPLERGLRVIEITIFEDRS 140          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Medaka
Match: GOLGA7B (golgin subfamily A member 7B [Source:NCBI gene;Acc:101168845])

HSP 1 Score: 117.087 bits (292), Expect = 3.170e-31
Identity = 54/128 (42.19%), Postives = 79/128 (61.72%), Query Frame = 1
Query:  118 PTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSR 501
              S   K FIQRD+S GT  RFQ    P EL+  IE  +F++ +  +N  +  AE +   + +E CL C TAYL+FLC+ T YEK +K++   IQ  N+K++ PR L+I +P+ERG+RV+  +I   R
Sbjct:   14 SASLANKVFIQRDYSEGTACRFQT-KFPSELESRIERTLFEDTVKTLNTFYAEAEKIGGQSYLEGCLACATAYLIFLCMETRYEKVLKKIAKYIQEQNEKIYAPRGLLITDPIERGMRVIEVSIYEDR 140          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Medaka
Match: golga7 (golgin subfamily A member 7-like [Source:NCBI gene;Acc:111947425])

HSP 1 Score: 114.775 bits (286), Expect = 1.750e-30
Identity = 51/114 (44.74%), Postives = 79/114 (69.30%), Query Frame = 1
Query:  136 KTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
            K FIQRD+S GT  +FQ    P EL+  ++ + F+E I  +N ++  AE L  ++ +E CL CLTAY +FLC+ T+YEK +K++   I++ N+K++ PR L++ +P+ERGLRVV
Sbjct:   25 KVFIQRDYSSGTICKFQT-KFPSELESRLDKQQFEETIQTLNNLYAEAEKLGGSSYLEGCLACLTAYTVFLCMETHYEKVLKKIARYIRDQNEKIYAPRGLLLTDPIERGLRVV 137          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Medaka
Match: golga7 (golgin subfamily A member 7-like [Source:NCBI gene;Acc:111947425])

HSP 1 Score: 114.39 bits (285), Expect = 1.898e-30
Identity = 51/114 (44.74%), Postives = 79/114 (69.30%), Query Frame = 1
Query:  136 KTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
            K FIQRD+S GT  +FQ    P EL+  ++ + F+E I  +N ++  AE L  ++ +E CL CLTAY +FLC+ T+YEK +K++   I++ N+K++ PR L++ +P+ERGLRVV
Sbjct:   18 KVFIQRDYSSGTICKFQT-KFPSELESRLDKQQFEETIQTLNNLYAEAEKLGGSSYLEGCLACLTAYTVFLCMETHYEKVLKKIARYIRDQNEKIYAPRGLLLTDPIERGLRVV 130          
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Medaka
Match: golga7 (golgin subfamily A member 7-like [Source:NCBI gene;Acc:111947425])

HSP 1 Score: 112.079 bits (279), Expect = 1.245e-29
Identity = 50/112 (44.64%), Postives = 78/112 (69.64%), Query Frame = 1
Query:  142 FIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
            FIQRD+S GT  +FQ    P EL+  ++ + F+E I  +N ++  AE L  ++ +E CL CLTAY +FLC+ T+YEK +K++   I++ N+K++ PR L++ +P+ERGLRVV
Sbjct:   13 FIQRDYSSGTICKFQT-KFPSELESRLDKQQFEETIQTLNNLYAEAEKLGGSSYLEGCLACLTAYTVFLCMETHYEKVLKKIARYIRDQNEKIYAPRGLLLTDPIERGLRVV 123          
BLAST of Acetyl-CoA C-acetyltransferase vs. Planmine SMEST
Match: SMESG000043482.1 (SMESG000043482.1)

