Suppressor of cytokine signaling 6

Overview
NameSuppressor of cytokine signaling 6
Smed IDSMED30026576
Length (bp)1515
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Suppressor of cytokine signaling 6 (SMED30026576) t-SNE clustered cells

Violin plots show distribution of expression levels for Suppressor of cytokine signaling 6 (SMED30026576) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Suppressor of cytokine signaling 6 (SMED30026576) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Suppressor of cytokine signaling 6 (SMED30026576) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026576

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30026576h1SMcG0013383 dd_Smed_v4_5869_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026576h1SMcG0013383 dd_Smed_v4_5869_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Human
Match: SOCS6 (suppressor of cytokine signaling 6 [Source:HGNC Symbol;Acc:HGNC:16833])

HSP 1 Score: 113.62 bits (283), Expect = 3.057e-26
Identity = 74/192 (38.54%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFL--PD-EEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA  GWYWGP+TR EA  +L +  DG FLVRDS  D    +LSF+  G+  H RI   N +++F   PD E   SI  LI  ++R S   A+C+SRS                                 GS T    + VRL +PVSR+  V RSL YLCRF+IRQYT +  +  L +   +  YLQ+  Y
Sbjct:  379 LAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSR------------------------------LPGSAT----YPVRLTNPVSRFMQV-RSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 535          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Human
Match: SOCS6 (suppressor of cytokine signaling 6 [Source:HGNC Symbol;Acc:HGNC:16833])

HSP 1 Score: 113.62 bits (283), Expect = 3.057e-26
Identity = 74/192 (38.54%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFL--PD-EEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA  GWYWGP+TR EA  +L +  DG FLVRDS  D    +LSF+  G+  H RI   N +++F   PD E   SI  LI  ++R S   A+C+SRS                                 GS T    + VRL +PVSR+  V RSL YLCRF+IRQYT +  +  L +   +  YLQ+  Y
Sbjct:  379 LAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSR------------------------------LPGSAT----YPVRLTNPVSRFMQV-RSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 535          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Human
Match: SOCS7 (suppressor of cytokine signaling 7 [Source:HGNC Symbol;Acc:HGNC:29846])

HSP 1 Score: 75.0998 bits (183), Expect = 1.030e-13
Identity = 55/194 (28.35%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            L   GWYWGP+   +A  +L+ K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V                              G   T     V+LL+PVSR+SNV +SL +LCRF IRQ   +  +  L +   +++Y++   YY
Sbjct:  367 LEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRV-----------------------------PGLPPT----PVQLLYPVSRFSNV-KSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 526          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Human
Match: SOCS7 (suppressor of cytokine signaling 7 [Source:HGNC Symbol;Acc:HGNC:29846])

HSP 1 Score: 74.7146 bits (182), Expect = 1.258e-13
Identity = 55/194 (28.35%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            L   GWYWGP+   +A  +L+ K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V                              G   T     V+LL+PVSR+SNV +SL +LCRF IRQ   +  +  L +   +++Y++   YY
Sbjct:  361 LEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRV-----------------------------PGLPPT----PVQLLYPVSRFSNV-KSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 520          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Human
Match: SOCS7 (suppressor of cytokine signaling 7 [Source:HGNC Symbol;Acc:HGNC:29846])

HSP 1 Score: 74.7146 bits (182), Expect = 1.566e-13
Identity = 55/194 (28.35%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            L   GWYWGP+   +A  +L+ K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V                              G   T     V+LL+PVSR+SNV +SL +LCRF IRQ   +  +  L +   +++Y++   YY
Sbjct:  395 LEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRV-----------------------------PGLPPT----PVQLLYPVSRFSNV-KSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 554          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Celegans
Match: abl-1 (Tyrosine-protein kinase abl-1 [Source:UniProtKB/Swiss-Prot;Acc:P03949])

HSP 1 Score: 52.373 bits (124), Expect = 8.350e-7
Identity = 27/89 (30.34%), Postives = 50/89 (56.18%), Query Frame = 1
Query:  556 VANTYPPRYGYLASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDE-EFDSIPALI 819
            V + +   Y  L  + WY G ++R+++   L     G FLVR+SE  + ++T+S +  G++FH RI   N++  F+  E +F ++  L+
Sbjct:  163 VPSNFIAPYNSLDKYTWYHGKISRSDSEAILGSGITGSFLVRESETSIGQYTISVRHDGRVFHYRINVDNTEKMFITQEVKFRTLGELV 251          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Celegans
Match: abl-1 (Tyrosine-protein kinase abl-1 [Source:UniProtKB/Swiss-Prot;Acc:P03949])

HSP 1 Score: 51.9878 bits (123), Expect = 9.186e-7
Identity = 27/89 (30.34%), Postives = 50/89 (56.18%), Query Frame = 1
Query:  556 VANTYPPRYGYLASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDE-EFDSIPALI 819
            V + +   Y  L  + WY G ++R+++   L     G FLVR+SE  + ++T+S +  G++FH RI   N++  F+  E +F ++  L+
Sbjct:  168 VPSNFIAPYNSLDKYTWYHGKISRSDSEAILGSGITGSFLVRESETSIGQYTISVRHDGRVFHYRINVDNTEKMFITQEVKFRTLGELV 256          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Celegans
Match: abl-1 (Tyrosine-protein kinase abl-1 [Source:UniProtKB/Swiss-Prot;Acc:P03949])

HSP 1 Score: 51.9878 bits (123), Expect = 9.604e-7
Identity = 27/89 (30.34%), Postives = 50/89 (56.18%), Query Frame = 1
Query:  556 VANTYPPRYGYLASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDE-EFDSIPALI 819
            V + +   Y  L  + WY G ++R+++   L     G FLVR+SE  + ++T+S +  G++FH RI   N++  F+  E +F ++  L+
Sbjct:  178 VPSNFIAPYNSLDKYTWYHGKISRSDSEAILGSGITGSFLVRESETSIGQYTISVRHDGRVFHYRINVDNTEKMFITQEVKFRTLGELV 266          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Fly
Match: Socs16D (gene:FBgn0030869 transcript:FBtr0074473)

HSP 1 Score: 68.9366 bits (167), Expect = 6.324e-12
Identity = 57/184 (30.98%), Postives = 82/184 (44.57%), Query Frame = 1
Query:  598 FGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDS--IPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDL-DMLGVTGDVLTYL 1140
            +GWYWGPL+   A + L  + DG F+VRDS  D   F+LSFK    + H RI +    ++F    +F S  I   I  A+  S +  Y F                   H + E        HG            V+L +PVSR+ +V +SL ++CRF+I +     DL   L +   +L YL
Sbjct:  843 YGWYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKFKSQTITEFIEKAVEHSRSGRYLFF-----------------LHRRPE--------HGP---------MRVQLTNPVSRFKHV-QSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYL 991          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Fly
Match: Socs16D (gene:FBgn0030869 transcript:FBtr0310310)

HSP 1 Score: 68.9366 bits (167), Expect = 6.446e-12
Identity = 57/184 (30.98%), Postives = 82/184 (44.57%), Query Frame = 1
Query:  598 FGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDS--IPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDL-DMLGVTGDVLTYL 1140
            +GWYWGPL+   A + L  + DG F+VRDS  D   F+LSFK    + H RI +    ++F    +F S  I   I  A+  S +  Y F                   H + E        HG            V+L +PVSR+ +V +SL ++CRF+I +     DL   L +   +L YL
Sbjct:  848 YGWYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKFKSQTITEFIEKAVEHSRSGRYLFF-----------------LHRRPE--------HGP---------MRVQLTNPVSRFKHV-QSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYL 996          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Fly
Match: Socs44A (gene:FBgn0033266 transcript:FBtr0088784)

