Ubiquitin carboxyl-terminal hydrolase family protein

Overview
NameUbiquitin carboxyl-terminal hydrolase family protein
Smed IDSMED30026564
Length (bp)2241
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin carboxyl-terminal hydrolase family protein (SMED30026564) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase family protein (SMED30026564) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin carboxyl-terminal hydrolase family protein (SMED30026564) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase family protein (SMED30026564) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Celegans
Match: usp-3 (Ubiquitinyl hydrolase 1 [Source:UniProtKB/TrEMBL;Acc:Q9GRV2])

HSP 1 Score: 51.2174 bits (121), Expect = 2.603e-6
Identity = 58/244 (23.77%), Postives = 104/244 (42.62%), Query Frame = 1
Query:  628 KPPSLSNIGANCYLNSAFQGISSCNKF------LSDL-----DTLRQKYGSRVEKLAVFYQLIDILNGGKS----------KSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKN--IQEWLKKELPMRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPLTGSS-NLQELVNMFFNRDRIEDYD-CETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKI 1284
            +P  + N+G  C++N+  Q ++S ++F      LS L     D    K G     L   Y+ + I    +S          +   IS  P F+ +    Q DS E + + M+ ++ ++RK  +  G    K+  I ++ +  L   +I Q   +C  K   ++    DL+L +      S   L + ++ FF  + +E  +  E   C  K        I  LP+ LC+H+++   NG K + I
Sbjct:  227 RPRGMRNVGNTCFMNAVLQALASISEFREYIMSLSSLEDYIHDEKEPKNGGNYCYLTDEYRKLLISQSARSFREPTAPNEFREAFISVCPRFRGFR---QHDSHEFMRYFMDSLHTEMRKCRKLPGMPDDKHTPISKYFEGTLQSSVICQTCRNCSNKIDEFM----DLSLDIPAQRNASKVRLSDCLSTFFKLEMLEKGEKPECAKCKTKQTCSKQMFIRKLPQVLCLHMKRFRDNGGKNDAI 463          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Fly
Match: Usp8 (gene:FBgn0038862 transcript:FBtr0084016)

HSP 1 Score: 50.0618 bits (118), Expect = 7.523e-6
Identity = 64/278 (23.02%), Postives = 124/278 (44.60%), Query Frame = 1
Query:  508 TIVNEKTTTGVGDEVSEPHTHSKNQTSTRPP--SNILEKKVVKP-PSLSNIGANCYLNSAFQGISSC---------NKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGG----KSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRK-YLESEGEIPKKNIQEWL---KKELPMRIIIQYE--------IHCHCKSIIYVPLQSDLALHVTIPLTGSSNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTF 1257
            TI   K      D   +P   +  +TS R    S ++ + V +    L N+G  CY+NS  Q +S+          +K+ + +    +  G  +E++A    + ++ NG      S+ L        K +    QQDS E L  +M+ +++D++  ++  + E+   + + WL   K +  M + + Y         + CH +S  Y    S+L+L +  P +    L + ++M+F+ +RI  ++C +  C  K        I+ LP  L +HL++ +
Sbjct:  518 TIAPNKAEIPTFDRAMKPQPRNVERTSQRVRDFSPVIGQNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYISRSNKTNGQVIEEVAAL--IKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLHSDLQTLHVPRQREMISASEKAWLEFTKAKESMILHLFYGQMKSTVKCVACHKESATYESF-SNLSLELP-PNSNVCQLNQCMDMYFSGERIHGWNCPS--CKTKRDAIKKLDISKLPPVLVVHLKRFY 789          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Zebrafish
Match: usp37 (ubiquitin specific peptidase 37 [Source:NCBI gene;Acc:768201])

HSP 1 Score: 51.6026 bits (122), Expect = 3.368e-6
Identity = 64/254 (25.20%), Postives = 115/254 (45.28%), Query Frame = 1
Query:  628 KPP--SLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYG-SRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPG----------QQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEW-------LKKEL--------PMRIIIQYEIH--CHCKSIIYVPLQ----SDLALHV-----TIPLTGSSNLQELVNMFFNRDRIEDYDCETEGCDGKSA---FRYTRLIAPLPRTLCIHLQKTFWN 1263
            +PP    SN+G  CY+N+  Q + S   F +DL  L+Q     RV   A+  +   +L        E+ ++ + +  N             Q D+ E L+  ++Q+  D+ K  +S    P      W       L  E+        P+ + +++E+     CKS   V L+    +DL++ +     T+P+    ++Q+ +++FF  + IE Y CE   C GK+A    +++R    LPR L +HL++  +N
Sbjct:  318 QPPLQGFSNLGNTCYMNAILQSLFSLPSFSNDL--LKQGIPWKRVPINALLRRFAHLLAKKDISPPEVKKDLLRRVKNAISSTAERFSGYMQNDAHEFLSQCLDQLKEDVEKINKSWKNEPSA----WDEPQSTRLADEVDTSRIYTCPVTVNMEFEVQHTITCKSCGEVVLKREQFNDLSIDLPRRRKTLPM---RSIQDSLDLFFRMEEIE-YSCEK--CSGKAATVSHKFSR----LPRVLILHLKRYSYN 555          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Zebrafish
Match: usp37 (ubiquitin specific peptidase 37 [Source:NCBI gene;Acc:768201])

