Small ArfGAP 1

Overview
NameSmall ArfGAP 1
Smed IDSMED30026569
Length (bp)1311
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Small ArfGAP 1 (SMED30026569) t-SNE clustered cells

Violin plots show distribution of expression levels for Small ArfGAP 1 (SMED30026569) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Small ArfGAP 1 (SMED30026569) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Small ArfGAP 1 (SMED30026569) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026569

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30026569h1SMcG0005992 Contig3931GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026569h1SMcG0016019 Contig3931GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
posterior sideSMED30026569h1SMcG0016019 dd_Smed_v4_4517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30026569h1SMcG0016019 dd_Smed_v4_4517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Small ArfGAP 1 vs. Ensembl Human
Match: SMAP1 (small ArfGAP 1 [Source:HGNC Symbol;Acc:HGNC:19651])

HSP 1 Score: 164.081 bits (414), Expect = 5.850e-45
Identity = 71/109 (65.14%), Postives = 87/109 (79.82%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIR 444
            K+N+ H LIL K++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K+  +YEA LP NF RPQT+ A+E FIR
Sbjct:   12 KLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR 120          
BLAST of Small ArfGAP 1 vs. Ensembl Human
Match: SMAP1 (small ArfGAP 1 [Source:HGNC Symbol;Acc:HGNC:19651])

HSP 1 Score: 163.31 bits (412), Expect = 6.063e-45
Identity = 71/109 (65.14%), Postives = 87/109 (79.82%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIR 444
            K+N+ H LIL K++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K+  +YEA LP NF RPQT+ A+E FIR
Sbjct:   12 KLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR 120          
BLAST of Small ArfGAP 1 vs. Ensembl Human
Match: SMAP2 (small ArfGAP2 [Source:HGNC Symbol;Acc:HGNC:25082])

HSP 1 Score: 162.155 bits (409), Expect = 1.456e-44
Identity = 67/115 (58.26%), Postives = 89/115 (77.39%), Query Frame = 1
Query:  124 INKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            +++   +L  ++ +E NK CADC ++G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K++ +YEA LP  F RPQ + A+E FIR KY+ K+Y
Sbjct:    9 VDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKY 123          
BLAST of Small ArfGAP 1 vs. Ensembl Human
Match: SMAP1 (small ArfGAP 1 [Source:HGNC Symbol;Acc:HGNC:19651])

HSP 1 Score: 162.155 bits (409), Expect = 1.706e-44
Identity = 71/109 (65.14%), Postives = 87/109 (79.82%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIR 444
            K+N+ H LIL K++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K+  +YEA LP NF RPQT+ A+E FIR
Sbjct:   12 KLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR 120          
BLAST of Small ArfGAP 1 vs. Ensembl Human
Match: SMAP2 (small ArfGAP2 [Source:HGNC Symbol;Acc:HGNC:25082])

HSP 1 Score: 138.658 bits (348), Expect = 1.612e-38
Identity = 59/89 (66.29%), Postives = 72/89 (80.90%), Query Frame = 1
Query:  202 GTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K++ +YEA LP  F RPQ + A+E FIR KY+ K+Y
Sbjct:   19 GPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKY 107          
BLAST of Small ArfGAP 1 vs. Ensembl Celegans
Match: W09D10.1 (pep chromosome:WBcel235:III:10736919:10739786:-1 gene:WBGene00012359.1 transcript:W09D10.1.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W09D10.1)

HSP 1 Score: 163.696 bits (413), Expect = 4.858e-45
Identity = 66/111 (59.46%), Postives = 86/111 (77.48%), Query Frame = 1
Query:  142 ILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRYCI 474
             LL ++++E NK CADC  +  RWA+WN G+F+CIRCAGIHRNLGVHISKV+SV+LDSWT EQ+Q M +MGN K+ ++YE  LP  F RP  +  +E+FIRSKY+ KRY +
Sbjct:   19 FLLDMLKEEENKYCADCQAKTPRWAAWNLGVFICIRCAGIHRNLGVHISKVRSVNLDSWTPEQVQTMRVMGNEKARQVYEHDLPAQFRRPTNDQQMEQFIRSKYEQKRYIL 129          
BLAST of Small ArfGAP 1 vs. Ensembl Celegans
Match: W09D10.1 (pep chromosome:WBcel235:III:10736919:10739792:-1 gene:WBGene00012359.1 transcript:W09D10.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W09D10.1)

HSP 1 Score: 163.696 bits (413), Expect = 4.858e-45
Identity = 66/111 (59.46%), Postives = 86/111 (77.48%), Query Frame = 1
Query:  142 ILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRYCI 474
             LL ++++E NK CADC  +  RWA+WN G+F+CIRCAGIHRNLGVHISKV+SV+LDSWT EQ+Q M +MGN K+ ++YE  LP  F RP  +  +E+FIRSKY+ KRY +
Sbjct:   19 FLLDMLKEEENKYCADCQAKTPRWAAWNLGVFICIRCAGIHRNLGVHISKVRSVNLDSWTPEQVQTMRVMGNEKARQVYEHDLPAQFRRPTNDQQMEQFIRSKYEQKRYIL 129          
BLAST of Small ArfGAP 1 vs. Ensembl Celegans
Match: W09D10.1 (pep chromosome:WBcel235:III:10736893:10739824:-1 gene:WBGene00012359.1 transcript:W09D10.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W09D10.1)

HSP 1 Score: 163.696 bits (413), Expect = 4.858e-45
Identity = 66/111 (59.46%), Postives = 86/111 (77.48%), Query Frame = 1
Query:  142 ILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRYCI 474
             LL ++++E NK CADC  +  RWA+WN G+F+CIRCAGIHRNLGVHISKV+SV+LDSWT EQ+Q M +MGN K+ ++YE  LP  F RP  +  +E+FIRSKY+ KRY +
Sbjct:   19 FLLDMLKEEENKYCADCQAKTPRWAAWNLGVFICIRCAGIHRNLGVHISKVRSVNLDSWTPEQVQTMRVMGNEKARQVYEHDLPAQFRRPTNDQQMEQFIRSKYEQKRYIL 129          
BLAST of Small ArfGAP 1 vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 105.531 bits (262), Expect = 4.474e-24
Identity = 52/116 (44.83%), Postives = 68/116 (58.62%), Query Frame = 1
Query:  169 GNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEE---FIRSKYQYKRYCISPPKSDSSPTT 507
            GN  CADCG   + WAS N GI +CI C+GIHRNLG HISKV+ ++LD W  E L VM+ +GN K++E++E  L     +P    + EE   FI  KY  K +    P +   P T
Sbjct:  392 GNGRCADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELDQWPVEHLAVMQAIGNDKANEMWEFGLLNGERKPTPESSREEKERFIDRKYVQKAFL--KPIASGEPVT 505          
BLAST of Small ArfGAP 1 vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 105.145 bits (261), Expect = 6.794e-24
Identity = 55/130 (42.31%), Postives = 74/130 (56.92%), Query Frame = 1
Query:  127 NKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEE---FIRSKYQYKRYCISPPKSDSSPTT 507
            N+  +  L+ I   GN  CADCG   + WAS N GI +CI C+GIHRNLG HISKV+ ++LD W  E L VM+ +GN K++E++E  L     +P    + EE   FI  KY  K +    P +   P T
Sbjct:  456 NRPDIAALRSIP--GNGRCADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELDQWPVEHLAVMQAIGNDKANEMWEFGLLNGERKPTPESSREEKERFIDRKYVQKAFL--KPIASGEPVT 581          
BLAST of Small ArfGAP 1 vs. Ensembl Fly
Match: CG8243 (gene:FBgn0033349 transcript:FBtr0088652)

HSP 1 Score: 164.851 bits (416), Expect = 2.911e-45
Identity = 71/127 (55.91%), Postives = 92/127 (72.44%), Query Frame = 1
Query:  130 KSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRYCI------SPPKSD 492
            K   +L +++  E NK C DC  +G RWASWN G+FLCIRCAGIHRNLGVHIS+VKSV+LD+WT EQ+  ++ MGN ++  +YEA LP  F RPQT+ A+E FIR+KY++K+Y        SPPK D
Sbjct:   16 KCQTLLTQMLRDEDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVISLQQMGNSRARAVYEAQLPDGFRRPQTDTALENFIRAKYEHKKYLAREWVPPSPPKVD 142          
BLAST of Small ArfGAP 1 vs. Ensembl Fly
Match: CenB1A (gene:FBgn0039056 transcript:FBtr0084369)