HSP 1 Score: 66.6254 bits (161), Expect = 1.256e-11
Identity = 51/179 (28.49%), Postives = 77/179 (43.02%), Query Frame = 1
Query:  604 WYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYL 1140
            WYWG ++R ++ ++L  K  G FLVRDSE   ++FTLSF+      H R L +   +    + +++SI  +I D + R                                 N N VC               V L +P+SRYSN+P+ L  LCR ++++      L  L V   +L YL
Sbjct:  189 WYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYR-LEYRDNFWHFEELKYESIVEMIEDILHRC-------------------------------TNDNFVCF--VKVPNEMQPPFPVILKYPLSRYSNMPK-LQDLCRRVLQRQMSREQLAQLPVPAQMLEYL 332          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Fly
Match: hwt (gene:FBgn0264542 transcript:FBtr0346131)

HSP 1 Score: 57.3806 bits (137), Expect = 3.142e-8
Identity = 29/75 (38.67%), Postives = 40/75 (53.33%), Query Frame = 1
Query:  601 GWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPD--EEFDSIPALI 819
            GWY G +TR EA   LR   +G FLVR+ E     ++LS KGA    H RI R+ +    L      F+++P +I
Sbjct: 1348 GWYHGAITRIEAETTLRPLSEGSFLVRNCESTKQDYSLSLKGAKGFMHMRIQRNETGQYILGQFSRPFETVPEMI 1422          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Fly
Match: hwt (gene:FBgn0264542 transcript:FBtr0333156)

HSP 1 Score: 56.9954 bits (136), Expect = 3.678e-8
Identity = 29/75 (38.67%), Postives = 40/75 (53.33%), Query Frame = 1
Query:  601 GWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPD--EEFDSIPALI 819
            GWY G +TR EA   LR   +G FLVR+ E     ++LS KGA    H RI R+ +    L      F+++P +I
Sbjct:  779 GWYHGAITRIEAETTLRPLSEGSFLVRNCESTKQDYSLSLKGAKGFMHMRIQRNETGQYILGQFSRPFETVPEMI 853          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Zebrafish
Match: socs6a (suppressor of cytokine signaling 6a [Source:ZFIN;Acc:ZDB-GENE-080722-35])

HSP 1 Score: 113.235 bits (282), Expect = 2.450e-26
Identity = 73/192 (38.02%), Postives = 97/192 (50.52%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFL--PD-EEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA  GWYWGP+TR EA ++L +  DG FLVRDS  D    +LSF+  G+  H RI   N +++F   PD E   SI  LI  +++ S   A+C+SRS                                 GS T    + VRL +PVSR+  V RSL YLCRF+IRQYT +  +  L +   +  YLQ+  Y
Sbjct:  363 LAKQGWYWGPITRWEAEEKLVNLPDGSFLVRDSSDDRYLLSLSFRSQGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIKDSENGAFCYSRSR------------------------------LPGSAT----YPVRLTNPVSRFMQV-RSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 519          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Zebrafish
Match: socs6b (suppressor of cytokine signaling 6b [Source:ZFIN;Acc:ZDB-GENE-030131-1670])

HSP 1 Score: 109.768 bits (273), Expect = 3.654e-25
Identity = 72/192 (37.50%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFL--PD-EEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA  GWYWGP+TR EA ++L +  DG FLVRDS  D    +LSF+   +  H RI   N  ++F   PD E   SI  LI ++++ S   A+C+SRS                                 GS T    + VRL +PVSR+  V RSL YLCRF+IRQYT +  +  L +   +  YLQ+  Y
Sbjct:  376 LAKQGWYWGPITRWEAEEKLTNLPDGSFLVRDSSDDRYLLSLSFRSQTKTLHTRIEHSNGSFSFYEQPDIEGHVSIVDLIDNSVKDSENGAFCYSRSR------------------------------LPGSAT----YPVRLTNPVSRFMQV-RSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 532          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Zebrafish
Match: socs7 (suppressor of cytokine signaling 7 [Source:ZFIN;Acc:ZDB-GENE-080204-125])

HSP 1 Score: 78.5666 bits (192), Expect = 6.312e-15
Identity = 57/195 (29.23%), Postives = 84/195 (43.08%), Query Frame = 1
Query:  586 YLASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            Y    GWYWGP+   +A  +LR K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V                              G   T     V+LL+PVSR+SNV +SL +LCRF IRQ   +  +  L +   ++ YL+   YY
Sbjct:  431 YCLYCGWYWGPMNWEDAEMKLRGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRV-----------------------------PGLPPT----PVQLLYPVSRFSNV-KSLQHLCRFCIRQLVRIDHIQELPLPKPLIVYLRKFYYY 591          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Zebrafish
Match: socs7 (suppressor of cytokine signaling 7 [Source:ZFIN;Acc:ZDB-GENE-080204-125])

HSP 1 Score: 78.1814 bits (191), Expect = 9.073e-15
Identity = 56/190 (29.47%), Postives = 83/190 (43.68%), Query Frame = 1
Query:  601 GWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            GWYWGP+   +A  +LR K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V                              G   T     V+LL+PVSR+SNV +SL +LCRF IRQ   +  +  L +   ++ YL+   YY
Sbjct:  477 GWYWGPMNWEDAEMKLRGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRV-----------------------------PGLPPT----PVQLLYPVSRFSNV-KSLQHLCRFCIRQLVRIDHIQELPLPKPLIVYLRKFYYY 632          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Zebrafish
Match: socs7 (suppressor of cytokine signaling 7 [Source:ZFIN;Acc:ZDB-GENE-080204-125])

HSP 1 Score: 78.1814 bits (191), Expect = 9.073e-15
Identity = 56/190 (29.47%), Postives = 83/190 (43.68%), Query Frame = 1
Query:  601 GWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            GWYWGP+   +A  +LR K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V                              G   T     V+LL+PVSR+SNV +SL +LCRF IRQ   +  +  L +   ++ YL+   YY
Sbjct:  477 GWYWGPMNWEDAEMKLRGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRV-----------------------------PGLPPT----PVQLLYPVSRFSNV-KSLQHLCRFCIRQLVRIDHIQELPLPKPLIVYLRKFYYY 632          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Xenopus
Match: tmbim6 (transmembrane BAX inhibitor motif containing 6 [Source:Xenbase;Acc:XB-GENE-952610])

HSP 1 Score: 113.235 bits (282), Expect = 3.823e-26
Identity = 73/192 (38.02%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFL--PD-EEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA  GWYWGP+TR EA ++L +  DG FLVRDS  D    +LSF+   +  H RI   N +++F   PD E   SI  LI  ++R S   A+C+SRS                                 GS T    + VRL +PVSR+  V RSL YLCRF+IRQYT +  +  L +   +  YLQ+  Y
Sbjct:  377 LARQGWYWGPITRWEAEEKLANVLDGSFLVRDSSDDRYLLSLSFRSHSKTLHTRIEHSNGRFSFYEQPDVEGHTSIVELIEHSIRDSENGAFCYSRSR------------------------------VPGSAT----YPVRLTNPVSRFMQV-RSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 533          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Xenopus
Match: cdc42se1 (cdc42 small effector 1 [Source:Xenbase;Acc:XB-GENE-945193])

HSP 1 Score: 75.485 bits (184), Expect = 4.868e-14
Identity = 56/194 (28.87%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            L   GWYWGP+   +A  +L+ K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V                              G   T     V+LL+PVSR+SNV +SL +LCRF IRQ   +  +  L +   +++YL+   YY
Sbjct:  266 LEKCGWYWGPMNWEDAEMKLKAKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRV-----------------------------PGLPPT----PVQLLYPVSRFSNV-KSLQHLCRFRIRQLVRIDHIPELPLPKPLISYLRKFYYY 425          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Xenopus
Match: cdc42se1 (cdc42 small effector 1 [Source:Xenbase;Acc:XB-GENE-945193])