HSP 1 Score: 51.6026 bits (122), Expect = 3.420e-6
Identity = 64/254 (25.20%), Postives = 115/254 (45.28%), Query Frame = 1
Query:  628 KPP--SLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYG-SRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPG----------QQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEW-------LKKEL--------PMRIIIQYEIH--CHCKSIIYVPLQ----SDLALHV-----TIPLTGSSNLQELVNMFFNRDRIEDYDCETEGCDGKSA---FRYTRLIAPLPRTLCIHLQKTFWN 1263
            +PP    SN+G  CY+N+  Q + S   F +DL  L+Q     RV   A+  +   +L        E+ ++ + +  N             Q D+ E L+  ++Q+  D+ K  +S    P      W       L  E+        P+ + +++E+     CKS   V L+    +DL++ +     T+P+    ++Q+ +++FF  + IE Y CE   C GK+A    +++R    LPR L +HL++  +N
Sbjct:  318 QPPLQGFSNLGNTCYMNAILQSLFSLPSFSNDL--LKQGIPWKRVPINALLRRFAHLLAKKDISPPEVKKDLLRRVKNAISSTAERFSGYMQNDAHEFLSQCLDQLKEDVEKINKSWKNEPSA----WDEPQSTRLADEVDTSRIYTCPVTVNMEFEVQHTITCKSCGEVVLKREQFNDLSIDLPRRRKTLPM---RSIQDSLDLFFRMEEIE-YSCEK--CSGKAATVSHKFSR----LPRVLILHLKRYSYN 555          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. UniProt/SwissProt
Match: sp|Q9FPS0|UBP27_ARATH (Ubiquitin carboxyl-terminal hydrolase 27 OS=Arabidopsis thaliana OX=3702 GN=UBP27 PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.889e-8
Identity = 75/317 (23.66%), Postives = 118/317 (37.22%), Query Frame = 1
Query:  634 PSLSNIGANCYLNSAFQGISSCNKFLSDL-----DTLRQKYGSRVEKLAVFYQLIDIL----NGGKSKSLEISRNPIF------KNWNKPGQQDSFELLAHVMNQVYNDI---------------------RKYLESEGEIPKKNIQEWLKK-ELPMRIIIQYEIHCH-CKSIIYVPLQ-------SDLALHVTIPLTGSSNLQELVNMFFNRDRIEDYDC------------------ETE-----------GCDGKSAFRYTRL--------------IAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNI 1320
            P L N+G NC+LN   Q ++SC  F S L     D      G + E+L + + L  +L      G  +S+   R  +       KN+N   QQD+ E L H+++ +  +I                     R    SEG      ++ W K    P   I+   + C  C S I +  Q       S L  H    +     L+  +  F N +++E+Y C                  ETE            CD K++    R+              IA  P+ LCI +Q+  +N ++  K++  I F   LN+
Sbjct:   74 PGLQNLGNNCFLNVILQALASCKDFRSFLQWVLEDARGSLAGEQEEQLPLTFALSALLQELGTVGSRRSVSNPRKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEIVVCYRPSQSSNLSDILFSRNLRMLAPSEGLHGLMELKRWHKHLRGPFDGILGSTLMCRTCSSQISLEFQFFHTLPLSPLLHHGGYNIMSGCTLEHCLKKFLNTEKVENYFCYRCWHGAALKYLSVIGAAETEIEKLRSCGGEDQCDCKTSLHLQRMPWSNSYSHILKQLIIARFPKLLCIQVQRASFNMFEEFKLSGHIAFPLVLNL 390          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. TrEMBL
Match: A0A443SW69 (USP domain-containing protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_12724 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 7.102e-7
Identity = 63/243 (25.93%), Postives = 109/243 (44.86%), Query Frame = 1
Query:  631 PPSLSNIGANCYLNSAFQGISSCNKFLSDLD----------------------TLRQKYGSRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEWLKKELPMRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPL-TGSSNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITK 1290
            P  L N+G  CY+NS  Q +   + F+S+L                        L  +Y  + +  +     I + +  + KS    +N  FK++    QQD+ E L  ++N +  +  K +    E P   IQ++   E+    I++    C C++   +P  ++ AL+++IP  T +  LQ+ +  + N +R E + C TE CD    +RYT  I  LP  L + L +   NG K  +I +
Sbjct:  129 PLPLKNLGNTCYMNSIIQSLFVLDCFMSELTDYYETSHDSMTFDAVNMTNALICLYSEYIKQKKLTSAMETEIVVKHLSQLKSCVGEKNSQFKSF---MQQDAAEFLDLILNSLKEEFIKNIAIASENP---IQKFF--EIEFDSILRC---CKCETDSQLPSVTNSALYLSIPENTDNFTLQDALRNYLNEERTE-HKCNTEDCDSNEKYRYTT-IKKLPVVLFVQLGRYSDNGEKRHEIVE 358          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. TrEMBL
Match: A0A067RGY8 (Ubiquitin carboxyl-terminal hydrolase 30 OS=Zootermopsis nevadensis OX=136037 GN=L798_15182 PE=3 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 7.306e-7
Identity = 58/263 (22.05%), Postives = 112/263 (42.59%), Query Frame = 1
Query:  613 EKKVVKPPSLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWN------KPGQQDSFELLAHVMNQVYNDIRKYL-----------ESEGEIPKKNIQE----------W----LKKELPMRIIIQYEIHCH-CKSIIYVPLQSDLALHVTIP----LTGSSN----LQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEK 1281
            +K+  K   L N+G  C+LN+  Q ++SC   L D  +  Q   ++   +A     + +LNG +      + + + ++ +       PG+QD+ EL   ++  +  ++++ L           +   EI +  +Q           W    LK  LP + +   ++ C  CK    V   +  +L + +P    + G+ +    LQEL+  +     + D  C+  GC   +  +       LPR LCIH+ +T W G  +++
Sbjct:   33 QKRRGKVLGLVNLGYTCFLNTLLQALASCPVVL-DWLSKHQNSANKKSFIAALQNTLQVLNGKEGSEDPYTPSKLIQSLHGHGWIISPGEQDAHELFLVIVTTLEEEVQQKLPKVCSLSAAVEDGLREIQQHGLQATLLSPKPSSWWQEAKLKGPLPFQGLFASQLQCMSCKYKSAVHYATFYSLSLVLPPRLSVLGTMDEFYTLQELIGHYVTSRVVNDVTCDGCGCRDTAQVKSLNF-GKLPRCLCIHIARTIWEGEPLKR 293          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. TrEMBL
Match: A0A5J5B3T8 (USP domain-containing protein OS=Nyssa sinensis OX=561372 GN=F0562_027015 PE=3 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 8.227e-7
Identity = 63/274 (22.99%), Postives = 122/274 (44.53%), Query Frame = 1
Query:  601 SNILEKKVVKPPSLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRV--EKLAVFYQLI---DILNG---GKSKSLEISR-------NPIFKNW---------NKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEWLKKELPMRIIIQYEIHCHCKSI---IYVPLQSDLALHVTIPLTGSSNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNIQSKFLIS 1341
             +++  + + P  L N G  C+LN+  Q + SC+ F+  L  LR +   +V    L+ F + +   D+ +G    K   LE  R         + +N+          +P Q+D+ E L+ VM+Q+++++   L+ EG++   N    L+    +  I   +I    K+        +Q  L LH+ I     + + + + +F   + +E+Y     G  G    R +  I  LP+ + +HL +  +  +   K+ K + F  EL +  + L+S
Sbjct:  181 GSVIASRDLLPRGLINPGNLCFLNATLQALLSCSPFVWLLQGLRIRNIPKVGYPTLSAFAEFVSDFDMPSGESLKKKDVLETGRPFKPAMFEGVLRNFTPDVPNSISGRPRQEDAQEFLSFVMHQLHDEL---LKLEGKVSSLNGNTKLR-SFRISAIFGGQIRSVVKARGNKASATVQPFLLLHLDISHEAVNTIDDALRLFSAPETLEEYRTSAIGKAGVVTARKSVNIQTLPKIMILHLMRFSYGSHGSTKLHKPVHFPLELVLGRELLVS 450          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. TrEMBL
Match: A0A4D8ZJG3 (Ubiquitin carboxyl-terminal hydrolase OS=Salvia splendens OX=180675 GN=USP10 PE=3 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.489e-6
Identity = 70/310 (22.58%), Postives = 129/310 (41.61%), Query Frame = 1
Query:  565 THSKNQTSTRPPSNILEKKVVKPPSLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQ----KYG-SRVEKLAVFYQLIDILNGG---KSKSLEISRNPIFK---------------NW---NKPGQQDSFELLAHVMNQVYNDIRK-----YLESEGE--IPKKNIQEW---LKKELPMRIIIQYEIHCHCKSIIYVPLQSDLA---------------LHVTIPLTGSSNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNIQSKFLIS 1341
            TH K ++  +  +++L+ + + P  L N G  C+LN+  Q + +C  F+  L  L++    K G   +   A F    D++ G    K  S+EI     F                +W    +P Q+D+ E L+ VM+Q+++++ K     +L    +  + K   +EW    +K     I  Q        SI    LQS +                LH+ I       +++ + +    + +++Y     G  G  A R +  I  LP+ + +HL++  +  Y   K+ K + F  EL++    L+S
Sbjct:  155 THDK-ESRLKMDASVLDAQGITPRGLINPGNLCFLNATLQALLACFPFVQLLLQLKELNIPKVGYPTLNAFAEFIGEFDVVGGANIKKKDSIEIEAGRPFNPTMFEVVLRKFTPDVSWSTSGRPRQEDAQEFLSFVMDQIHDELLKLGGKSHLNGRNQTLVSKSEDEEWETVGQKNKSAVIRRQSFFPSELSSIFGGELQSTVKAKGNRPSATVEPFFLLHLDISGEVIRTIEDALRLLSTPETLDEYRASRAGKVGVVAARKSINIQTLPKIMILHLKRFSYGSYGSTKLHKDVHFPPELSLSRDLLVS 463          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Cavefish
Match: usp37 (ubiquitin specific peptidase 37 [Source:NCBI gene;Acc:103026056])