HSP 1 Score: 275.018 bits (702), Expect = 5.746e-93
Identity = 140/164 (85.37%), Postives = 140/164 (85.37%), Query Frame = 1
Query:  100 MSKHYTPTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRSDINIIFFSHWLPF*IEVCIFDSNMSNEGF 591
            MSKHYTPTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRV                        IEVCIFDSNMSNEGF
Sbjct:    1 MSKHYTPTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRV------------------------IEVCIFDSNMSNEGF 140          
BLAST of Acetyl-CoA C-acetyltransferase vs. Planmine SMEST
Match: SMESG000016125.1 (SMESG000016125.1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.448e-22
Identity = 45/115 (39.13%), Postives = 68/115 (59.13%), Query Frame = 1
Query:  133 RKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
            RK FI RDF+ G E+ FQ+     +L  +I P   K  IH +N I+  AE +SM  C    LGCL+ YL  LC+ + Y+K  K+    I+ +N K F P  + +++P+ERG+R++
Sbjct:   14 RKVFIHRDFTQGIELCFQDKYFDPQLIEIINPNTLKTIIHTLNEIYSEAEMISMRNCCYTMLGCLSCYLFNLCVDSDYKKFTKKASRYIKRVNLKYFAPNGIYMIDPVERGMRLI 128          
BLAST of Acetyl-CoA C-acetyltransferase vs. Planmine SMEST
Match: SMESG000016125.1 (SMESG000016125.1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.971e-22
Identity = 45/115 (39.13%), Postives = 68/115 (59.13%), Query Frame = 1
Query:  133 RKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAIHQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLIQNLNDKVFVPRNLMIVNPMERGLRVV 477
            RK FI RDF+ G E+ FQ+     +L  +I P   K  IH +N I+  AE +SM  C    LGCL+ YL  LC+ + Y+K  K+    I+ +N K F P  + +++P+ERG+R++
Sbjct:   14 RKVFIHRDFTQGIELCFQDKYFDPQLIEIINPNTLKTIIHTLNEIYSEAEMISMRNCCYTMLGCLSCYLFNLCVDSDYKKFTKKASRYIKRVNLKYFAPNGIYMIDPVERGMRLI 128          
The following BLAST results are available for this feature:
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GOLGA7B2.498e-3042.19golgin A7 family member B [Source:HGNC Symbol;Acc:... [more]
GOLGA7B2.960e-3042.52golgin A7 family member B [Source:HGNC Symbol;Acc:... [more]
GOLGA71.666e-2942.28golgin A7 [Source:HGNC Symbol;Acc:HGNC:24876][more]
GOLGA71.666e-2942.28golgin A7 [Source:HGNC Symbol;Acc:HGNC:24876][more]
GOLGA71.666e-2942.28golgin A7 [Source:HGNC Symbol;Acc:HGNC:24876][more]
back to top
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y57G11C.331.056e-1737.93pep chromosome:WBcel235:IV:14657086:14658165:1 gen... [more]
Y57G11C.331.372e-1536.67pep chromosome:WBcel235:IV:14657081:14658165:1 gen... [more]
back to top
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG54471.427e-2741.23gene:FBgn0039427 transcript:FBtr0085012[more]
CG54472.428e-2741.23gene:FBgn0039427 transcript:FBtr0330152[more]
back to top
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
golga7bb3.827e-3245.38golgin A7 family, member Bb [Source:ZFIN;Acc:ZDB-G... [more]
golga7bb1.295e-3145.76golgin A7 family, member Bb [Source:ZFIN;Acc:ZDB-G... [more]
golga7ba7.433e-3142.97golgin A7 family, member Ba [Source:ZFIN;Acc:ZDB-G... [more]
golga7ba1.781e-3043.31golgin A7 family, member Ba [Source:ZFIN;Acc:ZDB-G... [more]
golga72.183e-2941.41golgin A7 [Source:ZFIN;Acc:ZDB-GENE-040625-142][more]
back to top
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cacfd12.181e-2939.84calcium channel flower domain containing 1 [Source... [more]
cacfd11.088e-2840.65calcium channel flower domain containing 1 [Source... [more]
mafb6.444e-2839.84v-maf avian musculoaponeurotic fibrosarcoma oncoge... [more]
back to top
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Golga7b1.336e-3042.97golgi autoantigen, golgin subfamily a, 7B [Source:... [more]
Golga7b1.336e-3042.97golgi autoantigen, golgin subfamily a, 7B [Source:... [more]
Golga71.109e-2940.74golgi autoantigen, golgin subfamily a, 7 [Source:M... [more]
Golga71.109e-2940.74golgi autoantigen, golgin subfamily a, 7 [Source:M... [more]
back to top
BLAST of Acetyl-CoA C-acetyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D428|GOG7B_MOUSE9.344e-3042.97Golgin subfamily A member 7B OS=Mus musculus OX=10... [more]
sp|Q2TAP0|GOG7B_HUMAN1.199e-2942.19Golgin subfamily A member 7B OS=Homo sapiens OX=96... [more]
sp|Q5ZLC9|GOGA7_CHICK2.825e-2940.74Golgin subfamily A member 7 OS=Gallus gallus OX=90... [more]
sp|Q91W53|GOGA7_MOUSE7.754e-2940.74Golgin subfamily A member 7 OS=Mus musculus OX=100... [more]