HSP 1 Score: 100.908 bits (250), Expect = 1.457e-22
Identity = 56/144 (38.89%), Postives = 76/144 (52.78%), Query Frame = 1
Query:  169 GNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGN--FTRPQTNYAI---EEFIRSKYQYKRYCISPPKS--------------DSSPTTEDNDKCKSNIAK 543
            GN  C DC +   RWAS N GI LCI C+G+HR+LGVH SKV+S+ LD+W  E ++VM  +GN   + IYEA +  +    +P     I   E +I++KY  +R+    PK               DS    ED +   S IAK
Sbjct:  162 GNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFVCGMPKPQELLASETAEVLSIDSGGVVEDGESGGSGIAK 305          
BLAST of Small ArfGAP 1 vs. Ensembl Fly
Match: CenB1A (gene:FBgn0039056 transcript:FBtr0084368)

HSP 1 Score: 100.908 bits (250), Expect = 1.779e-22
Identity = 56/144 (38.89%), Postives = 76/144 (52.78%), Query Frame = 1
Query:  169 GNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGN--FTRPQTNYAI---EEFIRSKYQYKRYCISPPKS--------------DSSPTTEDNDKCKSNIAK 543
            GN  C DC +   RWAS N GI LCI C+G+HR+LGVH SKV+S+ LD+W  E ++VM  +GN   + IYEA +  +    +P     I   E +I++KY  +R+    PK               DS    ED +   S IAK
Sbjct:  392 GNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFVCGMPKPQELLASETAEVLSIDSGGVVEDGESGGSGIAK 535          
BLAST of Small ArfGAP 1 vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080548)

HSP 1 Score: 94.3597 bits (233), Expect = 2.604e-20
Identity = 42/103 (40.78%), Postives = 62/103 (60.19%), Query Frame = 1
Query:  169 GNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEE---FIRSKYQYKRY 468
            GN  C DCG     WAS N G+ +CI C+G+HRNLG HISKV+S+ LD W    L VM  +GN  ++ ++E+       +P +  + E+   ++RSKY+ K +
Sbjct:  481 GNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNT-RQRVKPTSQASREDKERWVRSKYEAKEF 582          
BLAST of Small ArfGAP 1 vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080546)

HSP 1 Score: 93.9745 bits (232), Expect = 3.772e-20
Identity = 42/103 (40.78%), Postives = 62/103 (60.19%), Query Frame = 1
Query:  169 GNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEE---FIRSKYQYKRY 468
            GN  C DCG     WAS N G+ +CI C+G+HRNLG HISKV+S+ LD W    L VM  +GN  ++ ++E+       +P +  + E+   ++RSKY+ K +
Sbjct:  713 GNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNT-RQRVKPTSQASREDKERWVRSKYEAKEF 814          
BLAST of Small ArfGAP 1 vs. Ensembl Zebrafish
Match: smap1 (small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2])

HSP 1 Score: 168.703 bits (426), Expect = 8.451e-47
Identity = 72/117 (61.54%), Postives = 93/117 (79.49%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            K+N+ H  IL K++ ++ NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q ++ MGN K+ ++YEA LP NF RPQT+ A+E FIR KY+ K+Y
Sbjct:   12 KLNEQHQAILSKMLREDDNKYCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSVQSMGNTKARQLYEAHLPENFRRPQTDQAVEFFIRDKYERKKY 128          
BLAST of Small ArfGAP 1 vs. Ensembl Zebrafish
Match: smap1 (small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2])

HSP 1 Score: 167.933 bits (424), Expect = 1.181e-46
Identity = 72/117 (61.54%), Postives = 93/117 (79.49%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            K+N+ H  IL K++ ++ NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q ++ MGN K+ ++YEA LP NF RPQT+ A+E FIR KY+ K+Y
Sbjct:   12 KLNEQHQAILSKMLREDDNKYCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSVQSMGNTKARQLYEAHLPENFRRPQTDQAVEFFIRDKYERKKY 128          
BLAST of Small ArfGAP 1 vs. Ensembl Zebrafish
Match: smap2 (small ArfGAP2 [Source:ZFIN;Acc:ZDB-GENE-060503-374])

HSP 1 Score: 147.902 bits (372), Expect = 1.623e-39
Identity = 64/107 (59.81%), Postives = 80/107 (74.77%), Query Frame = 1
Query:  124 INKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIR 444
            I++   +L  ++  E NK CADC  +G RWASWN GIF+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q ++ MGN K+  +YEA LP  F RP+T+ A E FIR
Sbjct:    9 IDRYQAVLTSLLTLEENKFCADCYAKGPRWASWNLGIFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQSVQEMGNAKARRLYEAFLPECFQRPETDQAAEIFIR 115          
BLAST of Small ArfGAP 1 vs. Ensembl Zebrafish
Match: zgc:162872 (zgc:162872 [Source:ZFIN;Acc:ZDB-GENE-081022-1])

HSP 1 Score: 105.145 bits (261), Expect = 8.437e-24
Identity = 51/115 (44.35%), Postives = 72/115 (62.61%), Query Frame = 1
Query:  169 GNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAI---EEFIRSKYQYKRYC---ISPPKSDS 495
            GN++C DCG    RWAS N GI +CI C+GIHR+LGVH+SKV+S+ LDSW  EQL+++ ++GN   + IYE        +P         E++IRSKY  KR+    +  P +D+
Sbjct:  399 GNQHCCDCGEAEPRWASVNLGITMCIECSGIHRSLGVHLSKVRSLTLDSWEPEQLKLLCVLGNEVINGIYEREAADGLQKPSAGSPRQDKEQWIRSKYVEKRFVARHLDGPDADA 513          
BLAST of Small ArfGAP 1 vs. Ensembl Zebrafish
Match: si:ch211-168b3.1 (si:ch211-168b3.1 [Source:ZFIN;Acc:ZDB-GENE-081104-34])

HSP 1 Score: 105.145 bits (261), Expect = 9.286e-24
Identity = 56/128 (43.75%), Postives = 77/128 (60.16%), Query Frame = 1
Query:  121 KINKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGN-FTRPQ---TNYAIEEFIRSKYQYKRYCISPPKSD 492
            K+ K    L +++   GN+ C DCG    RWAS N  I LCI C+GIHR+LGVH SKV+S+ LD+W  E L++M  +GN   ++IYEA    N   +PQ       IE FIR+KY  KR+ + P + +
Sbjct:  397 KLVKGESALQRVLAIPGNEFCCDCGQSDPRWASINLCITLCIECSGIHRSLGVHNSKVRSLTLDTWEPELLKLMCELGNDVINQIYEAHREENGGKKPQPGDPRREIEAFIRAKYVDKRFVLKPTEQE 524          
BLAST of Small ArfGAP 1 vs. Ensembl Xenopus
Match: ammecr1l (AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907])

HSP 1 Score: 167.162 bits (422), Expect = 2.125e-47
Identity = 72/117 (61.54%), Postives = 92/117 (78.63%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            K N+ H  IL +++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K+ ++YEA LP NF RPQT+ ++E FIR KY+ K+Y
Sbjct:   12 KQNEQHQAILSRMLREEDNKYCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQMQCMQDMGNTKARQMYEANLPENFRRPQTDQSVEFFIRDKYERKKY 128          
BLAST of Small ArfGAP 1 vs. Ensembl Xenopus
Match: ammecr1l (AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907])

HSP 1 Score: 167.162 bits (422), Expect = 1.520e-46
Identity = 72/117 (61.54%), Postives = 92/117 (78.63%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            K N+ H  IL +++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K+ ++YEA LP NF RPQT+ ++E FIR KY+ K+Y
Sbjct:   12 KQNEQHQAILSRMLREEDNKYCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQMQCMQDMGNTKARQMYEANLPENFRRPQTDQSVEFFIRDKYERKKY 128          
BLAST of Small ArfGAP 1 vs. Ensembl Xenopus
Match: ammecr1l (AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907])

HSP 1 Score: 167.933 bits (424), Expect = 1.943e-46
Identity = 72/117 (61.54%), Postives = 92/117 (78.63%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            K N+ H  IL +++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K+ ++YEA LP NF RPQT+ ++E FIR KY+ K+Y
Sbjct:   12 KQNEQHQAILSRMLREEDNKYCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQMQCMQDMGNTKARQMYEANLPENFRRPQTDQSVEFFIRDKYERKKY 128          
BLAST of Small ArfGAP 1 vs. Ensembl Xenopus
Match: ammecr1l (AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907])

HSP 1 Score: 167.162 bits (422), Expect = 2.806e-46
Identity = 72/117 (61.54%), Postives = 92/117 (78.63%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            K N+ H  IL +++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K+ ++YEA LP NF RPQT+ ++E FIR KY+ K+Y
Sbjct:   12 KQNEQHQAILSRMLREEDNKYCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQMQCMQDMGNTKARQMYEANLPENFRRPQTDQSVEFFIRDKYERKKY 128          
BLAST of Small ArfGAP 1 vs. Ensembl Xenopus
Match: foxn3 (forkhead box N3 [Source:Xenbase;Acc:XB-GENE-483117])