HSP 1 Score: 56.9954 bits (136), Expect = 6.400e-8
Identity = 64/249 (25.70%), Postives = 113/249 (45.38%), Query Frame = 1
Query:  625 VKPP--SLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYG-SRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPG----------QQDSFELLAHVMNQVYNDIRK-----------YLESEG----EIPKKNIQEWLKKELPMRIIIQYEIHCH-CKSIIYVPLQ-SDLALHV-----TIPLTGSSNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNG 1266
             +PP    SN+G  CY+N+  Q + S   F +DL  L+Q     RV   A+  +   +L      S E+ ++ + +  N             Q D+ E L+  ++Q+  D+ K           + E++G    E P  +        + M   +Q+ I C  C  ++    Q +DL++ +     T+PL    ++Q+ +++FF  + IE Y CE   C+GK+A   T   + LPR L +HL++  +N 
Sbjct:  317 AQPPLQGFSNLGNTCYMNAILQSLFSLPSFSNDL--LKQGIPWKRVPINALLRRFAHLLAKKDISSPEVKKDLLRRVKNAISSTAERFSGYMQNDAHEFLSQCLDQLKEDVEKVNKSCKSEPFAWEETQGTRLTEEPDTSRIYTCPVTVNMEFEVQHTITCKSCGEVVTKREQFNDLSIDLPRRKKTLPL---RSIQDSLDLFFRMEEIE-YSCEK--CNGKTAT-VTHKFSRLPRVLILHLKRYSYNA 556          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Cavefish
Match: usp37 (ubiquitin specific peptidase 37 [Source:NCBI gene;Acc:103026056])