HSP 1 Score: 75.8702 bits (185), Expect = 5.604e-14
Identity = 56/194 (28.87%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            L   GWYWGP+   +A  +L+ K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V                              G   T     V+LL+PVSR+SNV +SL +LCRF IRQ   +  +  L +   +++YL+   YY
Sbjct:  350 LEKCGWYWGPMNWEDAEMKLKAKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRV-----------------------------PGLPPT----PVQLLYPVSRFSNV-KSLQHLCRFRIRQLVRIDHIPELPLPKPLISYLRKFYYY 509          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Xenopus
Match: cdc42se1 (cdc42 small effector 1 [Source:Xenbase;Acc:XB-GENE-945193])

HSP 1 Score: 75.0998 bits (183), Expect = 1.006e-13
Identity = 56/194 (28.87%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            L   GWYWGP+   +A  +L+ K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V                              G   T     V+LL+PVSR+SNV +SL +LCRF IRQ   +  +  L +   +++YL+   YY
Sbjct:  384 LEKCGWYWGPMNWEDAEMKLKAKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRV-----------------------------PGLPPT----PVQLLYPVSRFSNV-KSLQHLCRFRIRQLVRIDHIPELPLPKPLISYLRKFYYY 543          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Xenopus
Match: PIK3R1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:NCBI gene;Acc:100486835])

HSP 1 Score: 59.3066 bits (142), Expect = 7.308e-9
Identity = 32/95 (33.68%), Postives = 45/95 (47.37%), Query Frame = 1
Query:  541 PQSMHVANTYPPRYGYLASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDM-NKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDSIPALIA 822
            P+S  V N        L    WYWG ++R E  ++LR   DG FLVRD+   M   +TL+ +  G     +I   + KY F     F+S+  LI 
Sbjct:    9 PKSTAVTNNGTNHIMSLQDAEWYWGDISREEVNEKLRDTTDGTFLVRDASTIMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELIT 103          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Mouse
Match: Socs6 (suppressor of cytokine signaling 6 [Source:MGI Symbol;Acc:MGI:1924885])

HSP 1 Score: 112.464 bits (280), Expect = 5.096e-26
Identity = 74/192 (38.54%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFL--PD-EEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA  GWYWGP+TR EA  +L +  DG FLVRDS  D    +LSF+  G+  H RI   N +++F   PD E   SI  LI  ++R S   A+C+SRS                                 GS T    + VRL +PVSR+  V RSL YLCRF+IRQYT +  +  L +   +  YLQ+  Y
Sbjct:  377 LAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSR------------------------------LPGSAT----YPVRLTNPVSRFMQV-RSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 533          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Mouse
Match: Socs6 (suppressor of cytokine signaling 6 [Source:MGI Symbol;Acc:MGI:1924885])

HSP 1 Score: 112.464 bits (280), Expect = 5.096e-26
Identity = 74/192 (38.54%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFL--PD-EEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA  GWYWGP+TR EA  +L +  DG FLVRDS  D    +LSF+  G+  H RI   N +++F   PD E   SI  LI  ++R S   A+C+SRS                                 GS T    + VRL +PVSR+  V RSL YLCRF+IRQYT +  +  L +   +  YLQ+  Y
Sbjct:  377 LAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSR------------------------------LPGSAT----YPVRLTNPVSRFMQV-RSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 533          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Mouse
Match: Socs6 (suppressor of cytokine signaling 6 [Source:MGI Symbol;Acc:MGI:1924885])

HSP 1 Score: 112.464 bits (280), Expect = 5.096e-26
Identity = 74/192 (38.54%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFL--PD-EEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA  GWYWGP+TR EA  +L +  DG FLVRDS  D    +LSF+  G+  H RI   N +++F   PD E   SI  LI  ++R S   A+C+SRS                                 GS T    + VRL +PVSR+  V RSL YLCRF+IRQYT +  +  L +   +  YLQ+  Y
Sbjct:  377 LAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSR------------------------------LPGSAT----YPVRLTNPVSRFMQV-RSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 533          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Mouse
Match: Socs7 (suppressor of cytokine signaling 7 [Source:MGI Symbol;Acc:MGI:2651588])

HSP 1 Score: 74.3294 bits (181), Expect = 1.212e-13
Identity = 55/194 (28.35%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            L   GWYWGP+   +A  +L+ K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V                              G   T     V+LL+PVSR+SNV +SL +LCRF IRQ   +  +  L +   +++Y++   YY
Sbjct:  393 LEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRV-----------------------------PGLPPT----PVQLLYPVSRFSNV-KSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 552          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Mouse
Match: Socs7 (suppressor of cytokine signaling 7 [Source:MGI Symbol;Acc:MGI:2651588])