HSP 1 Score: 165.236 bits (417), Expect = 4.174e-46
Identity = 72/123 (58.54%), Postives = 92/123 (74.80%), Query Frame = 1
Query:  112 MTSK----INKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            MT K    + +   +L +++ +E NK CADC  +G RWASWN G+F+CIRCAG+HRNLGVHIS+VKSV+LD WT EQ+Q ME MGN K+  +YEA LP NF RPQT+ A+E FIR KY+ K+Y
Sbjct:    1 MTGKSVRDVERYQAVLSELLLREENKFCADCLAKGPRWASWNIGVFVCIRCAGVHRNLGVHISRVKSVNLDQWTQEQIQCMEEMGNGKAKRLYEAFLPDNFIRPQTDQAVEVFIRDKYEKKKY 123          
BLAST of Small ArfGAP 1 vs. Ensembl Mouse
Match: Smap2 (small ArfGAP 2 [Source:MGI Symbol;Acc:MGI:1917030])

HSP 1 Score: 162.155 bits (409), Expect = 1.000e-44
Identity = 67/115 (58.26%), Postives = 89/115 (77.39%), Query Frame = 1
Query:  124 INKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            +++   +L  ++ +E NK CADC ++G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K++ +YEA LP  F RPQ + A+E FIR KY+ K+Y
Sbjct:    9 VDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKY 123          
BLAST of Small ArfGAP 1 vs. Ensembl Mouse
Match: Smap1 (small ArfGAP 1 [Source:MGI Symbol;Acc:MGI:2138261])

HSP 1 Score: 162.155 bits (409), Expect = 1.403e-44
Identity = 71/109 (65.14%), Postives = 87/109 (79.82%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIR 444
            K+N+ H LIL K++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K+  +YEA LP NF RPQT+ A+E FIR
Sbjct:   12 KLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR 120          
BLAST of Small ArfGAP 1 vs. Ensembl Mouse
Match: Acap3 (ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 [Source:MGI Symbol;Acc:MGI:2153589])

HSP 1 Score: 103.605 bits (257), Expect = 3.716e-23
Identity = 65/190 (34.21%), Postives = 93/190 (48.95%), Query Frame = 1
Query:  130 KSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAI----EEFIRSKYQYKRY--------------------CISPPKSDSSPTTEDNDKCK---SNIAKLKKPASVESESDKTSTPMQESDDSL 618
            K   +L ++    GN  C DCG    RWAS N G+ LCI C+GIHR+LGVH SKV+S+ LDSW  E L++M  +GN   ++IYEA   G   R  T  +     E +I+ KY  K++                    C  P  S  +PTT    + +    ++A L   A++E +  + S    +  DSL
Sbjct:  401 KGESVLQRVQSVAGNSQCGDCGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSTVNQIYEAQCEGPGVRKPTASSSRQDKEAWIKDKYVEKKFLRKLTSAPAREPPRRWRAQKCQRPHSSPHAPTTRRKVRLEPVLPSVAALSSAATMERKFRRDSLFCPDELDSL 590          
BLAST of Small ArfGAP 1 vs. Ensembl Mouse
Match: Agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:MGI Symbol;Acc:MGI:2183446])

HSP 1 Score: 102.064 bits (253), Expect = 4.122e-23
Identity = 49/111 (44.14%), Postives = 67/111 (60.36%), Query Frame = 1
Query:  169 GNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEE---FIRSKYQYKRYCISPPKSD 492
            GN  C DC      WAS N G  +CI C+GIHR+LG H+S+V+S+DLD W  E L VM  MGN  ++ ++E AL G +++P      EE   +IR+KY+ K +    P SD
Sbjct:  207 GNSLCIDCEAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELLAVMTAMGNALANSVWEGALDG-YSKPGPEACREEKERWIRAKYEQKLFLAPLPSSD 316          
BLAST of Small ArfGAP 1 vs. Ensembl Mouse
Match: Acap3 (ArfGAP with coiled-coil, ankyrin repeat and PH domains 3 [Source:MGI Symbol;Acc:MGI:2153589])

HSP 1 Score: 103.219 bits (256), Expect = 4.406e-23
Identity = 65/190 (34.21%), Postives = 93/190 (48.95%), Query Frame = 1
Query:  130 KSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAI----EEFIRSKYQYKRY--------------------CISPPKSDSSPTTEDNDKCK---SNIAKLKKPASVESESDKTSTPMQESDDSL 618
            K   +L ++    GN  C DCG    RWAS N G+ LCI C+GIHR+LGVH SKV+S+ LDSW  E L++M  +GN   ++IYEA   G   R  T  +     E +I+ KY  K++                    C  P  S  +PTT    + +    ++A L   A++E +  + S    +  DSL
Sbjct:  397 KGESVLQRVQSVAGNSQCGDCGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSTVNQIYEAQCEGPGVRKPTASSSRQDKEAWIKDKYVEKKFLRKLTSAPAREPPRRWRAQKCQRPHSSPHAPTTRRKVRLEPVLPSVAALSSAATMERKFRRDSLFCPDELDSL 586          
BLAST of Small ArfGAP 1 vs. UniProt/SwissProt
Match: sp|Q5F413|SMAP2_CHICK (Stromal membrane-associated protein 2 OS=Gallus gallus OX=9031 GN=SMAP2 PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 4.010e-45
Identity = 69/115 (60.00%), Postives = 89/115 (77.39%), Query Frame = 1
Query:  124 INKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            + +   +L  ++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K++ +YEA LP NF RPQT+ A+E FIR KY+ K+Y
Sbjct:    9 VERYQAVLGSLLSEEENKYCADCQAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAFLPENFRRPQTDQAVEGFIRDKYEKKKY 123          
BLAST of Small ArfGAP 1 vs. UniProt/SwissProt
Match: sp|Q5EA00|SMAP2_BOVIN (Stromal membrane-associated protein 2 OS=Bos taurus OX=9913 GN=SMAP2 PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.755e-44
Identity = 67/115 (58.26%), Postives = 90/115 (78.26%), Query Frame = 1
Query:  124 INKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            +++   +L  ++ +E NK CADC ++G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K++ +YEA LP  F RPQ ++A+E FIR KY+ K+Y
Sbjct:    9 VDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDHAVEGFIRDKYEKKKY 123          
BLAST of Small ArfGAP 1 vs. UniProt/SwissProt
Match: sp|Q8IYB5|SMAP1_HUMAN (Stromal membrane-associated protein 1 OS=Homo sapiens OX=9606 GN=SMAP1 PE=1 SV=2)