HSP 1 Score: 56.9954 bits (136), Expect = 6.400e-8
Identity = 64/249 (25.70%), Postives = 113/249 (45.38%), Query Frame = 1
Query:  625 VKPP--SLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYG-SRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPG----------QQDSFELLAHVMNQVYNDIRK-----------YLESEG----EIPKKNIQEWLKKELPMRIIIQYEIHCH-CKSIIYVPLQ-SDLALHV-----TIPLTGSSNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNG 1266
             +PP    SN+G  CY+N+  Q + S   F +DL  L+Q     RV   A+  +   +L      S E+ ++ + +  N             Q D+ E L+  ++Q+  D+ K           + E++G    E P  +        + M   +Q+ I C  C  ++    Q +DL++ +     T+PL    ++Q+ +++FF  + IE Y CE   C+GK+A   T   + LPR L +HL++  +N 
Sbjct:  317 AQPPLQGFSNLGNTCYMNAILQSLFSLPSFSNDL--LKQGIPWKRVPINALLRRFAHLLAKKDISSPEVKKDLLRRVKNAISSTAERFSGYMQNDAHEFLSQCLDQLKEDVEKVNKSCKSEPFAWEETQGTRLTEEPDTSRIYTCPVTVNMEFEVQHTITCKSCGEVVTKREQFNDLSIDLPRRKKTLPL---RSIQDSLDLFFRMEEIE-YSCEK--CNGKTAT-VTHKFSRLPRVLILHLKRYSYNA 556          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000898.1 (pep scaffold:Pmarinus_7.0:GL482053:22454:36085:-1 gene:ENSPMAG00000000806.1 transcript:ENSPMAT00000000898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 8.529e-6
Identity = 55/233 (23.61%), Postives = 107/233 (45.92%), Query Frame = 1
Query:  637 SLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKY-------GSRVEKLAVFYQLIDILNGGKSKSL----EISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKY-----LE-SEGEIPKKNIQEWLKKELP--------MRIIIQYEIHCH-CKSIIYVPLQ-SDLALHVTIPLTGSS-NLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQK 1251
              SN+G  CY+N+  Q + + + F SD+  LRQ          S + +LA      D+      K L    + + +   + ++   Q D+ E L+  ++Q+  D+ +      LE  +GE PK + Q     ++P        M   + + I C  C  ++    Q +DL++ +    + ++ ++Q+ +++F    R ED +   E C+ ++A    + I  LPR L +HL++
Sbjct:  339 GFSNLGNTCYMNAILQSLFALHSFTSDM--LRQGIPWNRVPPNSLLRRLAHLLSKKDVCTMDYKKELLKRVKTAISASAERFSGYAQNDAHEFLSQCLDQLKEDVERLNKKWRLEPGQGESPKPS-QTDSASDMPYTCPVAANMEFEVLHTITCRVCGEVVKKKEQFNDLSIDLPRKKSDTAWSIQDSLDLFL---RAEDVEYACEKCESRNATVTHKFIK-LPRVLILHLKR 564          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Nematostella
Match: EDO44586 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7RVJ3])