HSP 1 Score: 73.559 bits (179), Expect = 2.218e-13
Identity = 55/194 (28.35%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            L   GWYWGP+   +A  +L+ K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V                              G   T     V+LL+PVSR+SNV +SL +LCRF IRQ   +  +  L +   +++Y++   YY
Sbjct:  462 LEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRV-----------------------------PGLPPT----PVQLLYPVSRFSNV-KSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 621          
BLAST of Suppressor of cytokine signaling 6 vs. UniProt/SwissProt
Match: sp|Q5RCM6|SOCS6_PONAB (Suppressor of cytokine signaling 6 OS=Pongo abelii OX=9601 GN=SOCS6 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.441e-25
Identity = 74/192 (38.54%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFL--PD-EEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA  GWYWGP+TR EA  +L +  DG FLVRDS  D    +LSF+  G+  H RI   N +++F   PD E   SI  LI  ++R S   A+C+SRS                                 GS T    + VRL +PVSR+  V RSL YLCRF+IRQYT +  +  L +   +  YLQ+  Y
Sbjct:  379 LAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSR------------------------------LPGSAT----YPVRLTNPVSRFMQV-RSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 535          
BLAST of Suppressor of cytokine signaling 6 vs. UniProt/SwissProt
Match: sp|O14544|SOCS6_HUMAN (Suppressor of cytokine signaling 6 OS=Homo sapiens OX=9606 GN=SOCS6 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 1.468e-25
Identity = 74/192 (38.54%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFL--PD-EEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA  GWYWGP+TR EA  +L +  DG FLVRDS  D    +LSF+  G+  H RI   N +++F   PD E   SI  LI  ++R S   A+C+SRS                                 GS T    + VRL +PVSR+  V RSL YLCRF+IRQYT +  +  L +   +  YLQ+  Y
Sbjct:  379 LAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSR------------------------------LPGSAT----YPVRLTNPVSRFMQV-RSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 535          
BLAST of Suppressor of cytokine signaling 6 vs. UniProt/SwissProt
Match: sp|Q9JLY0|SOCS6_MOUSE (Suppressor of cytokine signaling 6 OS=Mus musculus OX=10090 GN=Socs6 PE=1 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 3.565e-25
Identity = 74/192 (38.54%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFL--PD-EEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA  GWYWGP+TR EA  +L +  DG FLVRDS  D    +LSF+  G+  H RI   N +++F   PD E   SI  LI  ++R S   A+C+SRS                                 GS T    + VRL +PVSR+  V RSL YLCRF+IRQYT +  +  L +   +  YLQ+  Y
Sbjct:  377 LAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSR------------------------------LPGSAT----YPVRLTNPVSRFMQV-RSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 533          
BLAST of Suppressor of cytokine signaling 6 vs. UniProt/SwissProt
Match: sp|O14512|SOCS7_HUMAN (Suppressor of cytokine signaling 7 OS=Homo sapiens OX=9606 GN=SOCS7 PE=1 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 7.521e-13
Identity = 55/194 (28.35%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            L   GWYWGP+   +A  +L+ K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V                              G   T     V+LL+PVSR+SNV +SL +LCRF IRQ   +  +  L +   +++Y++   YY
Sbjct:  395 LEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRV-----------------------------PGLPPT----PVQLLYPVSRFSNV-KSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 554          
BLAST of Suppressor of cytokine signaling 6 vs. UniProt/SwissProt
Match: sp|Q8VHQ2|SOCS7_MOUSE (Suppressor of cytokine signaling 7 OS=Mus musculus OX=10090 GN=Socs7 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 8.479e-13
Identity = 55/194 (28.35%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            L   GWYWGP+   +A  +L+ K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V                              G   T     V+LL+PVSR+SNV +SL +LCRF IRQ   +  +  L +   +++Y++   YY
Sbjct:  393 LEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRV-----------------------------PGLPPT----PVQLLYPVSRFSNV-KSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 552          
BLAST of Suppressor of cytokine signaling 6 vs. TrEMBL
Match: A0A0X3NP07 (Suppressor of cytokine signaling 6 OS=Schistocephalus solidus OX=70667 GN=SOCS6 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 6.376e-28
Identity = 76/181 (41.99%), Postives = 104/181 (57.46%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGA-GQIFHNRILRHNSKYAFLPDEEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQY--TGVYD----LDML 1110
            L++  W+WGPL+R EATQ L+    G F+VRDSE D+++FTL+F+ + G I +NRI    + YAFL  E F SI ALI +AM  S   AYC SR T       A  +  ET S    +S    + G   S   N   +VRLL P+SR+   P  L +LCRF I++Y  +G+ +    LD+L
Sbjct:   95 LSTQPWFWGPLSRIEATQLLQETSPGSFIVRDSEKDVSRFTLTFRCSNGSILNNRIAEQGNFYAFLEGEAFSSISALIENAMNFSKKGAYCLSRPT-----ASAKVSPGETKSVSPEDSETNENAGDGASELPNDSSKVRLLFPLSRHQLSP-PLQFLCRFAIQKYVRSGLLEPTRLLDIL 269          
BLAST of Suppressor of cytokine signaling 6 vs. TrEMBL
Match: A0A448WLP0 (SH2 domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS8277 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 6.857e-26
Identity = 84/227 (37.00%), Postives = 106/227 (46.70%), Query Frame = 1
Query:  550 MHVANTYPPRYGYLASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAG-QIFHNRILRHNSKYAFLPDEEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSN----------PVCSHGASG---------------------------------SGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYD 1098
            +H+    P  Y  L S  WYWGPL+R EAT  L  K  G FLVRDSE D ++FTL+F+GA  QIF+NRI   N KYAFL  E +DSI  LI  A+ +S    YC SR T+       +     T   L+AN +           + S  A G                                 S     ++EVRLL PVSR+S V  SL +LCRF  R    +Y+
Sbjct:   86 IHLETVAPHDYIELNSKPWYWGPLSRREATLILMDKPYGSFLVRDSERDSSRFTLTFRGADEQIFNNRISFENQKYAFLKGEAYDSISDLIDSAVLKSRDGPYCLSRLTEA--PISPSIEEENTQIGLDANQSRCITTKSGEKDILSTRAEGVTRIQLENSGEFPNGAKENEISNLETGDALNFESNKARSRNEVRLLFPVSRFSEV-HSLSFLCRFSFRHNLTLYN 309          
BLAST of Suppressor of cytokine signaling 6 vs. TrEMBL
Match: A0A087VYQ2 (Suppressor of cytokine signaling 6 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000121800 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 3.015e-25
Identity = 67/173 (38.73%), Postives = 98/173 (56.65%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQ-IFHNRILRHNSKYAFLPDEEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQY--TGVYD 1098
            L S  W+WGPLTR EA   L    DG F+VRDSE D ++FTL+F+ +G+ I +NRI +  +K+ F+  E F+SI AL+ +AM  S + AYC S +T             +T +     S+P        S   +   +VRLL+P SR+S VP  L +LCRF + ++  TG+ +
Sbjct:   74 LCSQPWFWGPLTRVEADALLHFAPDGSFIVRDSENDNSRFTLTFRFSGEVILNNRITQTGNKFGFIQGEAFESIQALLKNAMSHSESGAYCLSNAT------------FDTEA-----SDP--------SALVSESKKVRLLYPFSRFSIVP-PLLFLCRFALLRFIRTGIVE 220          
BLAST of Suppressor of cytokine signaling 6 vs. TrEMBL
Match: K9KF08 (Suppressor of cytokine signaling 6-like protein (Fragment) OS=Equus caballus OX=9796 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 3.669e-25
Identity = 75/192 (39.06%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFL--PD-EEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA  GWYWGP+TR EA  +L +  DG FLVRDS  D    +LSF+  G+  H RI   N +++F   PD E   SI  LI  ++R S   A+C+SRS                                 GS T    + VRL HPVSR+  V RSL YLCRF+IRQYT +  +  L +   +  YLQ+  Y
Sbjct:   54 LAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSR------------------------------LPGSAT----YPVRLTHPVSRFMQV-RSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 210          
BLAST of Suppressor of cytokine signaling 6 vs. TrEMBL
Match: A0A0P4VZI7 (Uncharacterized protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 7.872e-25
Identity = 71/192 (36.98%), Postives = 94/192 (48.96%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLP---DEEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA FGWYWGP+TRAEA ++L  + DG FLVRDS  D   F+LSF+   +  H RI   N  ++F P    E+  S+  LI   M  S +  +CFSR+                        +P                 VRL  PVSR++ V RSL YLCRF+IRQYT V  +  L +   +  YL++  Y
Sbjct:  301 LARFGWYWGPITRAEAEEKLVDQPDGAFLVRDSSDDKYLFSLSFRSYNKTLHTRIEHSNGWFSFYPHPEHEDHTSLVGLIDHCMSHSESGVFCFSRA--------------------RVPGSP--------------SFPVRLTKPVSRFTQV-RSLQYLCRFVIRQYTRVDHIQALPLPSRIKGYLEEGHY 457          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Cavefish
Match: socs6b (suppressor of cytokine signaling 6b [Source:ZFIN;Acc:ZDB-GENE-030131-1670])

HSP 1 Score: 112.464 bits (280), Expect = 1.901e-26
Identity = 83/241 (34.44%), Postives = 112/241 (46.47%), Query Frame = 1
Query:  460 GKHSKEIEEV------DESQNKDVQKSSQNHIRPQSMHVANTYPPRYGYLASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFL--PD-EEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            G HS+  E V      D S    VQ+   + ++     V  +       LA  GWYWGP+TR EA ++L +  DG FLVRDS  D    +LSF+  G+  H RI   N  ++F   PD E   SI  LI +++R S   A+C+SRS                                 GS T    + VRL +PVSR+  V RSL Y CRF+IRQYT +  +  L +   +  YLQ+  Y
Sbjct:  254 GTHSQVAESVIRHLSFDPSSAPGVQRV-YDAVQSSGPMVVTSLTVELKKLAKQGWYWGPITRWEAEEKLTNLPDGSFLVRDSSDDRYLLSLSFRSQGKTLHTRIEHSNGSFSFYEQPDIEGHTSIVDLIDNSIRDSENGAFCYSRSR------------------------------LPGSAT----YPVRLTNPVSRFMQV-RSLQYSCRFIIRQYTRIDLIQKLPLPNKMKDYLQEKHY 458          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Cavefish
Match: socs6a (suppressor of cytokine signaling 6a [Source:ZFIN;Acc:ZDB-GENE-080722-35])