HSP 1 Score: 164.081 bits (414), Expect = 2.810e-44
Identity = 71/109 (65.14%), Postives = 87/109 (79.82%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIR 444
            K+N+ H LIL K++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K+  +YEA LP NF RPQT+ A+E FIR
Sbjct:   12 KLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR 120          
BLAST of Small ArfGAP 1 vs. UniProt/SwissProt
Match: sp|Q8WU79|SMAP2_HUMAN (Stromal membrane-associated protein 2 OS=Homo sapiens OX=9606 GN=SMAP2 PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 6.992e-44
Identity = 67/115 (58.26%), Postives = 89/115 (77.39%), Query Frame = 1
Query:  124 INKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            +++   +L  ++ +E NK CADC ++G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K++ +YEA LP  F RPQ + A+E FIR KY+ K+Y
Sbjct:    9 VDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKY 123          
BLAST of Small ArfGAP 1 vs. UniProt/SwissProt
Match: sp|Q7TN29|SMAP2_MOUSE (Stromal membrane-associated protein 2 OS=Mus musculus OX=10090 GN=Smap2 PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 6.998e-44
Identity = 67/115 (58.26%), Postives = 89/115 (77.39%), Query Frame = 1
Query:  124 INKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            +++   +L  ++ +E NK CADC ++G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M+ MGN K++ +YEA LP  F RPQ + A+E FIR KY+ K+Y
Sbjct:    9 VDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKY 123          
BLAST of Small ArfGAP 1 vs. TrEMBL
Match: A0A0N4UC26 (Arf-GAP domain-containing protein OS=Dracunculus medinensis OX=318479 GN=DME_LOCUS8678 PE=4 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 8.984e-47
Identity = 67/115 (58.26%), Postives = 95/115 (82.61%), Query Frame = 1
Query:  130 KSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRYCI 474
            + H ++++++ ++ NK CADC  +  RWASWN G+FLCIRCAGIHRNLGVH++K+KSV+LDSWT EQ+Q M +MGN+++ ++YEA LP +F RPQT+ A+E FIR+KY++KRY I
Sbjct:   16 RLHALVVELLREDENKYCADCEAKQPRWASWNLGVFLCIRCAGIHRNLGVHLTKIKSVNLDSWTAEQVQSMRVMGNKRAKQVYEAELPEHFRRPQTDQALESFIRAKYEHKRYII 130          
BLAST of Small ArfGAP 1 vs. TrEMBL
Match: A0A3P9HI60 (Small ArfGAP 1 OS=Oryzias latipes OX=8090 GN=SMAP1 (1 of many) PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 1.302e-46
Identity = 81/163 (49.69%), Postives = 110/163 (67.48%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY------CISPPKSDSSPTTE-----------DNDKCKSNIAKLKKP 555
            K+N+ H  IL K++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M  MGN ++  +YEA LP NF RPQT+ A+E FIR KY+ K+Y        +P  S++ P++            ++ +C+SN  K+ +P
Sbjct:   12 KLNEEHQTILSKLLREEDNKYCADCEAKGPRWASWNLGVFMCIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSMVDMGNTRAKHLYEAHLPENFRRPQTDQAVEVFIRDKYERKKYYNKEAAAAAPKTSEAVPSSTLLSSQADRSRPEHSECRSNAGKITEP 174          
BLAST of Small ArfGAP 1 vs. TrEMBL
Match: A0A484CBC3 (Arf-GAP domain-containing protein OS=Perca flavescens OX=8167 GN=EPR50_G00174780 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.345e-46
Identity = 79/130 (60.77%), Postives = 98/130 (75.38%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRYC------ISPPKS 489
            K+N+ H  IL K++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M  MGN ++ E+YEA LP NF RPQT+ A+E FIR KY+ K+YC       +PPKS
Sbjct:   12 KLNEQHQAILSKLLREEHNKFCADCEAKGPRWASWNLGVFMCIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSMVDMGNSRAKELYEAYLPENFRRPQTDQAVEVFIRDKYERKKYCNKEALTAAPPKS 141          
BLAST of Small ArfGAP 1 vs. TrEMBL
Match: Q5C6R3 (SJCHGC04830 protein (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 170.629 bits (431), Expect = 1.435e-46
Identity = 81/150 (54.00%), Postives = 101/150 (67.33%), Query Frame = 1
Query:  130 KSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRYCISPPKSDSSPTTEDNDKCKSNIAKL-----KKPASV 564
            +  LI+ +++  E NK CADC  +G RWASWN GIFLCIRCAGIHRNLGVHISKVKSV+LD+WT  QL VM  MGN ++  +YEA LP NF RPQT+ A+E FIR+KY+ KRY       + +P   D +     + +L     KKP SV
Sbjct:   12 RHQLIIQELLRDEDNKYCADCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISKVKSVNLDTWTPMQLAVMREMGNSRARAVYEANLPDNFRRPQTDSALETFIRAKYEQKRYIA----QEYTPIKPDVESLMKELQRLELSLKKKPTSV 157          
BLAST of Small ArfGAP 1 vs. TrEMBL
Match: A0A183KPD7 (Arf-GAP domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS16918 PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.609e-46
Identity = 76/127 (59.84%), Postives = 94/127 (74.02%), Query Frame = 1
Query:  130 KSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRYCISPPKSDSSPTTE 510
            +  LI+ +++  + NK CADC  +G RWASWN GIFLCIRCAGIHRNLGVHISKVKSV+LD+WT  QL VM  MGN ++  +YEA LP NF RPQT+ A+E FIR+KY+ KRY I+   + S P  E
Sbjct:   17 RHQLIIQELLRDDDNKYCADCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISKVKSVNLDTWTPMQLAVMREMGNSRARAVYEANLPDNFRRPQTDAALETFIRAKYEQKRY-IAQEYTPSKPDVE 142          
BLAST of Small ArfGAP 1 vs. Ensembl Cavefish
Match: smap1 (small ArfGAP 1 [Source:NCBI gene;Acc:103038877])

HSP 1 Score: 160.229 bits (404), Expect = 7.251e-44
Identity = 69/109 (63.30%), Postives = 87/109 (79.82%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIR 444
            K+N+ H  IL K++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q ++ MGN K+ ++YEA LP NF RPQT+ A+E FIR
Sbjct:   12 KLNEQHQAILSKMLREEDNKYCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSVQSMGNTKARQLYEAHLPDNFRRPQTDQAVEFFIR 120          
BLAST of Small ArfGAP 1 vs. Ensembl Cavefish
Match: smap1 (small ArfGAP 1 [Source:NCBI gene;Acc:103038877])

HSP 1 Score: 160.229 bits (404), Expect = 8.555e-44
Identity = 69/109 (63.30%), Postives = 87/109 (79.82%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIR 444
            K+N+ H  IL K++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q ++ MGN K+ ++YEA LP NF RPQT+ A+E FIR
Sbjct:   12 KLNEQHQAILSKMLREEDNKYCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSVQSMGNTKARQLYEAHLPDNFRRPQTDQAVEFFIR 120          
BLAST of Small ArfGAP 1 vs. Ensembl Cavefish
Match: smap1 (small ArfGAP 1 [Source:NCBI gene;Acc:103038877])

HSP 1 Score: 160.999 bits (406), Expect = 8.609e-44
Identity = 69/109 (63.30%), Postives = 87/109 (79.82%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIR 444
            K+N+ H  IL K++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q ++ MGN K+ ++YEA LP NF RPQT+ A+E FIR
Sbjct:   12 KLNEQHQAILSKMLREEDNKYCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSVQSMGNTKARQLYEAHLPDNFRRPQTDQAVEFFIR 120          
BLAST of Small ArfGAP 1 vs. Ensembl Cavefish
Match: smap1 (small ArfGAP 1 [Source:NCBI gene;Acc:103038877])

HSP 1 Score: 160.614 bits (405), Expect = 9.374e-44
Identity = 69/109 (63.30%), Postives = 87/109 (79.82%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIR 444
            K+N+ H  IL K++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q ++ MGN K+ ++YEA LP NF RPQT+ A+E FIR
Sbjct:   12 KLNEQHQAILSKMLREEDNKYCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSVQSMGNTKARQLYEAHLPDNFRRPQTDQAVEFFIR 120          
BLAST of Small ArfGAP 1 vs. Ensembl Cavefish
Match: smap2 (small ArfGAP2 [Source:ZFIN;Acc:ZDB-GENE-060503-374])

HSP 1 Score: 108.612 bits (270), Expect = 1.186e-25
Identity = 54/120 (45.00%), Postives = 72/120 (60.00%), Query Frame = 1
Query:  124 INKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY---CI 474
            +++   +L  ++  E NK CADC                  R  GIHRNLGVHIS+VKSV+LD WT EQ+Q ++ MGN K+  +YEA LP  F RP+T+ + E FIR KY+ K+Y   CI
Sbjct:    9 VDRYQAVLTSLLALEENKFCADC------------------RAKGIHRNLGVHISRVKSVNLDQWTQEQIQCVQEMGNAKARRLYEAFLPECFQRPETDQSAELFIRDKYEKKKYIDKCI 110          
BLAST of Small ArfGAP 1 vs. Ensembl Sea Lamprey
Match: smap1 (small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2])

HSP 1 Score: 164.851 bits (416), Expect = 4.390e-46
Identity = 70/117 (59.83%), Postives = 93/117 (79.49%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            K N+ H  +L+ ++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q ++ MGNRK+  +YEA LP +F RPQ+++A+E FIR KY+ K+Y
Sbjct:   12 KQNEQHQALLVAMLREEDNKYCADCEAKGPRWASWNLGVFVCIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQNIQEMGNRKARRLYEANLPDSFRRPQSDHAVEIFIREKYEKKKY 128          
BLAST of Small ArfGAP 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000548.1 (pep scaffold:Pmarinus_7.0:GL476772:99521:119783:-1 gene:ENSPMAG00000000494.1 transcript:ENSPMAT00000000548.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 4.257e-38
Identity = 62/107 (57.94%), Postives = 78/107 (72.90%), Query Frame = 1
Query:  202 GTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRYCISPPKSDSSPTTEDNDK 522
            G RWASWN G+F+CIRCAGIHRNLGVHI++VKSV+LD WT EQ+Q M+ MGN K+ ++YE  LP +F RP ++ A E FIR KY  KRY +      SSP  ++ DK
Sbjct:    1 GPRWASWNLGVFICIRCAGIHRNLGVHIARVKSVNLDQWTSEQIQHMQDMGNGKAKKLYEGFLPKDFRRPVSDQAAEAFIRDKYDKKRY-MDRDADISSPKDKEKDK 106          
BLAST of Small ArfGAP 1 vs. Ensembl Sea Lamprey
Match: acap3b (ArfGAP with coiled-coil, ankyrin repeat and PH domains 3b [Source:ZFIN;Acc:ZDB-GENE-070209-274])