HSP 1 Score: 59.6918 bits (143), Expect = 2.283e-9
Identity = 65/273 (23.81%), Postives = 124/273 (45.42%), Query Frame = 1
Query:  637 SLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLID--ILNGGKSKSLE-------ISRNPIFK-----NWNKPG-QQDSFE---LLAHVMNQVYNDIRKYLE----SEGEIPKKNI--------------QEWLKKELPMRIIIQYEIHC-HCKSIIYVPLQSDLALHVTIPLT--GSSNLQELVNMFFNRDRIEDYDCETEGCDG-----KSAFRYTRLIAPLPRTLCIHLQKTFWNGYKME-KITKKIKFSRELNI 1320
             L N+G  C++NS  QG++S   F+S  D    ++  R E+L     L+   I+   K  ++E       +S  PI +      W  P  QQD+FE   +L+  + +   ++   L+    +  E  K  +              +  +KK +P R ++  ++ C  C+    V      ++ +++P+T     +L++L+  F   + ++  +C+  G  G     KS+F     +  LP+ LCIH+++T+W+   M  KI   ++F   LN+
Sbjct:   11 GLYNLGNTCFMNSVLQGLASIASFVSWTD----EFTWRKEQLNQDGNLLGEAIVELMKELNIEWNEDDAVLSAGPIIQALQHHGWVIPSNQQDAFEFFQVLSSTLEEELGELSAILDFSSITSVEKSKGGLDGSVRHRISRVSYGRRCVKKHVPFRGLLASQLVCKECRFKCPVKFDGFDSISLSLPMTLQVGLSLEDLLQKFVCSESVDSVECKGCGNLGSENTNKSSFIKRLTVGKLPQCLCIHVKRTYWHNNGMPYKINTFVRFGEYLNL 279          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Planmine SMEST
Match: SMESG000039999.1 (SMESG000039999.1)

HSP 1 Score: 863.988 bits (2231), Expect = 0.000e+0
Identity = 517/544 (95.04%), Postives = 523/544 (96.14%), Query Frame = 1
Query:  607 ILEKKVVKPPSLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEWLKKELPMRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPLTGS---------------SNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNIQSKFLISHDTLQNSITKANEDXXXXXXXXXXXXXXXXXXXXXXXDEILNXXXXXXXXVDAKCSENLEKIQLTEKSLISEDGINFDVQKTELXXXXXXXXXXXXXXXNKNQLDENHSISERKIILDTENDLSDDSANSDVDKINMQKLFVSNKSTEIGRRDFIPQXXXXXXXXXXXXXXXXXPAGLINISSCSENVSDFHQENGCFPLQSDIQGPVLNTFSNDTRIERIDSETENYLLTSXXXXXXXXXXXXXXXXRYSNGQWYMTNDSSIYPVHEQDVLNSEAYILFYEKS 2193
            +++  +VKPPSL NIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNG KSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEWLKKELPMRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPLTGS               SNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNIQSKFLISHDTLQNSITKANEDKLKLESSKENKESSESKCNESNLDEILNDKDK TKKVDAKCSENLEKIQLTEKSLISEDGINFDVQKTELSEREEVIIDDEESSENKNQLDENHSISERKIILDTENDLSDDSANSDVDKINMQKLFVSNKSTEIGRRDFIPQNNSVNNVDNSINSNSNIPAGLINISSCSENVSDFHQENGCFPLQSDIQGPVLNTFSNDTRIERIDSETENYLLTSVIVHYGGVYGGHYVCYRYSNGQWYMTNDSS+YPV E+DVLNSEAYILFYEKS
Sbjct:   10 LIKYNIVKPPSLLNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGEKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEWLKKELPMRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPLTGSRNYNCDFSYIFIILGSNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNIQSKFLISHDTLQNSITKANEDKLKLESSKENKESSESKCNESNLDEILNDKDKNTKKVDAKCSENLEKIQLTEKSLISEDGINFDVQKTELSEREEVIIDDEESSENKNQLDENHSISERKIILDTENDLSDDSANSDVDKINMQKLFVSNKSTEIGRRDFIPQNNSVNNVDNSINSNSNIPAGLINISSCSENVSDFHQENGCFPLQSDIQGPVLNTFSNDTRIERIDSETENYLLTSVIVHYGGVYGGHYVCYRYSNGQWYMTNDSSVYPVREEDVLNSEAYILFYEKS 553          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Planmine SMEST
Match: SMESG000040007.1 (SMESG000040007.1)