HSP 1 Score: 109.768 bits (273), Expect = 1.785e-25
Identity = 72/192 (37.50%), Postives = 95/192 (49.48%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFL--PD-EEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA  GWYWGP+TR EA ++L    DG FLVRDS  D    +LSF+   +  H RI   N +++F   PD E   SI  LI  +++ S   A+C+SRS                                 GS T    + VRL +PVSR+  V RSL YLCRF+IRQYT +  +  L +   +  YLQ+  Y
Sbjct:  293 LAKQGWYWGPITRWEAEEKLLDLPDGSFLVRDSSDDRYLLSLSFRSQSKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIKDSENGAFCYSRSR------------------------------LPGSAT----YPVRLTNPVSRFMQV-RSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 449          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Cavefish
Match: socs7 (suppressor of cytokine signaling 7 [Source:ZFIN;Acc:ZDB-GENE-080204-125])

HSP 1 Score: 72.7886 bits (177), Expect = 3.861e-13
Identity = 54/190 (28.42%), Postives = 82/190 (43.16%), Query Frame = 1
Query:  601 GWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            GWYWGP+   +A  +L+ K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V                              G   T     V+LL+PVSR+ NV +SL +LCRF IRQ   +  +  L +   ++ YL+   YY
Sbjct:  436 GWYWGPMNWEDAELKLKGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRV-----------------------------PGLPPT----PVQLLYPVSRFCNV-KSLQHLCRFCIRQLVRIDHIQELPLPKPLIVYLRKFYYY 591          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Cavefish
Match: socs7 (suppressor of cytokine signaling 7 [Source:ZFIN;Acc:ZDB-GENE-080204-125])

HSP 1 Score: 72.7886 bits (177), Expect = 3.976e-13
Identity = 54/194 (27.84%), Postives = 82/194 (42.27%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            L   GWYWGP+   +A  +L+ K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V    P                                   V+LL+PVSR+ NV +SL +LCRF IRQ   +  +  L +   ++ YL+   YY
Sbjct:  456 LERCGWYWGPMNWEDAELKLKGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRVPGLPPT---------------------------------PVQLLYPVSRFCNV-KSLQHLCRFCIRQLVRIDHIQELPLPKPLIVYLRKFYYY 615          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Cavefish
Match: ENSAMXT00000044677.1 (suppressor of cytokine signaling 7-like [Source:NCBI gene;Acc:103036776])

HSP 1 Score: 72.4034 bits (176), Expect = 4.698e-13
Identity = 54/195 (27.69%), Postives = 84/195 (43.08%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYYL 1161
            L   GWYWGP+   +A  +L+ K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V    P                                   V+LL+PVSR+S+V +SL +LCRF IRQ   +  +  L +   ++ YL+  K+Y 
Sbjct:  516 LEKCGWYWGPMNWEDAEMKLKGKADGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGRFLYFLRSRVPGLPPT---------------------------------PVQLLYPVSRFSSV-KSLQHLCRFCIRQLVRIDHIQELPLPTPLIVYLR--KFYF 674          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Sea Lamprey
Match: socs6b (suppressor of cytokine signaling 6b [Source:ZFIN;Acc:ZDB-GENE-030131-1670])

HSP 1 Score: 102.834 bits (255), Expect = 1.136e-23
Identity = 68/192 (35.42%), Postives = 93/192 (48.44%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAF---LPDEEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA  GWYWGP+TR EA ++L   +DG FLVRDS  +    +LSF+   +  H RI   N +++F   L  E   S+  L+  ++R S   A+C+SRS                                 GS T    + VRL  PVSR+  V RSL YLCRF+IRQ T +  +  L +   +  YLQ+  Y
Sbjct:  374 LARQGWYWGPITRWEAEEKLHGLQDGSFLVRDSSDERYLLSLSFRSQNRTLHTRIEHSNGRFSFYEQLEAEGQASVVELVERSVRDSEVGAFCYSRSR------------------------------LPGSAT----YPVRLTVPVSRFMQV-RSLQYLCRFVIRQSTRIDLIRKLPLPSKMKDYLQEKPY 530          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Sea Lamprey
Match: pik3r1 (phosphoinositide-3-kinase, regulatory subunit 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-030131-1280])

HSP 1 Score: 62.003 bits (149), Expect = 1.587e-10
Identity = 35/105 (33.33%), Postives = 52/105 (49.52%), Query Frame = 1
Query:  532 HIRPQSMHVANTYPPRYG-------YLASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMN-KFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDSIPALIA 822
            H+RP S    +T+P   G        L    WYWG ++R E  ++LR+  DG +LVRD+   M   +TL+ +  G     +I   +SKY F     F+S+  LI 
Sbjct:   38 HLRPPSSPEPHTWPNSNGIKETSSTLLQDAEWYWGDISREEVNEKLRNTPDGTYLVRDASTKMQGDYTLTLRKGGNNKLIKIFHRDSKYGFSEPLTFNSVVELIT 142          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Sea Lamprey
Match: grb2a (growth factor receptor-bound protein 2a [Source:ZFIN;Acc:ZDB-GENE-041121-1])

HSP 1 Score: 47.7506 bits (112), Expect = 1.858e-6
Identity = 27/73 (36.99%), Postives = 41/73 (56.16%), Query Frame = 1
Query:  604 WYWGPLTRAEATQRL-RHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDSIPALI 819
            W+ G + R +A + L R K DG FLVR+SE     F+LS K    + H ++LR  +   FL   +F+S+  L+
Sbjct:   60 WFTGKIPRVKAEEMLNRQKFDGAFLVRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELV 132          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Sea Lamprey
Match: crkl (v-crk avian sarcoma virus CT10 oncogene homolog-like [Source:ZFIN;Acc:ZDB-GENE-040426-2951])

HSP 1 Score: 47.7506 bits (112), Expect = 2.884e-6
Identity = 25/72 (34.72%), Postives = 41/72 (56.94%), Query Frame = 1
Query:  604 WYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDSIPALI 819
            WY+GPL+R E  +RL+ +  G F+VRDS      + LS     ++ H  I+ + +    + D+EF  +PAL+
Sbjct:   14 WYFGPLSRVETQRRLQGQRHGTFVVRDSTTCPGDYVLSVSENSKVSH-YIVNNLADRFKIGDQEFRDLPALL 84          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Nematostella
Match: EDO37051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGW3])

HSP 1 Score: 100.908 bits (250), Expect = 5.221e-25
Identity = 62/175 (35.43%), Postives = 85/175 (48.57%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEF-DSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDML 1110
            L++ GWYWGP++  EA + L ++ DGCFLVRDSE D +  ++SF+  G   H R++ +  K++F  DE   DS   LI  AM  S     C SR                       N N +C             + VRL  P+SR++ VP  L +LCRF+IRQ      LD L
Sbjct:   24 LSNCGWYWGPMSSKEAEKELYNQPDGCFLVRDSENDYHLLSVSFRSKGATCHTRLIYNKGKFSFFQDEMGKDSAYELIMHAMEASQDGILCNSRG---------------------HNRNTIC-------------YPVRLQVPISRFNTVP-PLQFLCRFVIRQNIRCDQLDQL 163          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Nematostella
Match: EDO48108 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK55])