HSP 1 Score: 99.7525 bits (247), Expect = 3.396e-23
Identity = 50/113 (44.25%), Postives = 73/113 (64.60%), Query Frame = 1
Query:  142 ILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAA---LPGNFTRPQTNYAIEE-FIRSKYQYKRY 468
            +L ++    GN+ C DCG    RWAS N GI LCI C+GIHR+LGVH SKV+S+ LDSW  E L++M  +GN   ++IYEA+   + G    P ++   +E +IR+KY  +++
Sbjct:   69 VLARVQAIRGNERCCDCGQPDPRWASINLGIALCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNHVINDIYEASADDVGGKKPTPSSSRQEKEMWIRAKYVDRKF 181          
BLAST of Small ArfGAP 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009914.1 (pep scaffold:Pmarinus_7.0:GL476634:533628:626389:1 gene:ENSPMAG00000008958.1 transcript:ENSPMAT00000009914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 1.115e-20
Identity = 40/82 (48.78%), Postives = 53/82 (64.63%), Query Frame = 1
Query:  154 IIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGN 399
            I + +GN  C DCG     WAS N G  +CI C+GIHRNLG H+S+V+S+DLD W  E  QVM  +GN  S  ++E +L G+
Sbjct:  538 IRDVQGNDVCIDCGAPNPDWASLNLGALICIECSGIHRNLGSHVSRVRSLDLDEWPDELAQVMVSVGNAMSRGVWEGSLAGH 619          
BLAST of Small ArfGAP 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006444.1 (pep scaffold:Pmarinus_7.0:GL477103:5377:54062:-1 gene:ENSPMAG00000005792.1 transcript:ENSPMAT00000006444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 1.909e-18
Identity = 38/83 (45.78%), Postives = 50/83 (60.24%), Query Frame = 1
Query:  166 EGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQ 414
             GN  C DC      WAS N G  +CI C+GIHRNLG H+S+V+S+DLD W  E   VM  +GN  ++ ++EA   G   +PQ
Sbjct:  572 RGNAFCVDCDAPSPDWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPLELAAVMLAIGNATANGVWEADTQG-LGKPQ 653          
BLAST of Small ArfGAP 1 vs. Ensembl Yeast
Match: AGE2 (ADP-ribosylation factor (ARF) GTPase activating protein (GAP) effector; involved in Trans-Golgi-Network (TGN) transport; contains C2C2H2 cysteine/histidine motif [Source:SGD;Acc:S000001306])

HSP 1 Score: 110.923 bits (276), Expect = 4.177e-28
Identity = 49/112 (43.75%), Postives = 76/112 (67.86%), Query Frame = 1
Query:  145 LLKIIEKEGNKNCADCGTE-GTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQL-QVMELMGNRKSHEIYEAALPGNFTRPQT--NYAIEEFIRSKYQYKRY 468
            L  ++   GN +CADC  +   RWASW+ G+F+CI+CAGIHR+LG HISKVKSVDLD+W  E L ++++   N +++  YEA L     + +     +++ FI++KY+YK++
Sbjct:   11 LSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYKKW 122          
BLAST of Small ArfGAP 1 vs. Ensembl Yeast
Match: GCS1 (ADP-ribosylation factor GTPase activating protein (ARF GAP); involved in ER-Golgi transport; required for prospore membrane formation; regulates phospholipase Spo14p; shares functional similarity with Glo3p; GCS1 has a paralog, SPS18, that arose from the whole genome duplication [Source:SGD;Acc:S000002385])

HSP 1 Score: 82.4185 bits (202), Expect = 8.080e-18
Identity = 41/89 (46.07%), Postives = 55/89 (61.80%), Query Frame = 1
Query:  145 LLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNR------KSHEIYEAALP 393
            LL++ +   NK C DCG    +WA+  FG F+C+ CAGIHR LGVHIS V+S+ +D +  E+L  ME  GN       KSH I + +LP
Sbjct:   14 LLQLQKIGANKKCMDCGAPNPQWATPKFGAFICLECAGIHRGLGVHISFVRSITMDQFKPEELLRMEKGGNEPLTEWFKSHNI-DLSLP 101          
BLAST of Small ArfGAP 1 vs. Ensembl Yeast
Match: GLO3 (ADP-ribosylation factor GTPase activating protein (ARF GAP); involved in ER-Golgi transport; shares functional similarity with Gcs1p [Source:SGD;Acc:S000000924])

HSP 1 Score: 81.6481 bits (200), Expect = 3.367e-17
Identity = 33/82 (40.24%), Postives = 49/82 (59.76%), Query Frame = 1
Query:  133 SHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIY 378
            +  +  K+     N+ C DCG +   W S  FG+ LCI+C+ +HRN+GVHI+ VKS  LD WT   L+  +L GN K+ + +
Sbjct:   15 TQQVFQKLGSNMENRVCFDCGNKNPTWTSVPFGVMLCIQCSAVHRNMGVHITFVKSSTLDKWTINNLRRFKLGGNHKARDFF 96          
BLAST of Small ArfGAP 1 vs. Ensembl Yeast
Match: AGE1 (ADP-ribosylation factor (ARF) GTPase activating protein (GAP) effector; involved in the secretory and endocytic pathways; contains C2C2H2 cysteine/histidine motif [Source:SGD;Acc:S000002932])

HSP 1 Score: 77.0258 bits (188), Expect = 1.020e-15
Identity = 48/122 (39.34%), Postives = 70/122 (57.38%), Query Frame = 1
Query:  145 LLKIIEK--EGNKNCADCGTEGT-RWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELM----GNRKSHEIYEAALPGNF-----TRPQTNYAIEEFIRSKYQYKRYCI 474
            LL I+ K  + N  C DCG+  T  W S N    LCI+C+G+HR+LG HISK++S+ LD++T   L++M L+     N   + IYE+ L  NF     T    +    +FI  KYQ+K++ I
Sbjct:  172 LLSIVRKIDKSNLKCCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRSLTLDNFTS--LELMHLLQNNVSNSNVNAIYESNL-RNFPVKKITANSDDSERSKFIIDKYQFKKFVI 290          
BLAST of Small ArfGAP 1 vs. Ensembl Yeast
Match: GTS1 (Protein involved in Arf3p regulation and in transcription regulation; localizes to the nucleus and to endocytic patches; contains an N-terminal Zn-finger and ArfGAP homology domain, a C-terminal glutamine-rich region, and a UBA (ubiquitin associated) domain; gts1 mutations affect budding, cell size, heat tolerance, sporulation, life span, ultradian rhythms, endocytosis; expression oscillates in a pattern similar to metabolic oscillations [Source:SGD;Acc:S000003149])

HSP 1 Score: 63.1586 bits (152), Expect = 2.638e-11
Identity = 37/111 (33.33%), Postives = 55/111 (49.55%), Query Frame = 1
Query:  145 LLKIIEKEGNKN-CADCGTEGTRWASWNFGIFLCIRCAGIHRNL-----GVHISKVKSVDLDSWTGEQL-QVMELMGNRKSHEIYEAA-LPGNFTRPQTNYAIEEFIRSKY 453
            L ++I    N N C +CG     W S N G+FLC RCA +HR +         S VKS+ +D WT E + +++ L GN+ +   +    +P  F        +E +IR KY
Sbjct:   17 LKELINSSENANKCGECGNFYPTWCSVNLGVFLCGRCASVHRKVFGSRDDDAFSNVKSLSMDRWTREDIDELVSLGGNKGNARFWNPKNVPFPFDGDDDKAIVEHYIRDKY 127          
BLAST of Small ArfGAP 1 vs. Ensembl Nematostella
Match: EDO33091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST58])

HSP 1 Score: 154.066 bits (388), Expect = 1.402e-45
Identity = 67/116 (57.76%), Postives = 89/116 (76.72%), Query Frame = 1
Query:  121 KINKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY 468
            K N +  IL+ ++++E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHISKVKSV+LDSWT EQ+  ++  GNR++   +E  LP +F RPQT+ A+E FIR KY+ K++
Sbjct:   12 KQNANQAILVDMLKEEKNKYCADCAAKGPRWASWNLGVFICIRCAGIHRNLGVHISKVKSVNLDSWTEEQMASIQSWGNRRAGLYWECYLPEDFRRPQTDSAMEAFIRKKYEQKKF 127          
BLAST of Small ArfGAP 1 vs. Ensembl Nematostella
Match: EDO47919 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ9])

HSP 1 Score: 108.227 bits (269), Expect = 3.373e-26
Identity = 53/124 (42.74%), Postives = 79/124 (63.71%), Query Frame = 1
Query:  124 INKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQT---NYAIEEFIRSKYQYKRYCISPPK 486
            + K+   LL++ ++ GN  CADCG +   WAS + GIF+CI C+G+HRNLG  IS VKS+ LD+WT E+LQ M   GN KS+ I+   +P  + RP+    +   E++IR+KY+ K +    P+
Sbjct:    1 MEKNRNALLELAKRPGNNTCADCGAKHPEWASASKGIFICITCSGVHRNLGTQISVVKSLRLDTWTDERLQFMIENGNEKSNAIWAKNVPICYRRPKCTDPHVLREQWIRAKYERKEFIDGAPE 124          
BLAST of Small ArfGAP 1 vs. Ensembl Nematostella
Match: EDO43007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZU7])

HSP 1 Score: 107.071 bits (266), Expect = 7.485e-25
Identity = 60/167 (35.93%), Postives = 89/167 (53.29%), Query Frame = 1
Query:  151 KIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPG--NFTRPQTNYAIEEFIRSKYQYKRYCISPPKSDSSPTTEDNDKCKSNIAKLKKPASVESESDKTSTPMQESDDSLG-DPDYLID 642
            +I + EGNK CADC      WAS N GI +CI C+G+HR++GVH+SKV+S+ LD W G+ ++ ME MGN K ++I+EA L      TR    +  + FI+ KY  +++    P     P   +        A + +P   E E    S  +++    +G  P  LID
Sbjct:  514 RIRKVEGNKYCADCSAPRPDWASINLGITVCIECSGVHRSMGVHVSKVRSLTLDKWDGDTVEFMEAMGNTKVNKIFEANLNDFPKLTRDSGKHDRQAFIKLKYVEQKFYSPIPAEGLDPEVAE--------ALITRPGDREDELLDISQELEDERSLMGSSPLCLID 672          
BLAST of Small ArfGAP 1 vs. Ensembl Nematostella
Match: EDO37809 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEL6])

HSP 1 Score: 102.064 bits (253), Expect = 2.069e-23
Identity = 48/103 (46.60%), Postives = 69/103 (66.99%), Query Frame = 1
Query:  169 GNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQ--TNYAIEE-FIRSKYQYKRY 468
            GN+ CADC     +WAS N G+ LCI C+GIHR+LGVH+SKV+S+ LD+W  E L++M  +GN   + IYEA + G+  +    +N +  E +I+SKY Y R+
Sbjct:  416 GNEVCADCNHNDPKWASINLGVVLCIECSGIHRSLGVHVSKVRSLTLDAWEPEHLKLMSELGNSLINSIYEAKIAGDHKKINHLSNRSDREAWIKSKYIYHRF 518          
BLAST of Small ArfGAP 1 vs. Ensembl Nematostella
Match: EDO42956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S052])

HSP 1 Score: 99.3673 bits (246), Expect = 2.378e-22
Identity = 48/113 (42.48%), Postives = 67/113 (59.29%), Query Frame = 1
Query:  169 GNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEE---FIRSKYQYKRYCISPPKSDSS 498
            GN  C DCG     WAS N G  +CI C+G+HRN+G H+S+V+S+DLD W  E   VM  +GN  ++ I+E  + GN  +P  + + EE   +IRSKY+ K +    P  D S
Sbjct:  560 GNNICVDCGAPNPDWASLNLGALMCIECSGVHRNIGTHVSRVRSLDLDDWPSEVTAVMCSIGNSLANSIWEGRI-GNREKPTPSSSREEKERWIRSKYENKDFLSELPSCDFS 671          
BLAST of Small ArfGAP 1 vs. Ensembl Medaka
Match: smap1 (stromal membrane-associated protein 1 [Source:NCBI gene;Acc:101169097])

HSP 1 Score: 169.474 bits (428), Expect = 1.053e-47
Identity = 76/136 (55.88%), Postives = 100/136 (73.53%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRY------CISPPKSDSSPTT 507
            K+N+ H  IL K++++E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q M  MGN ++  +YEA LP NF RPQT+ A+E FIR KY+ K+Y        +P  S++ P++
Sbjct:   12 KLNEEHQTILSKLLKEEDNKYCADCEAKGPRWASWNLGVFMCIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQSMVDMGNTRAKHLYEAHLPENFRRPQTDQAVEVFIRDKYERKKYYNKEAAAAAPKTSEAVPSS 147          
BLAST of Small ArfGAP 1 vs. Ensembl Medaka
Match: SMAP1 (stromal membrane-associated protein 1 [Source:NCBI gene;Acc:101160389])

HSP 1 Score: 152.14 bits (383), Expect = 6.483e-41
Identity = 83/196 (42.35%), Postives = 106/196 (54.08%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIR------------------------------------SKYQYKRYC--ISPPKSDSSPTTEDNDKCKSNIAKLKKPASVESESDKTST 591
            K+N+ H  IL K++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q ++ MGN K+  +YEA LP +F RPQT+ A+E FIR                                    SK +  R    +SP K    P          N+  L  PA+V   +  TST
Sbjct:   12 KLNEQHQAILSKMLREEDNKYCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTSEQIQSIQDMGNTKARRLYEANLPDSFRRPQTDQAVEFFIRDKYEKKKYYSKNGLDRSSPKDKKEKEPDRGGKVSSHSKSEESRPVPKVSPAKPAEPPV---------NLLGLDAPAAVSPNNGNTST 198          
BLAST of Small ArfGAP 1 vs. Ensembl Medaka
Match: SMAP1 (stromal membrane-associated protein 1 [Source:NCBI gene;Acc:101160389])

HSP 1 Score: 150.214 bits (378), Expect = 1.092e-40
Identity = 83/196 (42.35%), Postives = 106/196 (54.08%), Query Frame = 1
Query:  121 KINKSH-LILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIR------------------------------------SKYQYKRYC--ISPPKSDSSPTTEDNDKCKSNIAKLKKPASVESESDKTST 591
            K+N+ H  IL K++ +E NK CADC  +G RWASWN G+F+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q ++ MGN K+  +YEA LP +F RPQT+ A+E FIR                                    SK +  R    +SP K    P          N+  L  PA+V   +  TST
Sbjct:   12 KLNEQHQAILSKMLREEDNKYCADCEAKGPRWASWNLGVFICIRCAGIHRNLGVHISRVKSVNLDQWTSEQIQSIQDMGNTKARRLYEANLPDSFRRPQTDQAVEFFIRDKYEKKKYYSKNGLDRSSPKDKKEKEPDRGGKVSSHSKSEESRPVPKVSPAKPAEPPV---------NLLGLDAPAAVSPNNGNTST 198          
BLAST of Small ArfGAP 1 vs. Ensembl Medaka
Match: smap2 (stromal membrane-associated protein 2 [Source:NCBI gene;Acc:101174757])

HSP 1 Score: 146.747 bits (369), Expect = 6.027e-39
Identity = 63/107 (58.88%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  124 INKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIR 444
            +++   +L  ++  E NK CADC ++G RWASWN GIF+CIRCAGIHRNLGVHIS+VKSV+LD WT EQ+Q ++ MGN K+  +YEA LP  F RP+T+ A E FIR
Sbjct:    9 VDRYQAVLNSLLALEENKFCADCESKGPRWASWNLGIFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQVQCVQEMGNAKAKRLYEAFLPECFQRPETDQAAEIFIR 115          
BLAST of Small ArfGAP 1 vs. Ensembl Medaka
Match: acap2 (ArfGAP with coiled-coil, ankyrin repeat and PH domains 2 [Source:NCBI gene;Acc:101158345])

HSP 1 Score: 108.227 bits (269), Expect = 7.659e-25
Identity = 55/124 (44.35%), Postives = 76/124 (61.29%), Query Frame = 1
Query:  121 KINKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTR-PQ---TNYAIEEFIRSKYQYKRYCISP 480
            ++ K    L K++   GN  C DCG    RWAS N GI LCI+C+GIHR+LGVH SKV+S+ LDSW  E L++M  +GN+  +EIYEA       R PQ     + +E +I++KY  +R+   P
Sbjct:  394 RLLKGESALQKVLAIPGNSCCCDCGQPDPRWASINLGITLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELLKLMCELGNKAINEIYEARREELGARKPQPGDPRHEVEAYIKAKYVDRRFVRRP 517          
BLAST of Small ArfGAP 1 vs. Planmine SMEST
Match: SMESG000069155.1 (SMESG000069155.1)

HSP 1 Score: 662.529 bits (1708), Expect = 0.000e+0
Identity = 332/333 (99.70%), Postives = 333/333 (100.00%), Query Frame = 1
Query:  112 MTSKINKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRYCISPPKSDSSPTTEDNDKCKSNIAKLKKPASVESESDKTSTPMQESDDSLGDPDYLIDLKEKPTKACHKVYSEGDLINFNSNSKTKSCNNDLFDTNNKSKILSLYDKPNSIGGYQSSMLPMXXXXXXXXXXXXIDGQYHSTTSIPASNQNSYLKQIQEKLSTIKDNLTSKFKSYEQPGVLPHQSGNMFSSANRNVPNSKGNQNGGETLSPDLWR 1110
            MTSKINKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRYCISPPKSDSSPTTEDNDKCKSNIA+LKKPASVESESDKTSTPMQESDDSLGDPDYLIDLKEKPTKACHKVYSEGDLINFNSNSKTKSCNNDLFDTNNKSKILSLYDKPNSIGGYQSSMLPMSNSSYQKSYGSSIDGQYHSTTSIPASNQNSYLKQIQEKLSTIKDNLTSKFKSYEQPGVLPHQSGNMFSSANRNVPNSKGNQNGGETLSPDLWR
Sbjct:    1 MTSKINKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRYCISPPKSDSSPTTEDNDKCKSNIARLKKPASVESESDKTSTPMQESDDSLGDPDYLIDLKEKPTKACHKVYSEGDLINFNSNSKTKSCNNDLFDTNNKSKILSLYDKPNSIGGYQSSMLPMSNSSYQKSYGSSIDGQYHSTTSIPASNQNSYLKQIQEKLSTIKDNLTSKFKSYEQPGVLPHQSGNMFSSANRNVPNSKGNQNGGETLSPDLWR 333          
BLAST of Small ArfGAP 1 vs. Planmine SMEST
Match: SMESG000048247.1 (SMESG000048247.1)

HSP 1 Score: 159.844 bits (403), Expect = 2.542e-44
Identity = 72/142 (50.70%), Postives = 98/142 (69.01%), Query Frame = 1
Query:  127 NKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRPQTNYAIEEFIRSKYQYKRYCISPPKSDSSPTTEDNDKCKSNIAKLKK 552
            +K  +IL  +++ + NK C DC ++G RWASW  GIFLCIRCAGIHRNLGVH+S+VKSV+LDSWT +Q+ +M+ +GN +   IYEA L  NF RPQT+ ++E+FIR KY++KRY       +  P T   D     I KL++
Sbjct:   13 DKLQIILADLLKDDDNKYCVDCDSKGPRWASWTLGIFLCIRCAGIHRNLGVHLSRVKSVNLDSWTPQQVAMMKEIGNSRGRAIYEANLEDNFRRPQTDSSLEQFIRGKYEHKRYI----AKEWIPPTPSVDSISEEIRKLEQ 150          
BLAST of Small ArfGAP 1 vs. Planmine SMEST
Match: SMESG000018614.1 (SMESG000018614.1)

HSP 1 Score: 102.834 bits (255), Expect = 3.835e-23
Identity = 49/111 (44.14%), Postives = 68/111 (61.26%), Query Frame = 1
Query:  169 GNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAAL---PGNFTRPQTNYAI---EEFIRSKYQYKRYCISPP 483
            GN  CADCG     WAS N G  +CI C+G+HR LG HIS+V+S+ LD W  E   VM+ +GN  ++ ++EAA+   P N  +P+ N      EE+IRSKY+ + +   PP
Sbjct:  698 GNDFCADCGQPKPDWASLNLGELVCIECSGVHRKLGTHISRVRSLQLDQWAPEWQAVMKAIGNTVANTVWEAAVNVSPRNLKKPELNSPAKDKEEWIRSKYERREFL--PP 806          
BLAST of Small ArfGAP 1 vs. Planmine SMEST
Match: SMESG000018614.1 (SMESG000018614.1)

HSP 1 Score: 102.834 bits (255), Expect = 4.534e-23
Identity = 49/111 (44.14%), Postives = 68/111 (61.26%), Query Frame = 1
Query:  169 GNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAAL---PGNFTRPQTNYAI---EEFIRSKYQYKRYCISPP 483
            GN  CADCG     WAS N G  +CI C+G+HR LG HIS+V+S+ LD W  E   VM+ +GN  ++ ++EAA+   P N  +P+ N      EE+IRSKY+ + +   PP
Sbjct:  669 GNDFCADCGQPKPDWASLNLGELVCIECSGVHRKLGTHISRVRSLQLDQWAPEWQAVMKAIGNTVANTVWEAAVNVSPRNLKKPELNSPAKDKEEWIRSKYERREFL--PP 777          
BLAST of Small ArfGAP 1 vs. Planmine SMEST
Match: SMESG000075717.1 (SMESG000075717.1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.501e-21
Identity = 43/113 (38.05%), Postives = 71/113 (62.83%), Query Frame = 1
Query:  169 GNKNCADCGTEGTRWASWNFGIFLCIRCAGIHRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAAL-PGNFTRPQTNYAI---EEFIRSKYQYKRYCISPPKSDS 495
            GN+ C DCG+    WAS N GI +CI C+G+HR LG H+S+V+S  LD W+ E + VM+ +GN  ++ ++EA++   +  +P+ + +    E ++RSKY+ K +    P  D+
Sbjct:  718 GNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDA 830          
The following BLAST results are available for this feature:
BLAST of Small ArfGAP 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMAP15.850e-4565.14small ArfGAP 1 [Source:HGNC Symbol;Acc:HGNC:19651][more]
SMAP16.063e-4565.14small ArfGAP 1 [Source:HGNC Symbol;Acc:HGNC:19651][more]
SMAP21.456e-4458.26small ArfGAP2 [Source:HGNC Symbol;Acc:HGNC:25082][more]
SMAP11.706e-4465.14small ArfGAP 1 [Source:HGNC Symbol;Acc:HGNC:19651][more]
SMAP21.612e-3866.29small ArfGAP2 [Source:HGNC Symbol;Acc:HGNC:25082][more]
back to top
BLAST of Small ArfGAP 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
W09D10.14.858e-4559.46pep chromosome:WBcel235:III:10736919:10739786:-1 g... [more]
W09D10.14.858e-4559.46pep chromosome:WBcel235:III:10736919:10739792:-1 g... [more]
W09D10.14.858e-4559.46pep chromosome:WBcel235:III:10736893:10739824:-1 g... [more]
cnt-24.474e-2444.83Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-26.794e-2442.31Arf-GAP with ANK repeat and PH domain-containing p... [more]
back to top
BLAST of Small ArfGAP 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG82432.911e-4555.91gene:FBgn0033349 transcript:FBtr0088652[more]
CenB1A1.457e-2238.89gene:FBgn0039056 transcript:FBtr0084369[more]
CenB1A1.779e-2238.89gene:FBgn0039056 transcript:FBtr0084368[more]
CenG1A2.604e-2040.78gene:FBgn0028509 transcript:FBtr0080548[more]
CenG1A3.772e-2040.78gene:FBgn0028509 transcript:FBtr0080546[more]
back to top
BLAST of Small ArfGAP 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smap18.451e-4761.54small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2][more]
smap11.181e-4661.54small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2][more]
smap21.623e-3959.81small ArfGAP2 [Source:ZFIN;Acc:ZDB-GENE-060503-374... [more]
zgc:1628728.437e-2444.35zgc:162872 [Source:ZFIN;Acc:ZDB-GENE-081022-1][more]
si:ch211-168b3.19.286e-2443.75si:ch211-168b3.1 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
back to top
BLAST of Small ArfGAP 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ammecr1l2.125e-4761.54AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907][more]
ammecr1l1.520e-4661.54AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907][more]
ammecr1l1.943e-4661.54AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907][more]
ammecr1l2.806e-4661.54AMMECR1 like [Source:Xenbase;Acc:XB-GENE-5787907][more]
foxn34.174e-4658.54forkhead box N3 [Source:Xenbase;Acc:XB-GENE-483117... [more]
back to top
BLAST of Small ArfGAP 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smap21.000e-4458.26small ArfGAP 2 [Source:MGI Symbol;Acc:MGI:1917030][more]
Smap11.403e-4465.14small ArfGAP 1 [Source:MGI Symbol;Acc:MGI:2138261][more]
Acap33.716e-2334.21ArfGAP with coiled-coil, ankyrin repeat and PH dom... [more]
Agap34.122e-2344.14ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
Acap34.406e-2334.21ArfGAP with coiled-coil, ankyrin repeat and PH dom... [more]
back to top
BLAST of Small ArfGAP 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5F413|SMAP2_CHICK4.010e-4560.00Stromal membrane-associated protein 2 OS=Gallus ga... [more]
sp|Q5EA00|SMAP2_BOVIN1.755e-4458.26Stromal membrane-associated protein 2 OS=Bos tauru... [more]
sp|Q8IYB5|SMAP1_HUMAN2.810e-4465.14Stromal membrane-associated protein 1 OS=Homo sapi... [more]
sp|Q8WU79|SMAP2_HUMAN6.992e-4458.26Stromal membrane-associated protein 2 OS=Homo sapi... [more]
sp|Q7TN29|SMAP2_MOUSE6.998e-4458.26Stromal membrane-associated protein 2 OS=Mus muscu... [more]
back to top
BLAST of Small ArfGAP 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0N4UC268.984e-4758.26Arf-GAP domain-containing protein OS=Dracunculus m... [more]
A0A3P9HI601.302e-4649.69Small ArfGAP 1 OS=Oryzias latipes OX=8090 GN=SMAP1... [more]
A0A484CBC31.345e-4660.77Arf-GAP domain-containing protein OS=Perca flavesc... [more]
Q5C6R31.435e-4654.00SJCHGC04830 protein (Fragment) OS=Schistosoma japo... [more]
A0A183KPD71.609e-4659.84Arf-GAP domain-containing protein OS=Schistosoma c... [more]
back to top
BLAST of Small ArfGAP 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smap17.251e-4463.30small ArfGAP 1 [Source:NCBI gene;Acc:103038877][more]
smap18.555e-4463.30small ArfGAP 1 [Source:NCBI gene;Acc:103038877][more]
smap18.609e-4463.30small ArfGAP 1 [Source:NCBI gene;Acc:103038877][more]
smap19.374e-4463.30small ArfGAP 1 [Source:NCBI gene;Acc:103038877][more]
smap21.186e-2545.00small ArfGAP2 [Source:ZFIN;Acc:ZDB-GENE-060503-374... [more]
back to top
BLAST of Small ArfGAP 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smap14.390e-4659.83small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2][more]
ENSPMAT00000000548.14.257e-3857.94pep scaffold:Pmarinus_7.0:GL476772:99521:119783:-1... [more]
acap3b3.396e-2344.25ArfGAP with coiled-coil, ankyrin repeat and PH dom... [more]
ENSPMAT00000009914.11.115e-2048.78pep scaffold:Pmarinus_7.0:GL476634:533628:626389:1... [more]
ENSPMAT00000006444.11.909e-1845.78pep scaffold:Pmarinus_7.0:GL477103:5377:54062:-1 g... [more]
back to top
BLAST of Small ArfGAP 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AGE24.177e-2843.75ADP-ribosylation factor (ARF) GTPase activating pr... [more]
GCS18.080e-1846.07ADP-ribosylation factor GTPase activating protein ... [more]
GLO33.367e-1740.24ADP-ribosylation factor GTPase activating protein ... [more]
AGE11.020e-1539.34ADP-ribosylation factor (ARF) GTPase activating pr... [more]
GTS12.638e-1133.33Protein involved in Arf3p regulation and in transc... [more]
back to top
BLAST of Small ArfGAP 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO330911.402e-4557.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479193.373e-2642.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430077.485e-2535.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378092.069e-2346.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429562.378e-2242.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Small ArfGAP 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smap11.053e-4755.88stromal membrane-associated protein 1 [Source:NCBI... [more]
SMAP16.483e-4142.35stromal membrane-associated protein 1 [Source:NCBI... [more]
SMAP11.092e-4042.35stromal membrane-associated protein 1 [Source:NCBI... [more]
smap26.027e-3958.88stromal membrane-associated protein 2 [Source:NCBI... [more]
acap27.659e-2544.35ArfGAP with coiled-coil, ankyrin repeat and PH dom... [more]
back to top
BLAST of Small ArfGAP 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069155.10.000e+099.70SMESG000069155.1[more]
SMESG000048247.12.542e-4450.70SMESG000048247.1[more]
SMESG000018614.13.835e-2344.14SMESG000018614.1[more]
SMESG000018614.14.534e-2344.14SMESG000018614.1[more]
SMESG000075717.12.501e-2138.05SMESG000075717.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026569 ID=SMED30026569|Name=Small ArfGAP 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1311bp
TTTACATTTAACATACATTTTTAAGTTAAATAATTCAACAGTATAATAAT
TTTAAATAAAAATTTCGGGGCCATCACTTTATTTTATAATTGTTTTTTAA
TTCCAATCGTAATGACTTCAAAAATTAATAAAAGTCATTTAATTTTGTTG
AAAATTATAGAAAAAGAAGGAAATAAGAATTGTGCTGATTGTGGTACTGA
AGGAACTAGATGGGCTTCGTGGAATTTTGGAATATTTTTATGCATTAGGT
GTGCAGGAATACACCGGAATTTAGGTGTTCATATTTCTAAGGTTAAATCA
GTTGATTTAGATAGTTGGACTGGAGAACAGTTACAGGTAATGGAATTGAT
GGGTAACAGGAAATCCCACGAAATTTATGAAGCAGCGTTGCCAGGAAATT
TTACTCGACCTCAGACTAATTATGCCATTGAAGAATTTATAAGATCTAAA
TATCAGTATAAAAGATATTGCATTTCTCCGCCTAAATCCGATTCCAGTCC
CACTACGGAGGATAATGATAAATGTAAATCAAATATAGCAAAGTTGAAAA
AACCAGCTTCAGTAGAGTCTGAAAGTGATAAGACATCAACGCCCATGCAA
GAGTCAGATGACTCCTTGGGGGATCCAGATTATTTGATAGATTTAAAAGA
AAAACCAACGAAGGCATGCCATAAAGTATATTCAGAAGGTGACTTGATTA
ATTTCAACAGCAATTCAAAAACTAAATCTTGTAATAATGATTTATTTGAT
ACGAATAACAAATCCAAAATATTATCCTTGTATGATAAGCCTAATTCAAT
TGGAGGATATCAGTCAAGCATGCTACCGATGTCAAATTCATCATATCAAA
AAAGTTATGGATCGTCAATTGATGGGCAATACCATTCTACAACCAGTATT
CCAGCCTCTAATCAGAATTCATATTTGAAGCAGATTCAGGAGAAATTAAG
CACAATTAAAGACAATTTGACATCAAAGTTCAAGTCATATGAACAGCCAG
GCGTTTTGCCACATCAGTCAGGAAATATGTTCAGTTCAGCAAATCGGAAT
GTTCCAAATTCTAAGGGTAATCAGAACGGCGGAGAAACTTTGTCTCCGGA
TTTATGGAGGTGATTGAGAACCAAACTAACTATCGGCAATAAATTGGTTT
ATTTGCGTGTTTATTCCATATTTCCGATAATATTTCCGTTTTGTTTGAGG
GATTCGATTGTGATTGATTCGATATTATTATTATTATTATTACGTCATTG
TGTTTATTATTATCATTAGTGTTGTGTAATAGAATTTGTGGTGGTAATAA
ATGCTCCTGGT
back to top

protein sequence of SMED30026569-orf-1

>SMED30026569-orf-1 ID=SMED30026569-orf-1|Name=SMED30026569-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=334bp
MTSKINKSHLILLKIIEKEGNKNCADCGTEGTRWASWNFGIFLCIRCAGI
HRNLGVHISKVKSVDLDSWTGEQLQVMELMGNRKSHEIYEAALPGNFTRP
QTNYAIEEFIRSKYQYKRYCISPPKSDSSPTTEDNDKCKSNIAKLKKPAS
VESESDKTSTPMQESDDSLGDPDYLIDLKEKPTKACHKVYSEGDLINFNS
NSKTKSCNNDLFDTNNKSKILSLYDKPNSIGGYQSSMLPMSNSSYQKSYG
SSIDGQYHSTTSIPASNQNSYLKQIQEKLSTIKDNLTSKFKSYEQPGVLP
HQSGNMFSSANRNVPNSKGNQNGGETLSPDLWR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR038508ArfGAP_dom_sf
IPR037278ARFGAP/RecO
IPR001164ArfGAP_dom
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
GO:0005515protein binding
GO:0030276clathrin binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0043547positive regulation of GTPase activity
GO:0045648positive regulation of erythrocyte differentiation
GO:2000369regulation of clathrin-dependent endocytosis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001164Arf GTPase activating proteinPRINTSPR00405REVINTRACTNGcoord: 40..57
score: 61.49
coord: 21..40
score: 42.41
coord: 61..82
score: 41.85
IPR001164Arf GTPase activating proteinSMARTSM00105arf_gap_3coord: 7..127
e-value: 5.1E-41
score: 152.3
IPR001164Arf GTPase activating proteinPFAMPF01412ArfGapcoord: 13..120
e-value: 1.5E-38
score: 131.4
IPR001164Arf GTPase activating proteinPROSITEPS50115ARFGAPcoord: 7..128
score: 27.035
IPR038508ArfGAP domain superfamilyGENE3DG3DSA:3.30.40.160coord: 1..124
e-value: 8.1E-49
score: 166.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 309..333
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 130..153
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 309..327
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 125..170
NoneNo IPR availablePANTHERPTHR45705FAMILY NOT NAMEDcoord: 6..322
NoneNo IPR availableCDDcd08839ArfGap_SMAPcoord: 12..114
e-value: 2.12678E-63
score: 194.412
IPR037278ARFGAP/RecO-like zinc fingerSUPERFAMILYSSF57863ArfGap/RecO-like zinc fingercoord: 11..122