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 497/608 (81.74%), Postives = 509/608 (83.72%), Query Frame = 1
Query:   91 MSFSIWAFFLSLFRWIERVFRCITSGCCSRNENDLGDSFHDKNDENELLAPENTSIETSIPLQIGPDSSSLENNQFDNLADENETPNLKEIEFQNQDTSSSLTVKPCNLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIVNEKTTTGVGDEVSEPHTHSKNQTSTRPPSNILE-----------------------------------------------------KKVVKPPSLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEWLKKELPMRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPLTGS---------------SNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNIQSKFLISHDTLQNSITKANEDXXXXXXXXXXXXXXXXXXXXXXXDEILNXXXXXXXXVDAKCSENLEKIQLTEKSLISEDGINFDVQKTELXXXXXXX---XXXXXXXXNKNQLDENHSISERKIILDTE 1701
            MS SIWAFFLSL  WI RVFRCITSGCCSRNENDLGDSFHDKNDENELLAPENTSIETSIPLQIGPDSSSLENNQFDNLADENETPNLKEIEFQNQDTSSSLTVKPCNLDSTKLGKSGKRKKKNQNHKKNNKKKSKTLSTIVNEKTTTGVGDEVSEPHTHSKNQTSTRPPSNILE                                                     KKVVKPPSLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEWLKKELPMRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPLTGS               SNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNIQSKFLISHDTLQNSITKANEDKLKLESSKENKESSESKCNESNLDEIL DKDKT  KVDAKCSENLEK QLTEK+L +E  I  DVQ++E SE+E V     ++   +  KNQL++  SISE +I  D +
Sbjct:    1 MSCSIWAFFLSLLCWIGRVFRCITSGCCSRNENDLGDSFHDKNDENELLAPENTSIETSIPLQIGPDSSSLENNQFDNLADENETPNLKEIEFQNQDTSSSLTVKPCNLDSTKLGKSGKRKKKNQNHKKNNKKKSKTLSTIVNEKTTTGVGDEVSEPHTHSKNQTSTRPPSNILENNKKNSKDFSPILSNEKLTTGVGDEVVVSGKNNKNQTSKQHFSSTKPQTKILEKKVVKPPSLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEWLKKELPMRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPLTGSRNYNCDFSYIFIILGSNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNIQSKFLISHDTLQNSITKANEDKLKLESSKENKESSESKCNESNLDEILKDKDKTATKVDAKCSENLEKNQLTEKTLNTEKEIKSDVQESESSEKEGVKIIPNEETPDNLEKNQLNKKPSISESEIKSDVQ 608          

HSP 2 Score: 188.734 bits (478), Expect = 2.496e-49
Identity = 108/110 (98.18%), Postives = 108/110 (98.18%), Query Frame = 1
Query: 1864 PAGLINISSCSENVSDFHQENGCFPLQSDIQGPVLNTFSNDTRIERIDSETENYLLTSXXXXXXXXXXXXXXXXRYSNGQWYMTNDSSIYPVHEQDVLNSEAYILFYEKS 2193
            PA  INISSCSENVSDFHQENGCFPLQSDIQGPVLNTFSNDTRIERIDSETENYLLTSVIVHYGGVYGGHYVCYRYSNGQWYMTNDSSIYPVHEQDVLNSEAYILFYEKS
Sbjct: 1750 PAN-INISSCSENVSDFHQENGCFPLQSDIQGPVLNTFSNDTRIERIDSETENYLLTSVIVHYGGVYGGHYVCYRYSNGQWYMTNDSSIYPVHEQDVLNSEAYILFYEKS 1858          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Planmine SMEST
Match: SMESG000040007.1 (SMESG000040007.1)

HSP 1 Score: 426.402 bits (1095), Expect = 1.146e-144
Identity = 232/342 (67.84%), Postives = 235/342 (68.71%), Query Frame = 1
Query:   91 MSFSIWAFFLSLFRWIERVFRCITSGCCSRNENDLGDSFHDKNDENELLAPENTSIETSIPLQIGPDSSSLENNQFDNLADENETPNLKEIEFQNQDTSSSLTVKPCNLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIVNEKTTTGVGDEVSEPHTHSKNQTSTRPPSNILE-----------------------------------------------------KKVVKPPSLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKK 957
            MS SIWAFFLSL  WI RVFRCITSGCCSRNENDLGDSFHDKNDENELLAPENTSIETSIPLQIGPDSSSLENNQFDNLADENE          N+  S +L+                                    TIVNEKTTTGVGDEVSEPHTHSKNQTSTRPPSNILE                                                     KKVVKPPSLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIP K
Sbjct:    1 MSCSIWAFFLSLLCWIGRVFRCITSGCCSRNENDLGDSFHDKNDENELLAPENTSIETSIPLQIGPDSSSLENNQFDNLADENE---------NNKKKSKTLS------------------------------------TIVNEKTTTGVGDEVSEPHTHSKNQTSTRPPSNILENNKKNSKDFSPILSNEKLTTGVGDEVVVSGKNNKNQTSKQHFSSTKPQTKILEKKVVKPPSLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPVK 297          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Planmine SMEST
Match: SMESG000040010.1 (SMESG000040010.1)

HSP 1 Score: 270.396 bits (690), Expect = 5.275e-83
Identity = 128/252 (50.79%), Postives = 179/252 (71.03%), Query Frame = 1
Query:  619 KVVKPPSLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEWLKKELPMRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPLTGSSNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNIQSKFLISHDTLQNSITKA 1374
            K V PPSL+NIGANCYLNSA Q ISSC KF  D+  L  KY   ++KL +F+ L+ +LN G   ++EISRN IF++WNK GQQDSFELLA+V+NQVYN+IR + E      K +I  WL+  LPM+++IQY I C C +II +PL SDLALH+++P  G+  L+  ++  F  D I +Y C+T+ C G +A + T+L+ PLP+TLCIHLQK++WNGY+M+KI  +I FS EL I+S++  + D + + + K+
Sbjct:   50 KKVSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKD-LDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSE-----VKNDISGWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKS 295          
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Planmine SMEST
Match: SMESG000040010.1 (SMESG000040010.1)