HSP 1 Score: 55.8398 bits (133), Expect = 7.664e-9
Identity = 26/73 (35.62%), Postives = 39/73 (53.42%), Query Frame = 1
Query:  604 WYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDSIPALIA 822
            WYWG  ++     R+R  EDG F+VRDS+    ++TL+    G I   RI+  + KY F     F S+  L++
Sbjct:    6 WYWGEASKEAVNARMRDTEDGTFIVRDSKRFPGEYTLTLMKGGVIKLIRIMYKDGKYGFSEPLTFKSVIDLVS 78          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Nematostella
Match: EDO29286 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T428])

HSP 1 Score: 48.521 bits (114), Expect = 6.662e-7
Identity = 23/59 (38.98%), Postives = 34/59 (57.63%), Query Frame = 1
Query:  604 WYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAF 780
            WYWG + R EA + L    DG FL+RDS      F++SF+   + +H RI +   +Y+F
Sbjct:   16 WYWGKINRFEAERVLDGLPDGTFLLRDSAQYQYLFSVSFRRYFRTYHARIEQWKHRYSF 74          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Nematostella
Match: EDO35739 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKN8])

HSP 1 Score: 48.521 bits (114), Expect = 6.669e-7
Identity = 23/59 (38.98%), Postives = 34/59 (57.63%), Query Frame = 1
Query:  604 WYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAF 780
            WYWG + R EA + L    DG FL+RDS      F++SF+   + +H RI +   +Y+F
Sbjct:   16 WYWGKINRFEAERVLDGLPDGTFLLRDSAQYQYLFSVSFRRYFRTYHARIEQWKHRYSF 74          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Medaka
Match: socs6 (suppressor of cytokine signaling 6 [Source:NCBI gene;Acc:100144377])

HSP 1 Score: 110.923 bits (276), Expect = 1.310e-25
Identity = 72/192 (37.50%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFL--PD-EEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKY 1155
            LA  GWYWGP+TR EA ++L +  DG FLVRDS  D    +LSF+   +  H RI   N +++F   PD E   SI  LI  +++ S   A+C+SRS                                 GS T    + VRL +PVSR+  V RSL YLCRF+IRQYT +  +  L +   +  YLQ+  Y
Sbjct:  380 LARQGWYWGPITRWEAEEKLFNLADGSFLVRDSSDDRYLLSLSFRSQSKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIKDSENGAFCYSRSR------------------------------LPGSAT----YPVRLTNPVSRFMQV-RSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 536          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Medaka
Match: ENSORLT00000028429.1 (suppressor of cytokine signaling 7 [Source:NCBI gene;Acc:100144378])

HSP 1 Score: 74.7146 bits (182), Expect = 7.379e-14
Identity = 56/194 (28.87%), Postives = 84/194 (43.30%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            L   GWYWGP+   +A  +L+ K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V                              G   T     V+LL+PVSR+SNV +SL +LCRF IRQ   +  +  L +   +++YL    YY
Sbjct:  349 LEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRV-----------------------------PGLPPT----PVQLLYPVSRFSNV-KSLQHLCRFCIRQIVRIDHIQELPLPRPLISYLSKFYYY 508          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Medaka
Match: ENSORLT00000043526.1 (suppressor of cytokine signaling 7 [Source:NCBI gene;Acc:100144378])

HSP 1 Score: 74.7146 bits (182), Expect = 9.880e-14
Identity = 55/194 (28.35%), Postives = 83/194 (42.78%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFD----SIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYY 1158
            L   GWYWGP+   +A  +L+ K DG FLVRDS       +LSF+  G   H R+  +   ++     +F+    S+   I  A+  S    + +   + V    P                                   V+LL+PVSR+SNV +SL +LCRF IRQ   +  +  L +   +++YL    YY
Sbjct:  620 LEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRVPGLPPT---------------------------------PVQLLYPVSRFSNV-KSLQHLCRFCIRQIVRIDHIQELPLPRPLISYLSKFYYY 779          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Medaka
Match: pik3r1 (phosphoinositide-3-kinase regulatory subunit 1 [Source:NCBI gene;Acc:101171597])

HSP 1 Score: 56.225 bits (134), Expect = 3.947e-8
Identity = 28/78 (35.90%), Postives = 39/78 (50.00%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDM-NKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDSIPALI 819
            L    WYWG ++R E  ++LR   DG FLVRD+   M   +TL+ +  G     +I   + KY F     F S+  LI
Sbjct:   38 LQDAEWYWGEISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELI 115          
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Medaka
Match: pik3r3b (phosphoinositide-3-kinase regulatory subunit 3 [Source:NCBI gene;Acc:101170665])

HSP 1 Score: 56.225 bits (134), Expect = 3.983e-8
Identity = 29/81 (35.80%), Postives = 41/81 (50.62%), Query Frame = 1
Query:  583 GYLASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDM-NKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDSIPALIA 822
            G L    WYWG ++R E   +LR   DG FLVRD+   M   +TL+ +  G     +I   + KY F     F+S+  LI+
Sbjct:   55 GALQEAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSEPLTFNSVVDLIS 135          
BLAST of Suppressor of cytokine signaling 6 vs. Planmine SMEST
Match: SMESG000068510.1 (SMESG000068510.1)

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 348/348 (100.00%), Postives = 348/348 (100.00%), Query Frame = 1
Query:  118 MEDTNVLPSPTEQENMXXXXXXXXXXXXXFNVITSKSVEENHKKHKTSFFNQIRKRFSMVKKSKSKENNEILDPLEKNCNSDKSHQQNNTEKPNTNESLKSEKRFSAIRRSIGKGKHSKEIEEVDESQNKDVQKSSQNHIRPQSMHVANTYPPRYGYLASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYYL 1161
            MEDTNVLPSPTEQENMNPSDSPKSSSKNSFNVITSKSVEENHKKHKTSFFNQIRKRFSMVKKSKSKENNEILDPLEKNCNSDKSHQQNNTEKPNTNESLKSEKRFSAIRRSIGKGKHSKEIEEVDESQNKDVQKSSQNHIRPQSMHVANTYPPRYGYLASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDSIPALIADAMRRSATSAYCFSRSTDVAPANPATNNNNETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYYL
Sbjct:    1 MEDTNVLPSPTEQENMNPSDSPKSSSKNSFNVITSKSVEENHKKHKTSFFNQIRKRFSMVKKSKSKENNEILDPLEKNCNSDKSHQQNNTEKPNTNESLKSEKRFSAIRRSIGKGKHSKEIEEVDESQNKDVQKSSQNHIRPQSMHVANTYPPRYGYLASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDSIPALIADAMRRSATSAYCFSRSTDVAPANPATNNNNETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYYL 348          
BLAST of Suppressor of cytokine signaling 6 vs. Planmine SMEST
Match: SMESG000016754.1 (SMESG000016754.1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.498e-15
Identity = 53/191 (27.75%), Postives = 87/191 (45.55%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDSIPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYYL 1161
            L    WYWGPLT+ +A   L++KEDG FLVRDS  +    ++SF+   +I+H RI     K++F  ++      A I D + +    +                      H +   N + +    A     +     V LL+P+SR+  V +SL +LCRF I        ++ L +   +  YL+ P+Y++
Sbjct:  200 LRRIPWYWGPLTKYDAELLLQNKEDGVFLVRDSGHEAYVLSVSFRAGNKIYHTRIEHSLGKFSFWLNDRNAVKAASIVDFINQLIEES-------------------RNGHVRYLINDSSLIGQLAETGRVS-----VSLLYPLSRFKIV-QSLMHLCRFEILALIRQDHINNLQIPNFLKRYLKAPQYFI 365          
BLAST of Suppressor of cytokine signaling 6 vs. Planmine SMEST
Match: SMESG000034034.1 (SMESG000034034.1)

HSP 1 Score: 75.485 bits (184), Expect = 5.119e-14
Identity = 55/194 (28.35%), Postives = 81/194 (41.75%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDS---IPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYYL 1161
            L + GWYWGPL   EA   + ++ DG FLVRDS  D    +L+F+  G  +H RI     K++F    E  S   I   I  A+  SA+  + +   T                                 S       EV LL+P+SRY  + +SL +L RF+I        +  L +   +  YL + +YY+
Sbjct:  930 LRNLGWYWGPLNHLEAENLVENRPDGTFLVRDSAHDTYFLSLTFRVLGTTYHTRIEYSQGKFSFWSQPESHSATTIVEFIDKAVAHSASGKFHYFLQT---------------------------------STPGQPPMEVSLLYPLSRYQ-IIQSLQHLSRFVILSNIRKDHVSQLQLPSSLKGYLLEKQYYI 1089          
BLAST of Suppressor of cytokine signaling 6 vs. Planmine SMEST
Match: SMESG000034034.1 (SMESG000034034.1)

HSP 1 Score: 75.485 bits (184), Expect = 5.220e-14
Identity = 56/194 (28.87%), Postives = 82/194 (42.27%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDS---IPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYYL 1161
            L + GWYWGPL   EA   + ++ DG FLVRDS  D    +L+F+  G  +H RI     K++F    E  S   I   I  A+  SA+  +                     H  L+             S       EV LL+P+SRY  + +SL +L RF+I        +  L +   +  YL + +YY+
Sbjct:  967 LRNLGWYWGPLNHLEAENLVENRPDGTFLVRDSAHDTYFLSLTFRVLGTTYHTRIEYSQGKFSFWSQPESHSATTIVEFIDKAVAHSASGKF---------------------HYFLQT------------STPGQPPMEVSLLYPLSRYQ-IIQSLQHLSRFVILSNIRKDHVSQLQLPSSLKGYLLEKQYYI 1126          
BLAST of Suppressor of cytokine signaling 6 vs. Planmine SMEST
Match: SMESG000041674.1 (SMESG000041674.1)

HSP 1 Score: 65.855 bits (159), Expect = 4.320e-11
Identity = 51/194 (26.29%), Postives = 81/194 (41.75%), Query Frame = 1
Query:  589 LASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLSFKGAGQIFHNRILRHNSKYAFLPDEEFDS---IPALIADAMRRSATSAYCFSRSTDVXXXXXXXXXXXETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHPVSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYYL 1161
            L   GWYWGPL+  EA + + +K +G FLVRDS  D    +L+F+     +H RI      ++F    E  S   I   I  A+  S +  + +   T+V                      P+               EV LL+P++R + +  SL +L RF+I        +  L +   +  YL + +YY+
Sbjct:  873 LKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQP------------------PM---------------EVSLLYPLTR-NQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYYI 1032          
The following BLAST results are available for this feature:
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SOCS63.057e-2638.54suppressor of cytokine signaling 6 [Source:HGNC Sy... [more]
SOCS63.057e-2638.54suppressor of cytokine signaling 6 [Source:HGNC Sy... [more]
SOCS71.030e-1328.35suppressor of cytokine signaling 7 [Source:HGNC Sy... [more]
SOCS71.258e-1328.35suppressor of cytokine signaling 7 [Source:HGNC Sy... [more]
SOCS71.566e-1328.35suppressor of cytokine signaling 7 [Source:HGNC Sy... [more]
back to top
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
abl-18.350e-730.34Tyrosine-protein kinase abl-1 [Source:UniProtKB/S... [more]
abl-19.186e-730.34Tyrosine-protein kinase abl-1 [Source:UniProtKB/S... [more]
abl-19.604e-730.34Tyrosine-protein kinase abl-1 [Source:UniProtKB/S... [more]
back to top
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Socs16D6.324e-1230.98gene:FBgn0030869 transcript:FBtr0074473[more]
Socs16D6.446e-1230.98gene:FBgn0030869 transcript:FBtr0310310[more]
Socs44A1.256e-1128.49gene:FBgn0033266 transcript:FBtr0088784[more]
hwt3.142e-838.67gene:FBgn0264542 transcript:FBtr0346131[more]
hwt3.678e-838.67gene:FBgn0264542 transcript:FBtr0333156[more]
back to top
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
socs6a2.450e-2638.02suppressor of cytokine signaling 6a [Source:ZFIN;A... [more]
socs6b3.654e-2537.50suppressor of cytokine signaling 6b [Source:ZFIN;A... [more]
socs76.312e-1529.23suppressor of cytokine signaling 7 [Source:ZFIN;Ac... [more]
socs79.073e-1529.47suppressor of cytokine signaling 7 [Source:ZFIN;Ac... [more]
socs79.073e-1529.47suppressor of cytokine signaling 7 [Source:ZFIN;Ac... [more]
back to top
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmbim63.823e-2638.02transmembrane BAX inhibitor motif containing 6 [So... [more]
cdc42se14.868e-1428.87cdc42 small effector 1 [Source:Xenbase;Acc:XB-GENE... [more]
cdc42se15.604e-1428.87cdc42 small effector 1 [Source:Xenbase;Acc:XB-GENE... [more]
cdc42se11.006e-1328.87cdc42 small effector 1 [Source:Xenbase;Acc:XB-GENE... [more]
PIK3R17.308e-933.68phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
back to top
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Socs65.096e-2638.54suppressor of cytokine signaling 6 [Source:MGI Sym... [more]
Socs65.096e-2638.54suppressor of cytokine signaling 6 [Source:MGI Sym... [more]
Socs65.096e-2638.54suppressor of cytokine signaling 6 [Source:MGI Sym... [more]
Socs71.212e-1328.35suppressor of cytokine signaling 7 [Source:MGI Sym... [more]
Socs72.218e-1328.35suppressor of cytokine signaling 7 [Source:MGI Sym... [more]
back to top
BLAST of Suppressor of cytokine signaling 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RCM6|SOCS6_PONAB1.441e-2538.54Suppressor of cytokine signaling 6 OS=Pongo abelii... [more]
sp|O14544|SOCS6_HUMAN1.468e-2538.54Suppressor of cytokine signaling 6 OS=Homo sapiens... [more]
sp|Q9JLY0|SOCS6_MOUSE3.565e-2538.54Suppressor of cytokine signaling 6 OS=Mus musculus... [more]
sp|O14512|SOCS7_HUMAN7.521e-1328.35Suppressor of cytokine signaling 7 OS=Homo sapiens... [more]
sp|Q8VHQ2|SOCS7_MOUSE8.479e-1328.35Suppressor of cytokine signaling 7 OS=Mus musculus... [more]
back to top
BLAST of Suppressor of cytokine signaling 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NP076.376e-2841.99Suppressor of cytokine signaling 6 OS=Schistocepha... [more]
A0A448WLP06.857e-2637.00SH2 domain-containing protein OS=Protopolystoma xe... [more]
A0A087VYQ23.015e-2538.73Suppressor of cytokine signaling 6 OS=Echinococcus... [more]
K9KF083.669e-2539.06Suppressor of cytokine signaling 6-like protein (F... [more]
A0A0P4VZI77.872e-2536.98Uncharacterized protein OS=Scylla olivacea OX=8555... [more]
back to top
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
socs6b1.901e-2634.44suppressor of cytokine signaling 6b [Source:ZFIN;A... [more]
socs6a1.785e-2537.50suppressor of cytokine signaling 6a [Source:ZFIN;A... [more]
socs73.861e-1328.42suppressor of cytokine signaling 7 [Source:ZFIN;Ac... [more]
socs73.976e-1327.84suppressor of cytokine signaling 7 [Source:ZFIN;Ac... [more]
ENSAMXT00000044677.14.698e-1327.69suppressor of cytokine signaling 7-like [Source:NC... [more]
back to top
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
socs6b1.136e-2335.42suppressor of cytokine signaling 6b [Source:ZFIN;A... [more]
pik3r11.587e-1033.33phosphoinositide-3-kinase, regulatory subunit 1 (a... [more]
grb2a1.858e-636.99growth factor receptor-bound protein 2a [Source:ZF... [more]
crkl2.884e-634.72v-crk avian sarcoma virus CT10 oncogene homolog-li... [more]
back to top
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO370515.221e-2535.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481087.664e-935.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292866.662e-738.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357396.669e-738.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Suppressor of cytokine signaling 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
socs61.310e-2537.50suppressor of cytokine signaling 6 [Source:NCBI ge... [more]
ENSORLT00000028429.17.379e-1428.87suppressor of cytokine signaling 7 [Source:NCBI ge... [more]
ENSORLT00000043526.19.880e-1428.35suppressor of cytokine signaling 7 [Source:NCBI ge... [more]
pik3r13.947e-835.90phosphoinositide-3-kinase regulatory subunit 1 [So... [more]
pik3r3b3.983e-835.80phosphoinositide-3-kinase regulatory subunit 3 [So... [more]
back to top
BLAST of Suppressor of cytokine signaling 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068510.10.000e+0100.00SMESG000068510.1[more]
SMESG000016754.12.498e-1527.75SMESG000016754.1[more]
SMESG000034034.15.119e-1428.35SMESG000034034.1[more]
SMESG000034034.15.220e-1428.87SMESG000034034.1[more]
SMESG000041674.14.320e-1126.29SMESG000041674.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026576 ID=SMED30026576|Name=Suppressor of cytokine signaling 6|organism=Schmidtea mediterranea sexual|type=transcript|length=1515bp
TGTTATTAATGCAAATGTTAATAATATGATAAACATTTTATTTTAATATC
GTATTTTATTAAGTAGATAAGAAAATTAAATTGTATTTAGCTAAACTATA
ACTTTCAATAATTTCCAATGGAAGACACTAATGTGTTACCATCACCAACA
GAACAAGAGAATATGAATCCAAGTGATAGTCCTAAATCTTCAAGTAAAAA
TAGTTTCAATGTGATAACTTCAAAATCTGTCGAAGAAAATCATAAAAAAC
ACAAAACTTCGTTCTTTAATCAAATACGAAAACGGTTCTCAATGGTGAAG
AAATCTAAATCTAAAGAAAACAATGAAATCTTAGATCCTCTGGAAAAAAA
TTGCAACTCAGATAAATCTCATCAGCAAAATAACACAGAAAAACCTAATA
CCAATGAATCATTAAAATCTGAAAAGCGATTTTCTGCTATACGTAGGAGT
ATCGGTAAAGGAAAACATTCTAAAGAAATTGAAGAAGTGGATGAATCACA
AAATAAAGACGTACAAAAAAGTTCTCAAAATCACATCAGACCACAATCTA
TGCATGTTGCTAATACATATCCTCCTCGGTACGGTTATTTAGCATCGTTT
GGATGGTATTGGGGTCCTCTAACGAGAGCTGAAGCTACACAGCGATTACG
CCATAAAGAAGATGGATGTTTCTTAGTTCGAGATAGTGAAGGGGACATGA
ACAAATTCACTCTCAGTTTTAAAGGAGCTGGTCAAATATTTCACAATCGT
ATTTTGAGACATAATTCAAAATATGCTTTTCTTCCTGATGAGGAATTTGA
TTCCATTCCGGCACTGATTGCAGACGCAATGCGTCGATCTGCTACTAGTG
CTTATTGCTTTTCTCGGTCAACTGATGTCGCTCCTGCTAATCCAGCAACC
AATAACAATAATGAAACCCATAGTCAATTGGAAGCCAATTCCAATCCGGT
TTGTTCTCACGGCGCTAGTGGCAGCGGTACCACCAATCATAAACATGAAG
TTCGCCTGCTTCATCCAGTATCCAGATACTCTAATGTTCCTCGATCTCTT
TACTACTTGTGTCGATTTATGATTCGACAATACACGGGCGTTTATGATTT
AGACATGTTAGGAGTAACTGGAGATGTGTTAACTTATTTACAGGACCCCA
AATACTATCTGTAGCTTAATTAATTAATTAATTAGGTTTTCTATTTTTAG
CGAAGTCATTTAAAAAGTGAGTGACTTAGACTTATTTTTGTCATCGTTTC
AATGTCATATCGGATTCGACTTGTTTGTCTGTTTTTATATTTCGATAATA
TTTGTAATTTTAATTGCGTTTCTCTAGTTTATAATTATTACTTTTCACAC
TATTTTGTATCATATATAATCATATGTTTCTTTATTTTCCTAGTAGTAAT
TTACTAGACGAAAATGTGACCAATAAAGTCGTTGTTGGTTCTGTCGGTCA
ATTATTTATTATATTGCCATTGATAAATTTGCTTTCTTCATATTTACTAT
TATTATTATTATTAT
back to top