sp|Q7Z5G4|GOGA7_HUMAN8.000e-2942.28Golgin subfamily A member 7 OS=Homo sapiens OX=960... [more]
back to top
BLAST of Acetyl-CoA C-acetyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MAQ05.047e-3753.78Erf4 domain-containing protein OS=Opisthorchis fel... [more]
A0A0V0J4K57.961e-3644.03Golgin subfamily A member 7 OS=Schistocephalus sol... [more]
A0A504Z1958.330e-3648.82Golgi autoantigen golgin subfamily a 7 OS=Fasciola... [more]
A0A183MYM72.870e-3549.58Erf4 domain-containing protein OS=Schistosoma marg... [more]
A0A183NWU54.027e-3549.15Erf4 domain-containing protein OS=Schistosoma matt... [more]
back to top
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
golga7ba5.641e-3142.52golgin A7 family, member Ba [Source:ZFIN;Acc:ZDB-G... [more]
golga72.427e-3042.19golgin A7 [Source:ZFIN;Acc:ZDB-GENE-040625-142][more]
golga78.866e-3042.19golgin A7 [Source:ZFIN;Acc:ZDB-GENE-040625-142][more]
golga7bb1.365e-2942.52golgin A7 family, member Bb [Source:ZFIN;Acc:ZDB-G... [more]
golga7bb1.139e-2843.70golgin A7 family, member Bb [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
golga7ba5.865e-2340.70golgin A7 family, member Ba [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO323446.453e-3250.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acetyl-CoA C-acetyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GOLGA71.290e-3144.72golgin A7 [Source:NCBI gene;Acc:101164159][more]
GOLGA7B3.170e-3142.19golgin subfamily A member 7B [Source:NCBI gene;Acc... [more]
golga71.750e-3044.74golgin subfamily A member 7-like [Source:NCBI gene... [more]
golga71.898e-3044.74golgin subfamily A member 7-like [Source:NCBI gene... [more]
golga71.245e-2944.64golgin subfamily A member 7-like [Source:NCBI gene... [more]
back to top
BLAST of Acetyl-CoA C-acetyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000043482.15.746e-9385.37SMESG000043482.1[more]
SMESG000016125.11.448e-2239.13SMESG000016125.1[more]
SMESG000016125.13.971e-2239.13SMESG000016125.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026577 ID=SMED30026577|Name=Acetyl-CoA C-acetyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1147bp
TTCCGATCTTGAATTTGTTTGTTGTATTAATATTTAATTATAATATTAAT
TTTATAACTGTATAAGATCATACTATTATTGATTATTTAATTAAATCCAA
TGTCCAAACATTATACACCCACATCAACTTGCAGGAAAACTTTTATCCAA
AGGGATTTTTCACTAGGAACAGAAGTTAGATTTCAAGAATTTCCTTTGCC
ACAAGAGCTTGATGGACTTATTGAACCAGAAGTATTTAAAGAAGCTATTC
ATCAGATTAATTGTATTTTCGATAGAGCCGAAACGTTATCCATGAACACA
TGCATAGAAAACTGCCTTGGTTGTTTAACAGCTTATTTATTATTTCTTTG
CATTCCAACATATTATGAAAAATGCATGAAAGAACTGTGCTTGCTCATTC
AAAACCTTAACGACAAGGTATTTGTGCCCAGAAACCTCATGATTGTAAAC
CCCATGGAGCGTGGTTTGCGCGTGGTAATTAATAATATTTCTCCTTCACG
TTCCGATATTAATATAATTTTTTTTTCTCATTGGCTGCCATTCTAGATCG
AAGTTTGTATATTTGACAGTAACATGTCCAATGAGGGATTCTGACGGGAG
GAAATCCGCATTTTTCTCTCTCTGGGAACTTTATTATCATTTTTGATCGT
GTTCTCAATGTGATTTTTGTAAAATTCTGTTTTTATGGTGATGATTGATT
ACTAATTGATTGGTGATTATTGATTATGATAATTATTGATTATTATTACA
CATTTTCTATTCCCTTGATGTATTTATGCTGTGCGTGCGTGTGTAATTAT
CCCATTGTCATATGCTGTTGCTGCTGCTAATATTCACTGTAAATACGCGC
CGGCTGCTCCTTTGGCATCGCATTATTGACCGCCCCGCAGCATCAGCAAC
ATTATATCTGCATCACGCAATCTCACGTCAATATATGATTTGTGATATTC
GATTTTAGCACCAATCAATGAAAATGAATCAATAGTGATAATTGTGCAAT
CAATATTGATTATTATTGTTCATGTGAATATCGATAATCATTGAAATTGT
GTGTCGGAATTATTAATATATTATTATATTCATTATTATTTATTCACCAT
TTTCCGTTTTGTCACGTGGCATCATTCAATTATAATTGATTTTCAGG
back to top

protein sequence of SMED30026577-orf-1

>SMED30026577-orf-1 ID=SMED30026577-orf-1|Name=SMED30026577-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=149bp
MSKHYTPTSTCRKTFIQRDFSLGTEVRFQEFPLPQELDGLIEPEVFKEAI
HQINCIFDRAETLSMNTCIENCLGCLTAYLLFLCIPTYYEKCMKELCLLI
QNLNDKVFVPRNLMIVNPMERGLRVVINNISPSRSDINIIFFSHWLPF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003985acetyl-CoA C-acetyltransferase activity
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR019383Golgin_A_7/ERF4
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0002178palmitoyltransferase complex
GO:0005794Golgi apparatus
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006612protein targeting to membrane
GO:0018230peptidyl-L-cysteine S-palmitoylation
GO:0072659protein localization to plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019383Golgin subfamily A member 7/ERF4PFAMPF10256Erf4coord: 15..126
e-value: 5.4E-26
score: 91.0
NoneNo IPR availablePANTHERPTHR13254GOLGI AUTOANTIGEN, GOLGIN SUBFAMILY A, 7coord: 9..127