HSP 1 Score: 270.011 bits (689), Expect = 7.824e-83
Identity = 128/252 (50.79%), Postives = 179/252 (71.03%), Query Frame = 1
Query:  619 KVVKPPSLSNIGANCYLNSAFQGISSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGGKSKSLEISRNPIFKNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEWLKKELPMRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPLTGSSNLQELVNMFFNRDRIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITKKIKFSRELNIQSKFLISHDTLQNSITKA 1374
            K V PPSL+NIGANCYLNSA Q ISSC KF  D+  L  KY   ++KL +F+ L+ +LN G   ++EISRN IF++WNK GQQDSFELLA+V+NQVYN+IR + E      K +I  WL+  LPM+++IQY I C C +II +PL SDLALH+++P  G+  L+  ++  F  D I +Y C+T+ C G +A + T+L+ PLP+TLCIHLQK++WNGY+M+KI  +I FS EL I+S++  + D + + + K+
Sbjct:   52 KKVSPPSLANIGANCYLNSALQSISSCEKFKEDIKRLHSKYKD-LDKLTLFHNLMIVLNNGSKNAIEISRNNIFRHWNKSGQQDSFELLAYVINQVYNEIRNHSE-----VKNDISGWLRIRLPMKLLIQYSIKCSCGTIISIPLHSDLALHISVPRNGNETLERCLDQHFTDDIILNYICDTKSCAGLNALKMTKLLRPLPQTLCIHLQKSYWNGYQMKKINNRINFSAELIIKSEYCHTIDEIDSELLKS 297          
The following BLAST results are available for this feature:
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
usp-32.603e-623.77Ubiquitinyl hydrolase 1 [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Usp87.523e-623.02gene:FBgn0038862 transcript:FBtr0084016[more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
usp373.368e-625.20ubiquitin specific peptidase 37 [Source:NCBI gene;... [more]
usp373.420e-625.20ubiquitin specific peptidase 37 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q9FPS0|UBP27_ARATH1.889e-823.66Ubiquitin carboxyl-terminal hydrolase 27 OS=Arabid... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 4
Match NameE-valueIdentityDescription
A0A443SW697.102e-725.93USP domain-containing protein OS=Leptotrombidium d... [more]
A0A067RGY87.306e-722.05Ubiquitin carboxyl-terminal hydrolase 30 OS=Zooter... [more]
A0A5J5B3T88.227e-722.99USP domain-containing protein OS=Nyssa sinensis OX... [more]
A0A4D8ZJG31.489e-622.58Ubiquitin carboxyl-terminal hydrolase OS=Salvia sp... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
usp376.400e-825.70ubiquitin specific peptidase 37 [Source:NCBI gene;... [more]
usp376.400e-825.70ubiquitin specific peptidase 37 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000898.18.529e-623.61pep scaffold:Pmarinus_7.0:GL482053:22454:36085:-1 ... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO445862.283e-923.81Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase family protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039999.10.000e+095.04SMESG000039999.1[more]
SMESG000040007.12.496e-4981.74SMESG000040007.1[more]
SMESG000040007.11.146e-14467.84SMESG000040007.1[more]
SMESG000040010.15.275e-8350.79SMESG000040010.1[more]
SMESG000040010.17.824e-8350.79SMESG000040010.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026564 ID=SMED30026564|Name=Ubiquitin carboxyl-terminal hydrolase family protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2241bp
AAATTCTTAGAATATTAAAACATTTTTAGTGTAATTATTTCAATTATCAA
AGTACAAAATTTTAATAAGCGAGTTAAGTTTTATTTGTCAATGAGTTTTT
CAATTTGGGCTTTTTTCCTATCATTATTCCGCTGGATAGAAAGAGTATTC
CGGTGTATAACATCAGGTTGTTGTTCGAGAAATGAAAACGACCTAGGCGA
TTCTTTTCATGATAAAAATGATGAAAATGAGTTGTTGGCCCCAGAAAACA
CAAGCATAGAGACCAGCATACCTTTACAAATTGGACCCGATTCCTCTTCA
CTAGAAAATAACCAATTTGATAACTTAGCTGACGAAAATGAAACTCCAAA
TCTAAAGGAGATTGAATTTCAAAATCAAGATACTTCTAGTTCTTTAACCG
TTAAACCTTGCAATCTAGATTCTACAAAGTTAGGGAAGTCAGGAAAACGC
AAGAAGAAAAATCAAAATCACAAAAAAAATAATAAGAAAAAGTCAAAAAC
TTTGTCAACAATCGTGAACGAGAAAACTACAACAGGAGTTGGTGATGAAG
TAAGTGAACCACACACACATAGTAAAAATCAGACCTCAACAAGACCTCCA
TCTAATATACTTGAAAAAAAAGTTGTAAAGCCGCCATCGTTATCGAATAT
TGGAGCTAACTGTTATTTGAATTCTGCTTTTCAAGGAATTTCATCTTGCA
ATAAATTTTTATCTGACCTGGATACACTGCGTCAAAAATATGGTTCTCGT
GTGGAGAAATTAGCTGTATTTTATCAATTAATTGATATTTTGAATGGCGG
AAAATCTAAATCATTGGAAATATCACGAAATCCTATATTCAAAAATTGGA
ACAAACCTGGACAGCAAGATAGTTTTGAATTATTAGCTCATGTTATGAAT
CAAGTATATAATGATATAAGGAAATATCTCGAGAGTGAAGGAGAAATTCC
AAAGAAAAACATTCAAGAGTGGTTAAAGAAAGAATTGCCAATGAGAATAA
TAATTCAATATGAAATACATTGTCATTGTAAAAGCATAATCTATGTCCCA
TTGCAGTCGGATCTAGCTCTACATGTGACAATTCCGTTAACAGGCAGCAG
TAATTTACAAGAACTAGTAAATATGTTTTTCAATCGAGATAGAATAGAAG
ATTACGATTGTGAAACGGAAGGCTGTGATGGTAAATCAGCGTTTAGATAC
ACTCGACTGATAGCGCCTTTGCCAAGGACTTTATGTATTCATTTACAAAA
AACATTTTGGAATGGGTATAAAATGGAAAAAATCACGAAAAAAATAAAAT
TTAGTCGTGAGCTAAATATTCAATCGAAATTTTTAATAAGCCATGATACT
CTTCAAAATTCCATCACTAAGGCAAATGAGGATAAGTTGAAATTAGAATC
AAGCAAGGAAAACAAGGAATCTTCGGAAAGCAAATGTAATGAGAGTAATC
TTGATGAAATATTAAATGACAAGGATAAAACCACTAAAAAAGTCGATGCA
AAATGTTCAGAAAACCTTGAAAAAATTCAATTGACTGAGAAGTCTTTAAT
TTCAGAGGACGGAATAAATTTTGATGTTCAGAAAACAGAATTGTCGGAGA
GAGAAGAAGTGATTATTGATGACGAAGAATCTTCAGAAAACAAAAATCAA
TTGGATGAAAATCATTCGATTTCAGAACGAAAAATTATTTTGGACACGGA
AAATGATTTGAGTGACGACTCTGCAAATAGTGATGTTGATAAAATAAATA
TGCAAAAGTTATTTGTTAGCAATAAATCTACAGAAATCGGAAGACGTGAT
TTTATTCCTCAAAATAATTCCGTCAATAACGTGGATAATTCTATAAATTC
TAATTCTAATATTCCAGCTGGGCTAATTAATATTTCTAGTTGCAGTGAAA
ACGTTTCAGATTTTCATCAAGAAAATGGATGTTTTCCCTTGCAATCTGAT
ATTCAAGGGCCTGTATTGAACACATTCAGTAACGACACCCGAATTGAACG
TATCGACAGTGAGACTGAGAACTATTTATTGACATCTGTTATTGTGCACT
ATGGAGGTGTTTACGGGGGCCACTACGTCTGTTATAGATACTCAAACGGC
CAATGGTACATGACCAACGATTCCTCCATTTACCCAGTCCATGAACAAGA
TGTTTTAAATTCTGAAGCTTACATTTTGTTCTATGAGAAATCCTAAATTC
GGACTCTTGATAATTATTTTTAATAAAAGAATAAATTAAAT
back to top