protein sequence of SMED30026576-orf-1

>SMED30026576-orf-1 ID=SMED30026576-orf-1|Name=SMED30026576-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=349bp
MEDTNVLPSPTEQENMNPSDSPKSSSKNSFNVITSKSVEENHKKHKTSFF
NQIRKRFSMVKKSKSKENNEILDPLEKNCNSDKSHQQNNTEKPNTNESLK
SEKRFSAIRRSIGKGKHSKEIEEVDESQNKDVQKSSQNHIRPQSMHVANT
YPPRYGYLASFGWYWGPLTRAEATQRLRHKEDGCFLVRDSEGDMNKFTLS
FKGAGQIFHNRILRHNSKYAFLPDEEFDSIPALIADAMRRSATSAYCFSR
STDVAPANPATNNNNETHSQLEANSNPVCSHGASGSGTTNHKHEVRLLHP
VSRYSNVPRSLYYLCRFMIRQYTGVYDLDMLGVTGDVLTYLQDPKYYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005942phosphatidylinositol 3-kinase complex
GO:0001772immunological synapse
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0043551regulation of phosphatidylinositol 3-kinase activity
GO:0046854phosphatidylinositol phosphorylation
GO:0035556intracellular signal transduction
GO:0009968negative regulation of signal transduction
GO:0010498proteasomal protein catabolic process
GO:0016567protein ubiquitination
GO:0040008regulation of growth
GO:0050868negative regulation of T cell activation
Vocabulary: molecular function
TermDefinition
GO:00469351-phosphatidylinositol-3-kinase regulator activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036036SOCS_box-like_dom_sf
IPR036860SH2_dom_sf
IPR000980SH2
IPR001496SOCS_box
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000980SH2 domainSMARTSM00252SH2_5coord: 161..243
e-value: 1.0E-20
score: 84.9
IPR000980SH2 domainPFAMPF00017SH2coord: 163..235
e-value: 8.3E-17
score: 61.1
IPR000980SH2 domainPROSITEPS50001SH2coord: 163..234
score: 15.447
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..141
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 96..132
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 81..95
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 62..80
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..36
NoneNo IPR availablePANTHERPTHR10155:SF12LP02169P-RELATEDcoord: 20..347
NoneNo IPR availablePANTHERPTHR10155PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY SUBUNITcoord: 20..347
IPR001496SOCS box domainPROSITEPS50225SOCScoord: 296..347
score: 8.787
IPR036036SOCS box-like domain superfamilySUPERFAMILYSSF158235SOCS box-likecoord: 309..347
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 143..239