protein sequence of SMED30026564-orf-1

>SMED30026564-orf-1 ID=SMED30026564-orf-1|Name=SMED30026564-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=702bp
MSFSIWAFFLSLFRWIERVFRCITSGCCSRNENDLGDSFHDKNDENELLA
PENTSIETSIPLQIGPDSSSLENNQFDNLADENETPNLKEIEFQNQDTSS
SLTVKPCNLDSTKLGKSGKRKKKNQNHKKNNKKKSKTLSTIVNEKTTTGV
GDEVSEPHTHSKNQTSTRPPSNILEKKVVKPPSLSNIGANCYLNSAFQGI
SSCNKFLSDLDTLRQKYGSRVEKLAVFYQLIDILNGGKSKSLEISRNPIF
KNWNKPGQQDSFELLAHVMNQVYNDIRKYLESEGEIPKKNIQEWLKKELP
MRIIIQYEIHCHCKSIIYVPLQSDLALHVTIPLTGSSNLQELVNMFFNRD
RIEDYDCETEGCDGKSAFRYTRLIAPLPRTLCIHLQKTFWNGYKMEKITK
KIKFSRELNIQSKFLISHDTLQNSITKANEDKLKLESSKENKESSESKCN
ESNLDEILNDKDKTTKKVDAKCSENLEKIQLTEKSLISEDGINFDVQKTE
LSEREEVIIDDEESSENKNQLDENHSISERKIILDTENDLSDDSANSDVD
KINMQKLFVSNKSTEIGRRDFIPQNNSVNNVDNSINSNSNIPAGLINISS
CSENVSDFHQENGCFPLQSDIQGPVLNTFSNDTRIERIDSETENYLLTSV
IVHYGGVYGGHYVCYRYSNGQWYMTNDSSIYPVHEQDVLNSEAYILFYEK
S*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001394Peptidase_C19_UCH
IPR018200USP_CS
IPR028889USP_dom
Vocabulary: molecular function
TermDefinition
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0016787hydrolase activity
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
Vocabulary: biological process
TermDefinition
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
GO:0006508proteolysis
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane