SMED30026560

Overview
NameSMED30026560
Smed IDSMED30026560
Length (bp)2531
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30026560 (SMED30026560) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30026560 (SMED30026560) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30026560 (SMED30026560) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30026560 (SMED30026560) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026560

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026560SMESG000037542.1 SmedASXL_015112SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026560SMESG000037542.1 SmedASXL_015112SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30026560SMESG000037542.1 dd_Smed_v4_6734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026560SMESG000037542.1 dd_Smed_v4_6734_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026560SMESG000037542.1 Contig49655uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026560SMESG000037542.1 Contig49655newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30026560SMESG000037542.1 dd_Smed_v6_6734_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30026560SMESG000037542.1 dd_Smed_v4_6734_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026560SMESG000037542.1 SMED_00734_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30026560SMESG000037542.1 SMED_00734_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30026560SMESG000037542.1 SmWIOct06_040386GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30026560SMESG000037542.1 SmWIOct06_036167GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30026560 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.007263:9832..13778 -12369
Homology
BLAST of SMED30026560 vs. Ensembl Human
Match: MCM3 (minichromosome maintenance complex component 3 [Source:HGNC Symbol;Acc:HGNC:6945])

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 408/813 (50.18%), Postives = 554/813 (68.14%), Query Frame = -3
Query:   61 ITDQESYQAESAYLNFLDSEIK---YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKF---AVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIF---------------------------KEVLKKSKKRTKPLNESDSDGEETNGIIEDMATTSIRSNKKQRTAEHAXXXXXXXXXXXXXXINNFKISVSRTFQDARVDFMDLNTLIVALQQIHPD-VNAAGITALLRKLDADSKIMMTDNEVYII 2391
            + D E  +A+  YL+FLD E     YQ +++ LI     RLI+++NDLR     R  +LL   F E+++ Q ALK  +A+I+  YA  YEEF+VG EGSFGS+ ++PRT+TS +L  +VC+EGIVTK S+++ K+V SVHYCPATKK +ER Y+DLT+L     + + YPTKDE  N LETEYGLS YKD QTIT+QEMPE APAGQLPRS++VILD+DLVD  K GDR+ V G YRC+PGKKGG+T+  FRT+LIA NV  ++K++  +F   D  KI+  +K   KDI D L +S+APSI GH+++K+A+LC LLGGVER L NG+ IRGDINIL++GDPSVAKSQ+LR+VL C   RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGIHARLNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLFI++DQ D   DREI++ V RMH+YR PG++DG+A+ L +   I    +   S ++ + T   +I+EK +       +K  +  +  F++KYIH A+ ++P L++E++  + ++Y  LRSQ+  MS++ +     RT PVTART+ETLIRLATAHAKAR  K V  +DAE A +LV YA F                           +E  ++ +KR K       DG+  +          +      +TA+  + +     ++ +  +  FK+++   F++A    + +N L  ++ +   +  ++  I A L K+  D+++M+++  +++I
Sbjct:   52 LDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLV-AFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLAKSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYVL-CTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQDT---QIYEKHDNLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQD-SMSSDTA-----RTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI 853          
BLAST of SMED30026560 vs. Ensembl Human
Match: MCM3 (minichromosome maintenance complex component 3 [Source:HGNC Symbol;Acc:HGNC:6945])

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 408/813 (50.18%), Postives = 554/813 (68.14%), Query Frame = -3
Query:   61 ITDQESYQAESAYLNFLDSEIK---YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKF---AVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIF---------------------------KEVLKKSKKRTKPLNESDSDGEETNGIIEDMATTSIRSNKKQRTAEHAXXXXXXXXXXXXXXINNFKISVSRTFQDARVDFMDLNTLIVALQQIHPD-VNAAGITALLRKLDADSKIMMTDNEVYII 2391
            + D E  +A+  YL+FLD E     YQ +++ LI     RLI+++NDLR     R  +LL   F E+++ Q ALK  +A+I+  YA  YEEF+VG EGSFGS+ ++PRT+TS +L  +VC+EGIVTK S+++ K+V SVHYCPATKK +ER Y+DLT+L     + + YPTKDE  N LETEYGLS YKD QTIT+QEMPE APAGQLPRS++VILD+DLVD  K GDR+ V G YRC+PGKKGG+T+  FRT+LIA NV  ++K++  +F   D  KI+  +K   KDI D L +S+APSI GH+++K+A+LC LLGGVER L NG+ IRGDINIL++GDPSVAKSQ+LR+VL C   RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGIHARLNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLFI++DQ D   DREI++ V RMH+YR PG++DG+A+ L +   I    +   S ++ + T   +I+EK +       +K  +  +  F++KYIH A+ ++P L++E++  + ++Y  LRSQ+  MS++ +     RT PVTART+ETLIRLATAHAKAR  K V  +DAE A +LV YA F                           +E  ++ +KR K       DG+  +          +      +TA+  + +     ++ +  +  FK+++   F++A    + +N L  ++ +   +  ++  I A L K+  D+++M+++  +++I
Sbjct:    7 LDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVA-FPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLAKSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYVL-CTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQDT---QIYEKHDNLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQD-SMSSDTA-----RTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI 808          
BLAST of SMED30026560 vs. Ensembl Human
Match: MCM3 (minichromosome maintenance complex component 3 [Source:HGNC Symbol;Acc:HGNC:6945])

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 387/756 (51.19%), Postives = 523/756 (69.18%), Query Frame = -3
Query:   61 KLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKF---AVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIF---------------------------KEVLKKSKKRTKPLNESDSDGEETNGIIEDMATTSIRSNKKQRTAEHAXXXXXXXXXXXXXXINNFKISVSRTFQDARVDFMDLNTLIVALQQIHPD-VNAAGITALLRKLDADSKIMMTDNEVYII 2229
            +LL   F E+++ Q ALK  +A+I+  YA  YEEF+VG EGSFGS+ ++PRT+TS +L  +VC+EGIVTK S+++ K+V SVHYCPATKK +ER Y+DLT+L     + + YPTKDE  N LETEYGLS YKD QTIT+QEMPE APAGQLPRS++VILD+DLVD  K GDR+ V G YRC+PGKKGG+T+  FRT+LIA NV  ++K++  +F   D  KI+  +K   KDI D L +S+APSI GH+++K+A+LC LLGGVER L NG+ IRGDINIL++GDPSVAKSQ+LR+VL C   RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGIHARLNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLFI++DQ D   DREI++ V RMH+YR PG++DG+A+ L +   I    +   S ++ + T   +I+EK +       +K  +  +  F++KYIH A+ ++P L++E++  + ++Y  LRSQ+  MS++ +     RT PVTART+ETLIRLATAHAKAR  K V  +DAE A +LV YA F                           +E  ++ +KR K       DG+  +          +      +TA+  + +     ++ +  +  FK+++   F++A    + +N L  ++ +   +  ++  I A L K+  D+++M+++  +++I
Sbjct:   74 RLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLV-AFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLAKSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYVL-CTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQDT---QIYEKHDNLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQD-SMSSDTA-----RTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI 818          
BLAST of SMED30026560 vs. Ensembl Human
Match: MCM3 (minichromosome maintenance complex component 3 [Source:HGNC Symbol;Acc:HGNC:6945])

HSP 1 Score: 697.582 bits (1799), Expect = 0.000e+0
Identity = 387/756 (51.19%), Postives = 523/756 (69.18%), Query Frame = -3
Query:   61 KLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKF---AVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIF---------------------------KEVLKKSKKRTKPLNESDSDGEETNGIIEDMATTSIRSNKKQRTAEHAXXXXXXXXXXXXXXINNFKISVSRTFQDARVDFMDLNTLIVALQQIHPD-VNAAGITALLRKLDADSKIMMTDNEVYII 2229
            +LL   F E+++ Q ALK  +A+I+  YA  YEEF+VG EGSFGS+ ++PRT+TS +L  +VC+EGIVTK S+++ K+V SVHYCPATKK +ER Y+DLT+L     + + YPTKDE  N LETEYGLS YKD QTIT+QEMPE APAGQLPRS++VILD+DLVD  K GDR+ V G YRC+PGKKGG+T+  FRT+LIA NV  ++K++  +F   D  KI+  +K   KDI D L +S+APSI GH+++K+A+LC LLGGVER L NG+ IRGDINIL++GDPSVAKSQ+LR+VL C   RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGIHARLNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLFI++DQ D   DREI++ V RMH+YR PG++DG+A+ L +   I    +   S ++ + T   +I+EK +       +K  +  +  F++KYIH A+ ++P L++E++  + ++Y  LRSQ+  MS++ +     RT PVTART+ETLIRLATAHAKAR  K V  +DAE A +LV YA F                           +E  ++ +KR K       DG+  +          +      +TA+  + +     ++ +  +  FK+++   F++A    + +N L  ++ +   +  ++  I A L K+  D+++M+++  +++I
Sbjct:   18 RLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLV-AFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLAKSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYVL-CTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQDT---QIYEKHDNLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQD-SMSSDTA-----RTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI 762          
BLAST of SMED30026560 vs. Ensembl Human
Match: MCM2 (minichromosome maintenance complex component 2 [Source:HGNC Symbol;Acc:HGNC:6944])

HSP 1 Score: 295.819 bits (756), Expect = 2.164e-86
Identity = 196/543 (36.10%), Postives = 283/543 (52.12%), Query Frame = -3
Query:  466 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTA----VFRTILIANNVYSI-NKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAA 2079
            R++   +L  ++   G+VT  + +  ++    + C      L  +     S N  +  G+  P     G   E     + Y+++Q I +QE P    AG+LPRS + IL  DLVD CK GD I + G Y       G   TA    VF T+++AN+V    NK +       D   I  ++K + I + +  SIAPSI GHE IKR +   L GG  +      ++RGDIN+L+ GDP  AKSQ L+++ + +  RAI TTG+G S VGLTA V     S E  LEAGA+VLADRG+  IDEFDKM+D DRT+IHE MEQ  ++ISKAGI   L ARC+V+AAANP+ GRYD   T  EN+ L + ++SRFD+L ++ D  D V D  +A FV   H    P  K+ E L+               +   ++P          N + VE   Q   K+++   I+A  ++ PKL++   + + + Y DLR + +             + P+T R +E++IR+A AHA+   R  V   D   A
Sbjct:  295 RSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPF---CQSQNQEVKPGSC-PECQSAGP-FEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN--NYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVS-SRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLA---------------NGSAAEPA-------MPNTYGVEPLPQEVLKKYI---IYAKERVHPKLNQMDQDKVAKMYSDLRKESMATG----------SIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMA 794          
BLAST of SMED30026560 vs. Ensembl Celegans
Match: mcm-3 (DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q9XVR7])

HSP 1 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 353/682 (51.76%), Postives = 473/682 (69.35%), Query Frame = -3
Query:  337 YLNFLDSE---IKYQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTK-TDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLK-----KSKKRTKPLNESDSDGEETNGIIEDMATT 2355
            YLNFLD++     Y+ +I  ++  G  RL+++L+++R    +R E LL  +  E+  LQ AL+  I N +   A     F VGFEG+FG R + PRT+ S YLGN+VC EGIVTK S ++ K++ SVHYCPAT K LE+ + D T L+   +    YPT+DE  N LETE+G S YKD QT T+QE+PE+APAGQLPR+++ + D DL D  K GDR+ + G +R +P K+ G ++  FR+I+I N++  ++K     FE  D   +R ++K ++  +LL RS+APSICGHE  K+A+LC LLGG+E+IL NG+R+RGDIN+L++GDPSVAKSQ+LR+VL+ A  RAI TTGRG+SGVGLTAAV TD +SGER LEAGAMVLADRG+VCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHA+LNARCSVLAAANPVYGRY+ FK+PMENIG+QDSLLSRFDL+F+++D+ D   D  +AE V ++H YR  G+ DG  L +         G E +S    +  K +  I+E++ ++A  +  +  T  F+ KYIH AR +QPKL+ EA+  + + Y D+RS ++  ++ E      RT PVTAR +ETLIRL+TA AKARF K V  +D E A +L+ +A FKE  K     + KKR   ++  D + +  N   EDMAT+
Sbjct:   25 YLNFLDNQADTFHYRQKIVKMMNDGESRLVMNLDEIREILPERAEGLLTQSVLEMNCLQSALQMAI-NRSDVQAVVKTGFHVGFEGTFGERHVNPRTLKSSYLGNLVCCEGIVTKCSTVRQKLLTSVHYCPATNKVLEKKFADFTMLD-TAVTNNNYPTEDENKNPLETEFGHSVYKDHQTFTIQELPESAPAGQLPRAVDCVADLDLADRVKPGDRVRIIGVFRVLPNKQNGVSSGSFRSIIIINHIQMLSKEVIPNFEPQDVKDVRKISKSRNPFELLARSLAPSICGHEETKKALLCLLLGGMEKILNNGSRLRGDINVLLIGDPSVAKSQLLRYVLRMA-PRAITTTGRGSSGVGLTAAVTTDPDSGERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHAKLNARCSVLAAANPVYGRYNPFKSPMENIGMQDSLLSRFDLIFVLLDEHDADKDANVAEHVLKLHTYRTQGEADGTVLPMGG-------GVETISTINMETKKASSSIYEENTQWAGIQDTKILTMDFMRKYIHLARSVQPKLTDEATEYISEVYADIRSFDITKTDQE------RTMPVTARQLETLIRLSTAIAKARFSKKVEREDTEKAYNLLHFACFKEKPKARQEYEKKKRAPRIDGDDDEDQSDN---EDMATS 687          
BLAST of SMED30026560 vs. Ensembl Celegans
Match: mcm-5 (DNA replication licensing factor mcm-5 [Source:UniProtKB/Swiss-Prot;Acc:Q21902])

HSP 1 Score: 288.886 bits (738), Expect = 1.919e-85
Identity = 188/560 (33.57%), Postives = 295/560 (52.68%), Query Frame = -3
Query:  457 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGA-----AYPTKDEVGNILETEYGLSTYK----DFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQY--RCMPGKKGG------FTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAAR-QLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQ-PVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADL 2079
            R + S  +  +V I GI+   + ++SK       C   K  +        S+ P L   A     A P + ++       Y +   K    D+QT+ +QE PE+ P G++PR +++  +  L D    G+R+ + G Y  + +  KKGG        T   R + I        + + TTF   +    + +A++KD  +L+ +SIAPSI G   IK+++ C L GG  + L +G   RGDIN+L+LGDP  AKSQ+L+FV Q +    + T+G+G+S  GLTA+V+ D +S    +E GAMVLAD G+VCIDEFDKM + DR AIHE MEQ  ++I+KAGI   LN+RCSVLAAAN VYGR+D+ +   +NI    ++LSRFD+++I+ D  D + D  +A+ V  +H            ++     + D  G  + +  +S    T  +F+            + T +FL+K++  AR    P+L+ +AS  L   Y  +R+  V     +SG   + +  P+T R +E ++R+A + AK   ++  + K  E A  L
Sbjct:  138 RQVKSAQVSQVVKISGIIVAAAQVRSKATKVTLQCRQCKHTIPD-----VSIKPGLEGFALPRTCAAPQQGQMQRCPIDPYIMLPDKCECVDYQTLKLQENPEDVPHGEMPRHLQLFTERYLTDKVVPGNRVTIVGVYSIKKLIQKKGGDKSLQGIRTPYLRVLGIHMETSGPGRTNFTTFTPEEERMFKTLAQRKDAYELIAKSIAPSIYGSADIKKSIACLLFGGARKKLPDGITRRGDINVLLLGDPGTAKSQLLKFVEQVS-PIGVYTSGKGSSAAGLTASVIRDPQSRSFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVYGRWDESRGD-DNIDFMPTILSRFDMIYIVKDTHDVLKDATLAKHVIEVH------------VNASAAKERDIAGVPKTATTDSDGVMT--MFDTDG---------FLTIEFLKKFVTYARLNCGPRLTPQASEKLVNHYVKMRNPVVNADAFKSGKKAHNSAIPITVRQLEAIVRIAESIAKMELQQFATDKHVEEALRL 667          
BLAST of SMED30026560 vs. Ensembl Celegans
Match: mcm-5 (DNA replication licensing factor mcm-5 [Source:UniProtKB/Swiss-Prot;Acc:Q21902])

HSP 1 Score: 288.886 bits (738), Expect = 1.919e-85
Identity = 188/560 (33.57%), Postives = 295/560 (52.68%), Query Frame = -3
Query:  457 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGA-----AYPTKDEVGNILETEYGLSTYK----DFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQY--RCMPGKKGG------FTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAAR-QLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQ-PVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADL 2079
            R + S  +  +V I GI+   + ++SK       C   K  +        S+ P L   A     A P + ++       Y +   K    D+QT+ +QE PE+ P G++PR +++  +  L D    G+R+ + G Y  + +  KKGG        T   R + I        + + TTF   +    + +A++KD  +L+ +SIAPSI G   IK+++ C L GG  + L +G   RGDIN+L+LGDP  AKSQ+L+FV Q +    + T+G+G+S  GLTA+V+ D +S    +E GAMVLAD G+VCIDEFDKM + DR AIHE MEQ  ++I+KAGI   LN+RCSVLAAAN VYGR+D+ +   +NI    ++LSRFD+++I+ D  D + D  +A+ V  +H            ++     + D  G  + +  +S    T  +F+            + T +FL+K++  AR    P+L+ +AS  L   Y  +R+  V     +SG   + +  P+T R +E ++R+A + AK   ++  + K  E A  L
Sbjct:  138 RQVKSAQVSQVVKISGIIVAAAQVRSKATKVTLQCRQCKHTIPD-----VSIKPGLEGFALPRTCAAPQQGQMQRCPIDPYIMLPDKCECVDYQTLKLQENPEDVPHGEMPRHLQLFTERYLTDKVVPGNRVTIVGVYSIKKLIQKKGGDKSLQGIRTPYLRVLGIHMETSGPGRTNFTTFTPEEERMFKTLAQRKDAYELIAKSIAPSIYGSADIKKSIACLLFGGARKKLPDGITRRGDINVLLLGDPGTAKSQLLKFVEQVS-PIGVYTSGKGSSAAGLTASVIRDPQSRSFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVYGRWDESRGD-DNIDFMPTILSRFDMIYIVKDTHDVLKDATLAKHVIEVH------------VNASAAKERDIAGVPKTATTDSDGVMT--MFDTDG---------FLTIEFLKKFVTYARLNCGPRLTPQASEKLVNHYVKMRNPVVNADAFKSGKKAHNSAIPITVRQLEAIVRIAESIAKMELQQFATDKHVEEALRL 667          
BLAST of SMED30026560 vs. Ensembl Celegans
Match: mcm-2 (DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6])

HSP 1 Score: 289.271 bits (739), Expect = 1.476e-84
Identity = 182/465 (39.14%), Postives = 257/465 (55.27%), Query Frame = -3
Query:  466 STYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQY-RCMPGK---KGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQ-LQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAA 1845
            + Y ++Q IT+QE P    AG+LPRS +VIL  DL D CK GD I V G Y     G    K GF   VF T++ AN++ + +K ++      D   IR++++  +I   +  SIAPSI GH+ +KRA+   L  G  +      R+RGDIN+L+ GDP  AKSQ LR+    A  R++ TTG+G S VGLTA V     + E  LEAGAMVLAD+G+  IDEFDKMSD DRT+IHE MEQ  ++ISKAGI   L+ARC+V+AA+NP+ GRY+  +T  EN+ L + +LSRFD+L +I D  D V D  +A+FV   H+   P  K           +I   G+E          + D++ E++         +   +  L KYI  AR+   P L  + S      +  +R + +             +  +T R +E++IRL+ AHAK   R  V+ +D  AA
Sbjct:  344 TVYHNYQRITMQESPNKVAAGRLPRSKDVILLGDLCDSCKPGDEIEVTGVYTNNFDGSLNYKQGF--PVFNTLIHANHITNKDKMASDQLTDEDIKAIRELSQDPNISQRVFSSIAPSIYGHDDVKRAIALALFRGEAKNPGAKHRLRGDINVLLCGDPGTAKSQFLRYAAHIA-PRSVLTTGQGASAVGLTAYVQRHPVTREWTLEAGAMVLADKGVCLIDEFDKMSDQDRTSIHEAMEQQSISISKAGIVTSLHARCTVIAASNPIGGRYNPTRTFAENVDLTEPILSRFDVLCVIRDSVDSVEDERLAKFVVGNHRTHHPDAK-----------KIVKEGDE---------LEEDQMDERTGV-------RLIPQDLLRKYIIYAREKCHPTLPEQHSEKFSNIFAQMRKESMATG----------SVAITVRHVESMIRLSEAHAKLHLRSYVNDEDCAAA 768          
BLAST of SMED30026560 vs. Ensembl Celegans
Match: mcm-2 (DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6])

HSP 1 Score: 289.271 bits (739), Expect = 1.476e-84
Identity = 182/465 (39.14%), Postives = 257/465 (55.27%), Query Frame = -3
Query:  466 STYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQY-RCMPGK---KGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQ-LQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAA 1845
            + Y ++Q IT+QE P    AG+LPRS +VIL  DL D CK GD I V G Y     G    K GF   VF T++ AN++ + +K ++      D   IR++++  +I   +  SIAPSI GH+ +KRA+   L  G  +      R+RGDIN+L+ GDP  AKSQ LR+    A  R++ TTG+G S VGLTA V     + E  LEAGAMVLAD+G+  IDEFDKMSD DRT+IHE MEQ  ++ISKAGI   L+ARC+V+AA+NP+ GRY+  +T  EN+ L + +LSRFD+L +I D  D V D  +A+FV   H+   P  K           +I   G+E          + D++ E++         +   +  L KYI  AR+   P L  + S      +  +R + +             +  +T R +E++IRL+ AHAK   R  V+ +D  AA
Sbjct:  344 TVYHNYQRITMQESPNKVAAGRLPRSKDVILLGDLCDSCKPGDEIEVTGVYTNNFDGSLNYKQGF--PVFNTLIHANHITNKDKMASDQLTDEDIKAIRELSQDPNISQRVFSSIAPSIYGHDDVKRAIALALFRGEAKNPGAKHRLRGDINVLLCGDPGTAKSQFLRYAAHIA-PRSVLTTGQGASAVGLTAYVQRHPVTREWTLEAGAMVLADKGVCLIDEFDKMSDQDRTSIHEAMEQQSISISKAGIVTSLHARCTVIAASNPIGGRYNPTRTFAENVDLTEPILSRFDVLCVIRDSVDSVEDERLAKFVVGNHRTHHPDAK-----------KIVKEGDE---------LEEDQMDERTGV-------RLIPQDLLRKYIIYAREKCHPTLPEQHSEKFSNIFAQMRKESMATG----------SVAITVRHVESMIRLSEAHAKLHLRSYVNDEDCAAA 768          
BLAST of SMED30026560 vs. Ensembl Fly
Match: Mcm3 (gene:FBgn0284442 transcript:FBtr0070762)

HSP 1 Score: 729.554 bits (1882), Expect = 0.000e+0
Identity = 383/671 (57.08%), Postives = 498/671 (74.22%), Query Frame = -3
Query:  361 YLNFLDSEIK---YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTT--NQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQE-VEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPLNESDSDGEETNG 2355
            Y++FLD E     Y   +K +I +  +RLI+++NDL+     R   LL     E ++   ALK+  + ++P YA  +E+ FVGFEG FG+R +TPR++TS YLGNMVC+EGIVTKVS+++ K+V SVHYCP T+K +ER YTDLTS    + +GAAYPTKDE GN+LETEYGLS YKD QT+T+QEMPE APAGQLPRS++++ D+DLVD CK GDR+ + G YRC+PGK+GG+T+  FRT+L+ANN+  ++K S       D +  + +AK  DI +LL++S+APSI GH ++K+A+LC LLGGVE+IL NGTR+RGDIN+L++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHA LNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLF+++D  D  VD+ I++ V RMH+YR P + DGE LS+ ++  + + +V + E   D     K D +    ++   ++H +  + +F+ KYIH A+ ++PKL  +A   +  +Y  LRSQE VE        +  RTQP+TART+ETLIRL+TAHA+AR  K V+  DA AA +LV +A FK+VL K +   +  N S SD E+ NG
Sbjct:   16 YVDFLDDEEDQGIYAGHVKDMIAEKSKRLIVNVNDLKRKNPQRALGLLSNAADEQLAFGRALKEYASTVDPGYAKMHEDLFVGFEGCFGNRHVTPRSLTSIYLGNMVCVEGIVTKVSLIRPKVVRSVHYCPNTRKVMERKYTDLTSFEA-VPSGAAYPTKDEDGNLLETEYGLSVYKDHQTLTIQEMPEKAPAGQLPRSVDIVCDDDLVDRCKPGDRVQIVGSYRCLPGKRGGYTSGTFRTVLLANNISLLSKESNLDISREDIMLCKKLAKNNDIFELLSKSLAPSIHGHAYVKQAILCLLLGGVEKILPNGTRLRGDINVLLIGDPSVAKSQLLRYVLNTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHASLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFVMLDVIDSDVDQMISDHVVRMHRYRNPKEADGEPLSMGSSYADSLSFVSSSEEKKDTEVYEKYDALLHGKSR---QRHEKILSVEFMRKYIHIAKCMKPKLGEQACEAIANEYSRLRSQEAVE-------TDVARTQPITARTLETLIRLSTAHARARMSKSVTIDDAHAAIELVQFAYFKKVLDKDRPSKRRRN-SGSDAEDDNG 673          
BLAST of SMED30026560 vs. Ensembl Fly
Match: Mcm3 (gene:FBgn0284442 transcript:FBtr0340476)

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 384/675 (56.89%), Postives = 500/675 (74.07%), Query Frame = -3
Query:  361 YLNFLDSEIK---YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTT--NQIDYVGNEELSDDESKPTKTDEIFEKSNKF----AVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQE-VEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPLNESDSDGEETNG 2355
            Y++FLD E     Y   +K +I +  +RLI+++NDL+     R   LL     E ++   ALK+  + ++P YA  +E+ FVGFEG FG+R +TPR++TS YLGNMVC+EGIVTKVS+++ K+V SVHYCP T+K +ER YTDLTS    + +GAAYPTKDE GN+LETEYGLS YKD QT+T+QEMPE APAGQLPRS++++ D+DLVD CK GDR+ + G YRC+PGK+GG+T+  FRT+L+ANN+  ++K S       D +  + +AK  DI +LL++S+APSI GH ++K+A+LC LLGGVE+IL NGTR+RGDIN+L++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHA LNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLF+++D  D  VD+ I++ V RMH+YR P + DGE LS+ ++  + + +V + E         K  E++EK +      + ++H +  + +F+ KYIH A+ ++PKL  +A   +  +Y  LRSQE VE        +  RTQP+TART+ETLIRL+TAHA+AR  K V+  DA AA +LV +A FK+VL K +   +  N S SD E+ NG
Sbjct:   16 YVDFLDDEEDQGIYAGHVKDMIAEKSKRLIVNVNDLKRKNPQRALGLLSNAADEQLAFGRALKEYASTVDPGYAKMHEDLFVGFEGCFGNRHVTPRSLTSIYLGNMVCVEGIVTKVSLIRPKVVRSVHYCPNTRKVMERKYTDLTSFEA-VPSGAAYPTKDEDGNLLETEYGLSVYKDHQTLTIQEMPEKAPAGQLPRSVDIVCDDDLVDRCKPGDRVQIVGSYRCLPGKRGGYTSGTFRTVLLANNISLLSKESNLDISREDIMLCKKLAKNNDIFELLSKSLAPSIHGHAYVKQAILCLLLGGVEKILPNGTRLRGDINVLLIGDPSVAKSQLLRYVLNTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHASLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFVMLDVIDSDVDQMISDHVVRMHRYRNPKEADGEPLSMGSSYADSLSFVSSSE--------EKDTEVYEKYDALLHGKSRQRHEKILSVEFMRKYIHIAKCMKPKLGEQACEAIANEYSRLRSQEAVE-------TDVARTQPITARTLETLIRLSTAHARARMSKSVTIDDAHAAIELVQFAYFKKVLDKDRPSKRRRN-SGSDAEDDNG 672          
BLAST of SMED30026560 vs. Ensembl Fly
Match: Mcm2 (gene:FBgn0014861 transcript:FBtr0081827)

HSP 1 Score: 288.115 bits (736), Expect = 5.186e-84
Identity = 176/463 (38.01%), Postives = 258/463 (55.72%), Query Frame = -3
Query:  466 YKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTT----AVFRTILIANNVY-SINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAA 1839
            Y+++Q IT+QE P   PAG++PRS +VIL  DL D CK GD + V G Y       G   T     VF T++IAN+V    +K    +    D   I+ ++K   I++ +  S+APSI GH++IKRA+   L GG  +      ++RGDIN+L+ GDP  AKSQ L++  + A  RA+ TTG+G S VGLTA V  +  S E  LEAGA+VLAD+G+  IDEFDKM+D DRT+IHE MEQ  ++ISKAGI   L ARC+V+AAANP+ GRYD   T  EN+ L + +LSRFD+L ++ D+ D + D+++A+FV   H    P +++   L       +D +  + L                              +Q++   ++A   ++PKL+    + + + Y  LR         ES A    + P+T R +E++IR++ AHA+   R+ V   D   A
Sbjct:  355 YRNYQKITLQESPGRIPAGRIPRSKDVILLADLCDQCKPGDELEVTGIY--TNNYDGSLNTDQGFPVFATVIIANHVVVKDSKQVVQSLTDEDIATIQKLSKDPRIVERVVASMAPSIYGHDYIKRALALALFGGESKNPGEKHKVRGDINLLICGDPGTAKSQFLKYTEKVA-PRAVFTTGQGASAVGLTAYVRRNPVSREWTLEAGALVLADQGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSMTFSENVNLSEPILSRFDVLCVVKDEFDPMQDQQLAKFVVHSHMKHHPSEEEQPELEEPQLKTVDEIPQDLL------------------------------RQYI---VYAKENIRPKLTNIDEDKIAKMYAQLR--------QESFATG--SLPITVRHIESVIRMSEAHARMHLRENVMEADVSMA 771          
BLAST of SMED30026560 vs. Ensembl Fly
Match: Mcm6 (gene:FBgn0025815 transcript:FBtr0070952)

HSP 1 Score: 275.789 bits (704), Expect = 4.949e-80
Identity = 187/596 (31.38%), Postives = 295/596 (49.50%), Query Frame = -3
Query:  436 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQY--------------------RCMPG---------KKGGFTTAVFRTILIANNVYSINKNSATTFEGSD-------------------FVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFK 2079
            R +T+  +G ++ I G V +   +  ++V  V  C   +  +          NP +        +     +L+ E  L  + DFQ I +QE     P G +PR++E+IL ++LV+  ++GDR    G                      R  PG         K  G     +R   +A +V +    +   F G+D                   + KI +M+K +++   L  S+ PSI G++ +KR +L Q  GGV +     T +RGDIN+ ++GDPS AKSQ L+ V   +  RAI T+G+ +S  GLTAAVV D+ES +  +EAGA++LAD GI CIDEFDKM   D+ AIHE MEQ  ++I++AG+ A LNAR S+LAAANP+ GRYD+ K+  +NI L   ++SRFDL FI++D+ +EVVD  IA  +  +H                                    +  +E  E++           +T++ + +Y+  ARQ +P +S+EA ++L + Y  LR ++       SG + +R   +T R +E++IRL+ A AK      V  +  + A  L++ +I +
Sbjct:  118 RDLTTSKIGTLIRISGQVVRTHPVHPELVSGVFMCLDCQTEIRNVEQQFKFTNPTICRNPVCSNRKRF--MLDVEKSL--FLDFQKIRIQETQAELPRGCIPRAVEIILRSELVETVQAGDRYDFTGTLIVVPDVSVLAGVGTRAENSSRHKPGEGMDGVTGLKALGMRELNYRMAFLACSVQA----TTARFGGTDLPMSEVTAEDMKKQMTDAEWHKIYEMSKDRNLYQNLISSLFPSIYGNDEVKRGILLQQFGGVAKTTTEKTSLRGDINVCIVGDPSTAKSQFLKQVSDFS-PRAIYTSGKASSAAGLTAAVVRDEESFDFVIEAGALMLADNGICCIDEFDKMDQRDQVAIHEAMEQQTISIARAGVRATLNARTSILAAANPINGRYDRSKSLQQNIQLSAPIMSRFDLFFILVDECNEVVDYAIARKIVDLH------------------------------------SNIEESVERA-----------YTREEVLRYVTFARQFKPVISQEAGHMLVENYGHLRQRD----TGTSGRSTWR---ITVRQLESMIRLSEAMAKLECSNRVLERHVKEAFRLLNKSIIR 650          
BLAST of SMED30026560 vs. Ensembl Fly
Match: Mcm5 (gene:FBgn0017577 transcript:FBtr0082279)

HSP 1 Score: 273.478 bits (698), Expect = 8.153e-80
Identity = 190/576 (32.99%), Postives = 282/576 (48.96%), Query Frame = -3
Query:  418 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTY---------KDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCM----PGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKI--------RDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAAR-QLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKS 2079
            R + S+ +  +V I GI+   S + +K       C +    +         +NP L  G A P K         +  L  +          DFQT+ +QE+P+  P G++PR +++  D  L +    G+R+ + G Y       P ++ G   AV         V  I  +S      S +  I        R MA   DI + L++S+APSI G   IK+A+ C L GG  + L +G   RGDIN+L+LGDP  AKSQ+L+FV + A   A+ T+G+G+S  GLTA+V+ D ++    +E GAMVLAD G+VCIDEFDKM + DR AIHE MEQ  ++I+KAGI   LN+RCSVLAAAN ++GR+D  K   ENI    ++LSRFD++FI+ D  DE  D  +A+ +  +H                            LS ++S P++  E             G+     F +KYIH  R    P+LS  A   L  +Y  +RS        E  ++K  + P+T R +E +IR++ + AK R +   + +    A  L   +     +  S
Sbjct:  133 RQLKSDCVSKLVKIAGIIVAASGISAKATRMSIQCLSCSTVIPNL-----KVNPGL-EGYALPRKCNTEQAGRPKCPLDPFFIMPDKCKCVDFQTLKLQELPDFVPQGEIPRHLQLFCDRSLCERVVPGNRVLIQGIYSIRKVGKPSRRDGREKAVVGVRAPYMRVVGITVDSEGAGAISRYSNITSDEEEHFRRMAASGDIYERLSQSLAPSIFGSRDIKKAITCMLFGGSRKRLPDGLCRRGDINVLLLGDPGTAKSQLLKFVEKVA-PIAVYTSGKGSSAAGLTASVMKDPQTRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSIFGRWDDTKGE-ENIDFMPTILSRFDMIFIVKDIHDESRDITLAKHIINVH----------------------------LSSNKSAPSEPAE-------------GEISLSTF-KKYIHYCRTHCGPRLSEAAGEKLKSRYVLMRSG---AGQQEKASDKRLSIPITVRQLEAVIRISESLAKIRLQPFATDEHVNEALRLFQVSTLDAAMTGS 655          
BLAST of SMED30026560 vs. Ensembl Zebrafish
Match: mcm3 (minichromosome maintenance complex component 3 [Source:ZFIN;Acc:ZDB-GENE-020419-4])

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 387/649 (59.63%), Postives = 490/649 (75.50%), Query Frame = -3
Query:  403 YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDM--AKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHG------QYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTK 2325
            YQ +++ +I +   RLI++LNDLR     R  KLL   F E+++ Q ALK  +A+I+  YA   EEFF+G EGSFGS+ ++PRT+TS  LG+MVC+EGIVTK S+++ K+V SVHYCPATKK +ER YTDLTSL+    + A YPTKDE  N LETE+GLS YKD QTIT+QEMPE APAGQLPRS+++ILDNDLVD  K GDR  V G YRC+PGKKGGFT+  FRTI+IA +V  ++K  +  F   D  KI+    ++ K++ D L RS+APSI GHE+IK+A+LC LLGGVE++L NG+RIRGDIN+L++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVL DRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGIHARLNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLFI++DQ D   DREI++ V RMH+YR P ++DG AL+L  T  ID +  E+  D   +  +  +++EK N      HG      +  +K F+ KYIH A+ + P L+++A+N + ++Y  LR+QE      + G++  RT PVTART+ETLIRL+TAHAKAR  K V   D E A +LV +A FK+VL+K +KR++
Sbjct:   31 YQSKVRQMISENKSRLIVNLNDLRRRNEKRAAKLLNNAFEELLAFQRALKDLVASIDATYAKQCEEFFIGLEGSFGSKHVSPRTLTSRLLGSMVCLEGIVTKCSLVRPKVVRSVHYCPATKKTMERKYTDLTSLDA-FPSSAIYPTKDEENNPLETEFGLSVYKDHQTITIQEMPEKAPAGQLPRSVDIILDNDLVDAVKPGDRTQVIGTYRCLPGKKGGFTSGTFRTIMIACHVKQMSKEISHYFSADDVAKIKSFCRSRSKNVFDQLARSLAPSIHGHEYIKKAILCMLLGGVEKVLENGSRIRGDINVLLIGDPSVAKSQLLRYVLHTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLGDRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHRYRDPHEQDGTALALGGT--IDALATED-PDATQEEEEELQVYEKHNPLL---HGSKKNKDRVVSKAFMRKYIHVAKAISPVLTQDAANHIAEEYSRLRNQE------QLGSDIARTSPVTARTLETLIRLSTAHAKARMSKAVELVDTEVAVELVQFAYFKKVLEKERKRSR 665          
BLAST of SMED30026560 vs. Ensembl Zebrafish
Match: mcm3l (MCM3 minichromosome maintenance deficient 3 (S. cerevisiae), like [Source:ZFIN;Acc:ZDB-GENE-040121-2])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 379/647 (58.58%), Postives = 492/647 (76.04%), Query Frame = -3
Query:  400 YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKF---AVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKP 2325
            Y +++++++  G  RLI+++NDLR     R ++LLK  F E+++ Q ALK  +A+I+  YA  +EEF VGFEGSFG++ ++PRT+++ +LGN+VC+EGIVTK S+++ KI+ SVHYCPATKK LER YTDLTSL+    + A YPTKDE  N LETE+GL  YKD QT+T+QEMPE APAGQLPRS+++I ++DLVD  K GDR+ + G YRC+P K+GGFT+  FRTIL+ANNV  ++K    TF G D  KI+   K   KD+ + L+RS+APSI GHE+IK+A+LC LLGG E  L NGTRIRGDINIL++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTISKAGI ARLNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLFI++DQ D   D+EI+E V RMH+YR PG+ +G A+ L +T  +D    E+ +  E+   +  +I+EK +       +K  +  T +F+ KYIH A+ ++P L++EAS+ + ++Y  LR      S+++  ++  RT PVTAR +ET+IRL+TAHAKAR  K V   DAEAA +L+ +A FK++L+K KKR  P
Sbjct:   30 YHEKVRSMVSDGQCRLIVNINDLRRKSEKRAKELLKNAFAELVAFQKALKDLVASIDATYAKQFEEFHVGFEGSFGNKHVSPRTLSARFLGNLVCVEGIVTKCSLVRPKIMRSVHYCPATKKTLERKYTDLTSLDA-FPSSAIYPTKDEENNPLETEFGLCCYKDHQTLTIQEMPEKAPAGQLPRSVDIIANDDLVDRVKPGDRVQIVGVYRCLPAKQGGFTSGTFRTILLANNVKLMSKEIVPTFSGDDVAKIKKFCKAHSKDVFEQLSRSLAPSIHGHEYIKKAILCLLLGGNETNLENGTRIRGDINILLIGDPSVAKSQLLRYVLFTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTISKAGIQARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIVLDQMDPDSDKEISEHVLRMHRYRAPGEAEGTAMPLGST--VDVFATEDPNITEASEQEL-QIYEKKDNVLHGHRKKREKIVTMEFIRKYIHVAKLVKPVLTQEASDYIAEEYSRLR------SHDQVNSDSARTMPVTARALETMIRLSTAHAKARMSKTVDLADAEAALELMQFAYFKKILEKVKKRKVP 665          
BLAST of SMED30026560 vs. Ensembl Zebrafish
Match: mcm3l (MCM3 minichromosome maintenance deficient 3 (S. cerevisiae), like [Source:ZFIN;Acc:ZDB-GENE-040121-2])

HSP 1 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 401/779 (51.48%), Postives = 542/779 (69.58%), Query Frame = -3
Query:   61 YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKF---AVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKS-----------KKRTKPLNESD-----SDGEETN--GIIEDMATTSIRSNKKQRTAEHAXXXXXXXXXXXXXXINNFKISVSRTFQDARVDFMDLNTLIVALQQIH-PDVNAAGITALLRKLDADSKIMMTDNEVYII 2325
            Y +++++++  G  RLI+++NDLR     R ++LLK  F E+++ Q ALK  +A+I+  YA  +EEF VGFEGSFG++ ++PRT+++ +LGN+VC+EGIVTK S+++ KI+ SVHYCPATKK LER YTDLTSL+    + A YPTKDE  N LETE+GL  YKD QT+T+QEMPE APAGQLPRS+++I ++DLVD  K GDR+ + G YRC+P K+GGFT+  FRTIL+ANNV  ++K    TF G D  KI+   K   KD+ + L+RS+APSI GHE+IK+A+LC LLGG E  L NGTRIRGDINIL++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTISKAGI ARLNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLFI++DQ D   D+EI+E V RMH+YR PG+ +G A+ L +T  +D    E+ +  E+   +  +I+EK +       +K  +  T +F+ KYIH A+ ++P L++EAS+ + ++Y  LR      S+++  ++  RT PVTAR +ET+IRL+TAHAKAR  K V   DAEAA +L+ +A FK++               +KR++   + D      DGE+ +     ED  T   + ++K R A           DI Q     FK ++   F+  R   + ++ L+  + Q    + +   I  LL  +  D+++M++++ V++I
Sbjct:   30 YHEKVRSMVSDGQCRLIVNINDLRRKSEKRAKELLKNAFAELVAFQKALKDLVASIDATYAKQFEEFHVGFEGSFGNKHVSPRTLSARFLGNLVCVEGIVTKCSLVRPKIMRSVHYCPATKKTLERKYTDLTSLDA-FPSSAIYPTKDEENNPLETEFGLCCYKDHQTLTIQEMPEKAPAGQLPRSVDIIANDDLVDRVKPGDRVQIVGVYRCLPAKQGGFTSGTFRTILLANNVKLMSKEIVPTFSGDDVAKIKKFCKAHSKDVFEQLSRSLAPSIHGHEYIKKAILCLLLGGNETNLENGTRIRGDINILLIGDPSVAKSQLLRYVLFTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTISKAGIQARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIVLDQMDPDSDKEISEHVLRMHRYRAPGEAEGTAMPLGST--VDVFATEDPNITEASEQEL-QIYEKKDNVLHGHRKKREKIVTMEFIRKYIHVAKLVKPVLTQEASDYIAEEYSRLR------SHDQVNSDSARTMPVTARALETMIRLSTAHAKARMSKTVDLADAEAALELMQFAYFKKLSNVRCYGFIRTNNVYRKRSRISKDGDDVEMTQDGEDEDPYDFTEDENT---QPSQKSRPASQ-RSSQRKKTDISQERFKTFKTALVNAFKVTRSQSVAVSDLLTHINQGQDEEFDQNEINLLLECMQDDNQVMVSEDVVFLI 793          
BLAST of SMED30026560 vs. Ensembl Zebrafish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:ZFIN;Acc:ZDB-GENE-020419-24])

HSP 1 Score: 288.886 bits (738), Expect = 3.446e-84
Identity = 193/544 (35.48%), Postives = 280/544 (51.47%), Query Frame = -3
Query:  466 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTA----VFRTILIANNVYSINKNSATT-FEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKY-IHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAA 2079
            R++   +L  ++   G+VT  + +  ++    + C      L  ++    S N  +  G+  P    +G   E     + Y+++Q IT+QE P    AG+LPRS + IL  DLVD+CK GD I + G Y       G    A    VF T+++AN++   ++  A       D   I  ++K + I + +  SI PSI  HE IKR +   L GG  +      ++RGDIN+L+ GDP  AKSQ L++V + A  RA+ TTG+G S VGLTA V     S E  LEAGA+VLADRG+  IDEFDKM+D DRT+IHE MEQ  ++ISKAGI   L ARC+V+AAANP+ GRYD   T  EN+ L + ++SRFD+L ++ D  D V D  +A FV   H    P  K+G    L+                              N F V        ++ L KY I+A  +++PKL++   + + + Y DLR + +             + P+T R +E++IR+A AHA+   R  V   D   A
Sbjct:  283 RSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCNFILGPFFQ---SQNQEVKPGSC-PECQSLGP-FEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDMCKPGDEIELTGIYHN--NYDGSLNMANGFPVFATVILANHIARKDEGVAVAELTDEDVKAIVALSKDERIGERIFASIGPSIYAHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVA-SRAVFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEVVL-------------------------PNTFDVPP----IPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATG----------SIPITVRHIESMIRMAEAHARMHLRDYVLEDDVNMA 779          
BLAST of SMED30026560 vs. Ensembl Zebrafish
Match: mcm4 (minichromosome maintenance complex component 4 [Source:ZFIN;Acc:ZDB-GENE-030131-9544])

HSP 1 Score: 280.026 bits (715), Expect = 3.048e-81
Identity = 190/569 (33.39%), Postives = 280/569 (49.21%), Query Frame = -3
Query:  418 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSD-------FVK-----IRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTR--IRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAAR-QLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKS 2079
            R +  E +  ++ I G+V + S +  ++  +   C          +     ++   +A  A        + +   +  S + D Q I +QE PE+ PAGQ P +  V   NDLVD  + GDR+ + G YR  P +     + V        +     K       G D       F K     ++++A K D+ + L+ ++APSI  HE IK+ +L QL GG  +      R   R ++NIL+ GDP  +KSQ+L++V      R   T+G+G+S VGLTA V+ D E+ +  L+ GA+VL+D GI CIDEFDKMSD  R+ +HEVMEQ  ++I+KAGI  +LNAR S+LAAANPV  +++  KT +ENI L  +LLSRFDL+F+++D  DE  DR +A  +               +L  Q+  QI+                             E+H        L+ YI  AR  + P+LS EAS  L + Y D+R    ++ +     + Y       R +E+LIRLA AHAK RF   V   D E A  L      +E LK+S
Sbjct:  254 RNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFRCQVCA------FNTRVEVDRGRIAEPAVCRNCNTTHSMALVHNRSVFSDKQMIKLQESPEDMPAGQTPHTTVVYAHNDLVDKVQPGDRVNITGIYRAAPMRLNPRQSQVKSVYKTHIDAIHFRKTDEKRLHGLDEDGEQKLFTKERVALLKELAAKPDVYERLSSALAPSIYEHEDIKKGILLQLFGGTRKDFTQTGRGNFRAEVNILLCGDPGTSKSQLLQYVYNLV-PRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLV--------------SLYYQSEEQIE-----------------------------EEH---LDMAVLKDYIAFARTTVHPRLSEEASQALIEAYVDMR----KIGSGRGMVSAY------PRQLESLIRLAEAHAKVRFSGKVETIDVEEAKRL-----HREALKQS 754          
BLAST of SMED30026560 vs. Ensembl Xenopus
Match: mcm3 (minichromosome maintenance complex component 3 [Source:NCBI gene;Acc:734092])

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 393/685 (57.37%), Postives = 513/685 (74.89%), Query Frame = -3
Query:  370 MTDITDQESYQAESAYLNFLDSEIK---YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKK--KDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKF--AVEKHGQ-YFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPLNESDSDGEE 2400
            +T++ DQE  +A+  YL+FLD E     YQ +++ +I +   RLI+++NDLR     R   L+   F  +I+ Q ALK  +A+I+  YA  YEEF++G EGSFG++ +TPRT+TS  L  +VC+EGIVTK S+++ K+V SVHYCPATKK +ER YTDLTSL     + A YPTKDE  N LETEYGLS YKD QTIT+QEMPE APAGQLPRS+++ILD+DLVD  K GDR+ V G YRC+P K+ G+T+A FRTILIA NV  ++K     F   D  KI+  +K   KDI + L+RS+APSI GH +IK+A+LC LLGGVE++L NGTRIRGDIN+L++GDPSVAKSQ+LR+VL C   RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGIHARLNARCSVLAAANPVYGRYDQ+KTPM+NIGLQDSLLSRFDLLFI++DQ D   DREI++ V RMH+YR  G++DG+A+ L +   I    +  ++ +E +     +++EK +     V+K  +   + +F+ KY+H A+  +P L++EA++ + ++Y  LR+Q+ ++S + +     RT PVTART+ETLIRL+TAHAK R  K V  +DAEAA +LV YA FK+VL+K KKR +   +SD++GE+
Sbjct:    6 VTELEDQEMREAQREYLDFLDDEEDQGIYQSKVRDMISENQYRLIVNINDLRKKNEKRANMLMNNAFEGLIAFQRALKDFVASIDGTYAKQYEEFYIGLEGSFGNKHVTPRTLTSRCLSCIVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERKYTDLTSLEA-FPSSAVYPTKDEENNPLETEYGLSIYKDHQTITIQEMPEKAPAGQLPRSVDIILDDDLVDKVKPGDRVQVIGTYRCLPSKQNGYTSASFRTILIACNVIQMSKEVTPVFSADDLAKIKKFSKSHSKDIFEQLSRSLAPSIHGHLYIKKAILCMLLGGVEKVLDNGTRIRGDINVLLIGDPSVAKSQLLRYVL-CTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMDNIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHRYRAAGEQDGDAMPLGSAVDILATNDPNVTSEEQQEL---QVYEKHDSLLHGVKKRKEKILSVEFMRKYVHVAKIFKPVLTQEAASFIAEEYSRLRNQD-QLSTDVA-----RTSPVTARTLETLIRLSTAHAKVRMSKTVQLQDAEAAIELVQYAYFKKVLEKEKKRRRRDEDSDTEGEQ 679          
BLAST of SMED30026560 vs. Ensembl Xenopus
Match: ctnnd1 (catenin delta 1 [Source:Xenbase;Acc:XB-GENE-919827])

HSP 1 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 390/744 (52.42%), Postives = 519/744 (69.76%), Query Frame = -3
Query:   61 RVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTD---EIFEKSNKFAVEKHG------QYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKE---VLKKSKKRTKPLNESD---SDGEETNGIIEDMATTSIRSNKKQRTAEHAXXXXXXXXXXXXXXINNFKISVSRTFQDARVDFMDLNTLIVALQQIHPD-VNAAGITALLRKLDADSKIMMTDNEVYII 2238
            R   LL   F E I+ Q ALK  +A+I+  YA  +EEF VGFEGSFGS+ ++PRT+T+  LG++VC+EGIVTK S+++ K++ SVHYCPATKK LER YTDLTSL     + + YPTKDE  N LETEYGLSTY+D QT+++QEMPE APAGQLPRS+++I D+DLVD CK GDR+ + G YRC+P K+GGFT+  FRTIL+ANN+  ++K  A TF   D  KI+   K   KDI + L++S+APSI GHE+IK+A+LC LLGG E++L NGTRIRGDIN+L++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGI ARLNARCSVLAAANPVYGRYDQ++TPMENIGLQDSLLSRFDLLFI++D+ D   DREIA+ V RMH+YR PG++DG AL L  + +I        +DD +    TD   +I+EK +      HG      +  + QF+ KYIH A+ ++P L+ EA++ + Q+Y  +R+   +  NN+S     RT PVTAR +ET+IRLATAHAK R  K +  +DAE A +LV +A FK+   VL ++ +R      S    SD E      + + T + R+N   + +E       + F    +    FK ++ +TF+  R   + ++ L   + + + +    + +   L  +  D+++M++D+ V++I
Sbjct:   62 RANLLLNNAFGETIAFQRALKDLVASIDATYAKQFEEFSVGFEGSFGSKHVSPRTLTASLLGSLVCVEGIVTKCSLVRPKVLRSVHYCPATKKTLERKYTDLTSLEA-FPSSSIYPTKDEENNPLETEYGLSTYRDHQTLSIQEMPEKAPAGQLPRSVDIIADDDLVDKCKPGDRVQIVGIYRCLPSKQGGFTSGTFRTILLANNIKLMSKEIAPTFSADDVAKIKKFCKAHSKDIFEHLSKSLAPSIHGHEYIKKAILCMLLGGNEKVLDNGTRIRGDINVLLIGDPSVAKSQLLRYVLYTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIQARLNARCSVLAAANPVYGRYDQYRTPMENIGLQDSLLSRFDLLFIVLDKMDADNDREIADHVLRMHRYRTPGEQDGYALPLGCSVEI------FATDDPNASDVTDQELQIYEKHDNLL---HGPRKNKSKIVSMQFIRKYIHVAKLIKPVLTPEAADYISQEYAKIRNH--DQINNDSA----RTMPVTARALETMIRLATAHAKVRMSKTIERQDAETALELVQFAYFKKVNVVLGEASERGSHKCGSYVAFSDEEPAKIPQQQLPTQARRANVAPQESE------KERFHKSLIRTKEFKAALLKTFKTTRSQSVAVSQLFELINKGNSEPFELSEVKEALDNMQNDNQVMVSDDVVFLI 782          
BLAST of SMED30026560 vs. Ensembl Xenopus
Match: ctnnd1 (catenin delta 1 [Source:Xenbase;Acc:XB-GENE-919827])

HSP 1 Score: 707.597 bits (1825), Expect = 0.000e+0
Identity = 388/770 (50.39%), Postives = 521/770 (67.66%), Query Frame = -3
Query:   61 RVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTD---EIFEKSNKFAVEKHG------QYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIF--------------------------KEVLKKSKKRTKPLNESDSDG------EETNGIIEDMATTSIRSNKKQRTAEHAXXXXXXXXXXXXXXINNFKISVSRTFQDARVDFMDLNTLIVALQQIHPD-VNAAGITALLRKLDADSKIMMTDNEVYII 2238
            R   LL   F E I+ Q ALK  +A+I+  YA  +EEF VGFEGSFGS+ ++PRT+T+  LG++VC+EGIVTK S+++ K++ SVHYCPATKK LER YTDLTSL     + + YPTKDE  N LETEYGLSTY+D QT+++QEMPE APAGQLPRS+++I D+DLVD CK GDR+ + G YRC+P K+GGFT+  FRTIL+ANN+  ++K  A TF   D  KI+   K   KDI + L++S+APSI GHE+IK+A+LC LLGG E++L NGTRIRGDIN+L++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGI ARLNARCSVLAAANPVYGRYDQ++TPMENIGLQDSLLSRFDLLFI++D+ D   DREIA+ V RMH+YR PG++DG AL L  + +I        +DD +    TD   +I+EK +      HG      +  + QF+ KYIH A+ ++P L+ EA++ + Q+Y  +R+   +  NN+S     RT PVTAR +ET+IRLATAHAK R  K +  +DAE A +LV +A F                          +E ++KS +R   + +S  D        E +  + +  + S+R  +K+  ++           + Q     FK ++ +TF+  R   + ++ L   + + + +    + +   L  +  D+++M++D+ V++I
Sbjct:   61 RANLLLNNAFGETIAFQRALKDLVASIDATYAKQFEEFSVGFEGSFGSKHVSPRTLTASLLGSLVCVEGIVTKCSLVRPKVLRSVHYCPATKKTLERKYTDLTSLEA-FPSSSIYPTKDEENNPLETEYGLSTYRDHQTLSIQEMPEKAPAGQLPRSVDIIADDDLVDKCKPGDRVQIVGIYRCLPSKQGGFTSGTFRTILLANNIKLMSKEIAPTFSADDVAKIKKFCKAHSKDIFEHLSKSLAPSIHGHEYIKKAILCMLLGGNEKVLDNGTRIRGDINVLLIGDPSVAKSQLLRYVLYTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIQARLNARCSVLAAANPVYGRYDQYRTPMENIGLQDSLLSRFDLLFIVLDKMDADNDREIADHVLRMHRYRTPGEQDGYALPLGCSVEI------FATDDPNASDVTDQELQIYEKHDNLL---HGPRKNKSKIVSMQFIRKYIHVAKLIKPVLTPEAADYISQEYAKIRNH--DQINNDSA----RTMPVTARALETMIRLATAHAKVRMSKTIERQDAETALELVQFAYFKKVLAKDKKKTDKDLHDEILSQDSASQESIRKSSRRAGKIADSQDDSMDPYSFSEQDSSLNETLSQSLRPQRKKAESQ------DIKRSLSQNRTKEFKAALLKTFKTTRSQSVAVSQLFELINKGNSEPFELSEVKEALDNMQNDNQVMVSDDVVFLI 807          
BLAST of SMED30026560 vs. Ensembl Xenopus
Match: ctnnd1 (catenin delta 1 [Source:Xenbase;Acc:XB-GENE-919827])

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 367/613 (59.87%), Postives = 464/613 (75.69%), Query Frame = -3
Query:  424 RVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTD---EIFEKSNKF---AVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLK 2238
            R   LL   F E I+ Q ALK  +A+I+  YA  +EEF VGFEGSFGS+ ++PRT+T+  LG++VC+EGIVTK S+++ K++ SVHYCPATKK LER YTDLTSL     + + YPTKDE  N LETEYGLSTY+D QT+++QEMPE APAGQLPRS+++I D+DLVD CK GDR+ + G YRC+P K+GGFT+  FRTIL+ANN+  ++K  A TF   D  KI+   K   KDI + L++S+APSI GHE+IK+A+LC LLGG E++L NGTRIRGDIN+L++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGI ARLNARCSVLAAANPVYGRYDQ++TPMENIGLQDSLLSRFDLLFI++D+ D   DREIA+ V RMH+YR PG++DG AL L  + +I        +DD +    TD   +I+EK +       +K  +  + QF+ KYIH A+ ++P L+ EA++ + Q+Y  +R+   +  NN+S     RT PVTAR +ET+IRLATAHAK R  K +  +DAE A +LV +A FK+V K
Sbjct:   61 RANLLLNNAFGETIAFQRALKDLVASIDATYAKQFEEFSVGFEGSFGSKHVSPRTLTASLLGSLVCVEGIVTKCSLVRPKVLRSVHYCPATKKTLERKYTDLTSLEA-FPSSSIYPTKDEENNPLETEYGLSTYRDHQTLSIQEMPEKAPAGQLPRSVDIIADDDLVDKCKPGDRVQIVGIYRCLPSKQGGFTSGTFRTILLANNIKLMSKEIAPTFSADDVAKIKKFCKAHSKDIFEHLSKSLAPSIHGHEYIKKAILCMLLGGNEKVLDNGTRIRGDINVLLIGDPSVAKSQLLRYVLYTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIQARLNARCSVLAAANPVYGRYDQYRTPMENIGLQDSLLSRFDLLFIVLDKMDADNDREIADHVLRMHRYRTPGEQDGYALPLGCSVEI------FATDDPNASDVTDQELQIYEKHDNLLHGPRKKLSKIVSMQFIRKYIHVAKLIKPVLTPEAADYISQEYAKIRNH--DQINNDSA----RTMPVTARALETMIRLATAHAKVRMSKTIERQDAETALELVQFAYFKKVNK 659          
BLAST of SMED30026560 vs. Ensembl Xenopus
Match: ctnnd1 (catenin delta 1 [Source:Xenbase;Acc:XB-GENE-919827])

HSP 1 Score: 705.671 bits (1820), Expect = 0.000e+0
Identity = 367/613 (59.87%), Postives = 464/613 (75.69%), Query Frame = -3
Query:  424 KLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTD---EIFEKSNKFAVEKHG------QYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLK 2229
            +LL   F E I+ Q ALK  +A+I+  YA  +EEF VGFEGSFGS+ ++PRT+T+  LG++VC+EGIVTK S+++ K++ SVHYCPATKK LER YTDLTSL     + + YPTKDE  N LETEYGLSTY+D QT+++QEMPE APAGQLPRS+++I D+DLVD CK GDR+ + G YRC+P K+GGFT+  FRTIL+ANN+  ++K  A TF   D  KI+   K   KDI + L++S+APSI GHE+IK+A+LC LLGG E++L NGTRIRGDIN+L++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGI ARLNARCSVLAAANPVYGRYDQ++TPMENIGLQDSLLSRFDLLFI++D+ D   DREIA+ V RMH+YR PG++DG AL L  + +I        +DD +    TD   +I+EK +      HG      +  + QF+ KYIH A+ ++P L+ EA++ + Q+Y  +R+   +  NN+S     RT PVTAR +ET+IRLATAHAK R  K +  +DAE A +LV +A FK+V K
Sbjct:   47 RLLNNAFGETIAFQRALKDLVASIDATYAKQFEEFSVGFEGSFGSKHVSPRTLTASLLGSLVCVEGIVTKCSLVRPKVLRSVHYCPATKKTLERKYTDLTSLEA-FPSSSIYPTKDEENNPLETEYGLSTYRDHQTLSIQEMPEKAPAGQLPRSVDIIADDDLVDKCKPGDRVQIVGIYRCLPSKQGGFTSGTFRTILLANNIKLMSKEIAPTFSADDVAKIKKFCKAHSKDIFEHLSKSLAPSIHGHEYIKKAILCMLLGGNEKVLDNGTRIRGDINVLLIGDPSVAKSQLLRYVLYTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIQARLNARCSVLAAANPVYGRYDQYRTPMENIGLQDSLLSRFDLLFIVLDKMDADNDREIADHVLRMHRYRTPGEQDGYALPLGCSVEI------FATDDPNASDVTDQELQIYEKHDNLL---HGPRKNKSKIVSMQFIRKYIHVAKLIKPVLTPEAADYISQEYAKIRNH--DQINNDSA----RTMPVTARALETMIRLATAHAKVRMSKTIERQDAETALELVQFAYFKKVNK 642          
BLAST of SMED30026560 vs. Ensembl Mouse
Match: Mcm3 (minichromosome maintenance complex component 3 [Source:MGI Symbol;Acc:MGI:101845])

HSP 1 Score: 719.539 bits (1856), Expect = 0.000e+0
Identity = 395/671 (58.87%), Postives = 504/671 (75.11%), Query Frame = -3
Query:  403 ITDQESYQAESAYLNFLDSEIK---YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKF---AVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTK 2391
            + D E  +A+  YL+FLD E     YQ++++ LI     RLI+ +NDLR     R  +LL   F E+++ Q ALK  +A+I+  YA  YEEF++G EGSFGS+ ++PRT+TS +L  +VC+EGIVTK S+++ K+V SVHYCPATKK +ER Y+DLT+L     + + YPTKDE  N LETEYGLS YKD QTIT+QEMPE APAGQLPRS++VILD+DLVD  K GDRI V G YRC+PGKKG +T+  FRT+LIA NV  ++K+    F   D  KI+  +K   KD+ + L RS+APSI GH+++K+A+LC LLGGVER L NG+ IRGDINIL++GDPSVAKSQ+LR+VL C   RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGIHARLNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLFI++DQ D   DREI++ V RMHQYR PG++DG+AL L ++  I    + + + D+ + T+   I+EK +       +K  +  +  F++KYIH A+ ++P L++E++  + ++Y  LRSQ+  MS++ +     RT PVTART+ETLIRLATAHAKAR  K V  +DAE A +LV YA FK+VL+K KKR K
Sbjct:    7 LDDVELREAQRDYLDFLDDEEDQGIYQNKVRELISDNQYRLIVSVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYIGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVA-FPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKVKPGDRIQVVGTYRCLPGKKGCYTSGTFRTVLIACNVKQMSKDIQPAFSADDIAKIKKFSKTRSKDVFEQLARSLAPSIHGHDYVKKAILCLLLGGVERELENGSHIRGDINILLIGDPSVAKSQLLRYVL-CTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHQYRAPGEQDGDALPLGSSVDILATDDPDFTQDDQQDTR---IYEKHDSLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPTLTQESAAYIAEEYSRLRSQD-SMSSDTA-----RTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRKK 666          
BLAST of SMED30026560 vs. Ensembl Mouse
Match: Mcm2 (minichromosome maintenance complex component 2 [Source:MGI Symbol;Acc:MGI:105380])

HSP 1 Score: 295.049 bits (754), Expect = 3.013e-86
Identity = 198/543 (36.46%), Postives = 283/543 (52.12%), Query Frame = -3
Query:  466 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTA----VFRTILIANNVYSI-NKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAA 2079
            R++   +L  ++   G+VT  + +  ++    + C      L  +     S N  +  G+  P     G   E     + Y+++Q I +QE P    AG+LPRS + IL  DLVD CK GD I + G Y       G   TA    VF TI++AN+V    NK +       D   I  ++K + I + +  SIAPSI GHE IKR +   L GG  +      ++RGDIN+L+ GDP  AKSQ L+++ + +  RAI TTG+G S VGLTA V     S E  LEAGA+VLADRG+  IDEFDKM+D DRT+IHE MEQ  ++ISKAGI   L ARC+V+AAANP+ GRYD   T  EN+ L + ++SRFD+L ++ D  D V D  +A FV   H    P  K  E L+   T +             + P          N + VE   Q   K+++   I+A  +++PKL++   + + + Y DLR + +             + P+T R +E++IR+A AHA+   R  V   D   A
Sbjct:  295 RSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCSKCNFVLGPF---CQSQNQEVKPGSC-PECQSAGP-FEINMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN--NYDGSLNTANGFPVFATIILANHVAKKDNKVAVGELTDEDVKMITGLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVS-SRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDVLCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKKDEGLTNGGTLE------------PAMP----------NTYGVEPLPQEVLKKYI---IYAKERVRPKLNQMDQDKVARMYSDLRKESMATG----------SIPITVRHIESMIRMAEAHARMHLRDYVMEDDVNMA 794          
BLAST of SMED30026560 vs. Ensembl Mouse
Match: Mcm4 (minichromosome maintenance complex component 4 [Source:MGI Symbol;Acc:MGI:103199])

HSP 1 Score: 280.026 bits (715), Expect = 3.963e-81
Identity = 189/569 (33.22%), Postives = 286/569 (50.26%), Query Frame = -3
Query:  418 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSD-----------FVKI-RDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTR--IRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYI-HAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKS 2079
            R +  E +  ++ I G+V + S +  ++  +   C          +T    ++   +A           + +   +  S + D Q I +QE PE+ PAGQ P +I +   NDLVD  + GDR+ V G YR +P +     + V        +V    K  A    G D            VK+ +++++K DI + L  ++APSI  HE IK+ +L QL GG  +   +  R   R +INIL+ GDP  +KSQ+L++V      R   T+G+G+S VGLTA V+ D E+ +  L+ GA+VL+D GI CIDEFDKM++  R+ +HEVMEQ  ++I+KAGI  +LNAR SVLAAANP+  +++  KT +ENI L  +LLSRFDL+F+++D  DE  DR +A  +  +                       Y  +EE  ++E                       +     L+ YI +A   + P+LS EAS  L + Y ++R    ++ ++    + Y       R +E+LIRLA AHAK RF   V A D E A  L      +E LK+S
Sbjct:  271 RNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCA------HTTRVEIDRGRIAEPCSCVHCHTTHSMALIHNRSFFSDKQMIKLQESPEDMPAGQTPHTIVLFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVKLLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLV-PRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSL-----------------------YYQSEEQVEEE-----------------------FLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVNMR----KIGSSRGMVSAY------PRQLESLIRLAEAHAKVRFSNKVEAIDVEEAKRL-----HREALKQS 771          
BLAST of SMED30026560 vs. Ensembl Mouse
Match: Mcm7 (minichromosome maintenance complex component 7 [Source:MGI Symbol;Acc:MGI:1298398])

HSP 1 Score: 273.478 bits (698), Expect = 8.293e-80
Identity = 190/554 (34.30%), Postives = 297/554 (53.61%), Query Frame = -3
Query:  454 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKD----EVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTA----VFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQY--RPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLV 2079
            R + ++ +G ++ + GIVT+VS +K ++V + + C          Y  + S  P  +     P+++      G  L  +   S +  FQ + +QE  +  P G +PRSI V+L+ +   I + GD + V G +  +P  + GF       +  T L A+ +  + K S     G+  +   ++ +  ++D  + L  SIAP I GHE +K+A+L  L+GGV++    G +IRG+I+I ++GDP VAKSQ+L ++ + A  R+  TTGRG+SGVGLTAAV+ D  SGE  LE GA+VLAD+G+ CIDEFDKM++ DRTAIHEVMEQ  ++I+KAGI   LNARCS+LAAANP YGRY+  ++  +N+ L  +LLSRFDLL++I D+ D   D  +A+ +  +HQ+  +PP Q                                   FE                + + +YI    + QP +    ++ +   Y ++R         E+ A+K  T   +ART+  ++RL+TA A+ R   +V  +D   A  L+
Sbjct:  150 REVRADSVGKLLTVRGIVTRVSEVKPRMVVATYTCDQCGA---ETYQPIQS--PTFMPLIMCPSQECQTNRSGGRLYLQTRGSKFVKFQEMKIQEHSDQVPVGNIPRSITVVLEGENTRIAQPGDHVSVTGIF--LPVLRTGFQQMAQGLLSETYLEAHWIVKMTK-SDDDVSGAGELSSEELKQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQS-PQGMKIRGNIHICLMGDPGVAKSQLLSYIDRLA-PRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNVQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPAQ-----------------------------------FEP------------LDMKLMRRYIAMCHERQPTVPESLADYITAAYVEMR--------REARASKDATY-TSARTLLAILRLSTALARLRMVDIVEKEDVNEAIRLM 637          
BLAST of SMED30026560 vs. Ensembl Mouse
Match: Mcm5 (minichromosome maintenance complex component 5 [Source:MGI Symbol;Acc:MGI:103197])

HSP 1 Score: 271.937 bits (694), Expect = 3.637e-79
Identity = 183/571 (32.05%), Postives = 291/571 (50.96%), Query Frame = -3
Query:  427 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTY---------KDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRC----MPGKKG------GFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAAR-QLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVL 2079
            R + S+ + ++V I GI+   S +++K       C +    L        ++ P L  G A P K  +      +  L  Y          DFQT+ +QE+P+  P G++PR +++  D  L D    G+R+ + G Y      +   KG      G  ++  R + I  +     ++ A +    +  + R +A   +I +L+++SI+PSI G   +K+A+ C L GG  + L +G   RGDIN+LMLGDP  AKSQ+L+FV +C+    + T+G+G+S  GLTA+V+ D  S    +E GAMVLAD G+VCIDEFDKM + DR AIHE MEQ  ++I+KAGI   LN+RCSVLAAAN V+GR+D+ K   +NI    ++LSRFD++FI+ D+ +E  D  +A+ V  +H             +L  T  ++  G  +L+                                ++K+I   R +  P+LS EA+  L  +Y  +RS       +E  +++  + P+T R +E ++R+A A +K + +   +  D E A  L   +     L
Sbjct:  138 RILKSDMMSHLVKIPGIIISASAVRAKATRISIQCRSCHNTLTN-----IAMRPGL-EGYALPRKCNMDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLNPSKGRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGSVSPQEEEEFRRLAALPNIYELISKSISPSIFGGMDMKKAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCS-PIGVYTSGKGSSAAGLTASVIRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKGE-DNIDFMPTILSRFDMIFIVKDEHNEERDMMLAKHVMTLH-----------VSALTQTQAVE--GEIDLAK-------------------------------MKKFIAYCRARCGPRLSAEAAEKLKNRYIIMRSG---ARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAAL 653          
BLAST of SMED30026560 vs. UniProt/SwissProt
Match: sp|Q9XYU1|MCM3_DROME (DNA replication licensing factor Mcm3 OS=Drosophila melanogaster OX=7227 GN=Mcm3 PE=1 SV=1)

HSP 1 Score: 729.554 bits (1882), Expect = 0.000e+0
Identity = 383/671 (57.08%), Postives = 498/671 (74.22%), Query Frame = -3
Query:  361 YLNFLDSEIK---YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTT--NQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQE-VEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPLNESDSDGEETNG 2355
            Y++FLD E     Y   +K +I +  +RLI+++NDL+     R   LL     E ++   ALK+  + ++P YA  +E+ FVGFEG FG+R +TPR++TS YLGNMVC+EGIVTKVS+++ K+V SVHYCP T+K +ER YTDLTS    + +GAAYPTKDE GN+LETEYGLS YKD QT+T+QEMPE APAGQLPRS++++ D+DLVD CK GDR+ + G YRC+PGK+GG+T+  FRT+L+ANN+  ++K S       D +  + +AK  DI +LL++S+APSI GH ++K+A+LC LLGGVE+IL NGTR+RGDIN+L++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHA LNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLF+++D  D  VD+ I++ V RMH+YR P + DGE LS+ ++  + + +V + E   D     K D +    ++   ++H +  + +F+ KYIH A+ ++PKL  +A   +  +Y  LRSQE VE        +  RTQP+TART+ETLIRL+TAHA+AR  K V+  DA AA +LV +A FK+VL K +   +  N S SD E+ NG
Sbjct:   16 YVDFLDDEEDQGIYAGHVKDMIAEKSKRLIVNVNDLKRKNPQRALGLLSNAADEQLAFGRALKEYASTVDPGYAKMHEDLFVGFEGCFGNRHVTPRSLTSIYLGNMVCVEGIVTKVSLIRPKVVRSVHYCPNTRKVMERKYTDLTSFEA-VPSGAAYPTKDEDGNLLETEYGLSVYKDHQTLTIQEMPEKAPAGQLPRSVDIVCDDDLVDRCKPGDRVQIVGSYRCLPGKRGGYTSGTFRTVLLANNISLLSKESNLDISREDIMLCKKLAKNNDIFELLSKSLAPSIHGHAYVKQAILCLLLGGVEKILPNGTRLRGDINVLLIGDPSVAKSQLLRYVLNTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHASLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFVMLDVIDSDVDQMISDHVVRMHRYRNPKEADGEPLSMGSSYADSLSFVSSSEEKKDTEVYEKYDALLHGKSR---QRHEKILSVEFMRKYIHIAKCMKPKLGEQACEAIANEYSRLRSQEAVE-------TDVARTQPITARTLETLIRLSTAHARARMSKSVTIDDAHAAIELVQFAYFKKVLDKDRPSKRRRN-SGSDAEDDNG 673          
BLAST of SMED30026560 vs. UniProt/SwissProt
Match: sp|P25206|MCM3_MOUSE (DNA replication licensing factor MCM3 OS=Mus musculus OX=10090 GN=Mcm3 PE=1 SV=2)

HSP 1 Score: 719.539 bits (1856), Expect = 0.000e+0
Identity = 395/671 (58.87%), Postives = 504/671 (75.11%), Query Frame = -3
Query:  403 ITDQESYQAESAYLNFLDSEIK---YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKF---AVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTK 2391
            + D E  +A+  YL+FLD E     YQ++++ LI     RLI+ +NDLR     R  +LL   F E+++ Q ALK  +A+I+  YA  YEEF++G EGSFGS+ ++PRT+TS +L  +VC+EGIVTK S+++ K+V SVHYCPATKK +ER Y+DLT+L     + + YPTKDE  N LETEYGLS YKD QTIT+QEMPE APAGQLPRS++VILD+DLVD  K GDRI V G YRC+PGKKG +T+  FRT+LIA NV  ++K+    F   D  KI+  +K   KD+ + L RS+APSI GH+++K+A+LC LLGGVER L NG+ IRGDINIL++GDPSVAKSQ+LR+VL C   RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGIHARLNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLFI++DQ D   DREI++ V RMHQYR PG++DG+AL L ++  I    + + + D+ + T+   I+EK +       +K  +  +  F++KYIH A+ ++P L++E++  + ++Y  LRSQ+  MS++ +     RT PVTART+ETLIRLATAHAKAR  K V  +DAE A +LV YA FK+VL+K KKR K
Sbjct:    7 LDDVELREAQRDYLDFLDDEEDQGIYQNKVRELISDNQYRLIVSVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYIGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVA-FPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKVKPGDRIQVVGTYRCLPGKKGCYTSGTFRTVLIACNVKQMSKDIQPAFSADDIAKIKKFSKTRSKDVFEQLARSLAPSIHGHDYVKKAILCLLLGGVERELENGSHIRGDINILLIGDPSVAKSQLLRYVL-CTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHQYRAPGEQDGDALPLGSSVDILATDDPDFTQDDQQDTR---IYEKHDSLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPTLTQESAAYIAEEYSRLRSQD-SMSSDTA-----RTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRKK 666          
BLAST of SMED30026560 vs. UniProt/SwissProt
Match: sp|Q28BS0|MCM3Z_XENTR (Zygotic DNA replication licensing factor mcm3 OS=Xenopus tropicalis OX=8364 GN=zmcm3 PE=2 SV=1)

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 393/685 (57.37%), Postives = 513/685 (74.89%), Query Frame = -3
Query:  370 MTDITDQESYQAESAYLNFLDSEIK---YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKK--KDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKF--AVEKHGQ-YFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPLNESDSDGEE 2400
            +T++ DQE  +A+  YL+FLD E     YQ +++ +I +   RLI+++NDLR     R   L+   F  +I+ Q ALK  +A+I+  YA  YEEF++G EGSFG++ +TPRT+TS  L  +VC+EGIVTK S+++ K+V SVHYCPATKK +ER YTDLTSL     + A YPTKDE  N LETEYGLS YKD QTIT+QEMPE APAGQLPRS+++ILD+DLVD  K GDR+ V G YRC+P K+ G+T+A FRTILIA NV  ++K     F   D  KI+  +K   KDI + L+RS+APSI GH +IK+A+LC LLGGVE++L NGTRIRGDIN+L++GDPSVAKSQ+LR+VL C   RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGIHARLNARCSVLAAANPVYGRYDQ+KTPM+NIGLQDSLLSRFDLLFI++DQ D   DREI++ V RMH+YR  G++DG+A+ L +   I    +  ++ +E +     +++EK +     V+K  +   + +F+ KY+H A+  +P L++EA++ + ++Y  LR+Q+ ++S + +     RT PVTART+ETLIRL+TAHAK R  K V  +DAEAA +LV YA FK+VL+K KKR +   +SD++GE+
Sbjct:    6 VTELEDQEMREAQREYLDFLDDEEDQGIYQSKVRDMISENQYRLIVNVNDLRKKNEKRANMLMNNAFEGLIAFQRALKDFVASIDGTYAKQYEEFYIGLEGSFGNKHVTPRTLTSRCLSCIVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERKYTDLTSLEA-FPSSAVYPTKDEENNPLETEYGLSIYKDHQTITIQEMPEKAPAGQLPRSVDIILDDDLVDKVKPGDRVQVIGTYRCLPSKQNGYTSASFRTILIACNVIQMSKEVTPVFSADDLAKIKKFSKSHSKDIFEQLSRSLAPSIHGHLYIKKAILCMLLGGVEKVLDNGTRIRGDINVLLIGDPSVAKSQLLRYVL-CTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMDNIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHRYRAAGEQDGDAMPLGSAVDILATNDPNVTSEEQQEL---QVYEKHDSLLHGVKKRKEKILSVEFMRKYVHVAKIFKPVLTQEAASFIAEEYSRLRNQD-QLSTDVA-----RTSPVTARTLETLIRLSTAHAKVRMSKTVQLQDAEAAIELVQYAYFKKVLEKEKKRRRRDEDSDTEGEQ 679          
BLAST of SMED30026560 vs. UniProt/SwissProt
Match: sp|Q5ZMN2|MCM3_CHICK (DNA replication licensing factor MCM3 OS=Gallus gallus OX=9031 GN=MCM3 PE=2 SV=1)

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 406/817 (49.69%), Postives = 561/817 (68.67%), Query Frame = -3
Query:   61 ITDQESYQAESAYLNFLDSEIK---YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKK--KDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKP----TKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPL--------------------------NESDSDGEETNGIIEDMATTSIRSNKKQ----RTAEHAXXXXXXXXXXXXXXINNFKISVSRTFQDARVDFMDLNTLIVALQQIHPD-VNAAGITALLRKLDADSKIMMTDNEVYII 2391
            + D E  +A+  YL+FLD E     Y  +++ +I     RL++++NDLR     R  +LL   F E+I+ Q ALK  +A+++  YA  YE+F++G EGSFGS+ ++PRT+T+ +L  +VC+EGIVTK S+++ K+V SVHYCPATKK +ER YTDLTSL+    +   YPTKDE  N LETEYGLS YKD QTI++QEMPE APAGQLPRS++VILD+DLVD  K GDRI V G YRC+PGKKGG+T+  FRTILIA ++  ++K++   +  +D  KI+  +K   KDI + L RS+APSI GHEFIK+A+LC LLGGVE++L NG+RIRGDINIL++GDPSVAKSQ+LR+VL  A  RA+ TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSDIDRTAIHEVMEQGRVTI+KAGIHARLN+RCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLFI++DQ D   DREI++ V RMH+YR P ++DG+A+ L +  +I    + + + +E +      K D++    N+    +  +  + +F+ KYIH A+ ++P L++E+++ + ++Y  LRSQ      N+  ++  RT PVTART+ETLIRL+TAHAKAR  K V  +DAEAA +LV +A FK+VL+K KKR K +                           ++ ++GEE +    D +       + Q    +T E +        ++    +  FK ++   F+ +    + L  ++ ++ + +P+  + AG+   L  +  D++IM++D+ +++I
Sbjct:    8 LGDAELREAQRDYLDFLDDEEDQGVYHGKVRDMISDNQYRLLVNINDLRRRNEKRANRLLSNAFEELIAFQRALKDFVASVDATYAKQYEDFYIGLEGSFGSKHVSPRTLTACFLSCIVCVEGIVTKCSLIRPKVVRSVHYCPATKKTIERRYTDLTSLDA-FPSSTVYPTKDEENNPLETEYGLSVYKDHQTISIQEMPEKAPAGQLPRSVDVILDDDLVDKVKPGDRIQVVGTYRCLPGKKGGYTSGTFRTILIACHIKQMSKDARPLYSANDVAKIKRFSKSRSKDIFNQLARSLAPSIHGHEFIKKALLCMLLGGVEKVLENGSRIRGDINILLIGDPSVAKSQLLRYVLGTA-PRAVGTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTIAKAGIHARLNSRCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDSEQDREISDHVLRMHRYRNPNEQDGDAMPLGSAVEILATDDPDFAQEEEQELQVYEKHDDLLHGPNR----RKEKIVSMEFMRKYIHVAKMIKPVLTQESADYIAEEYSSLRSQ------NQMNSDIARTSPVTARTLETLIRLSTAHAKARMSKTVDLQDAEAALELVQFAYFKKVLEKEKKRKKQVEDDSETEKEEEEEETQPEKEGRKQRRKKARTEGEEESYDPYDFSDAEQEMPEVQAHTPKTPESSATGEAKKPELADPRLKAFKAALLEVFKSSHAQSVGLKNVMESINRDNPEPFSLAGVKVALAHMQDDNQIMVSDDIIFLI 812          
BLAST of SMED30026560 vs. UniProt/SwissProt
Match: sp|Q7ZXZ0|MCM3Z_XENLA (Zygotic DNA replication licensing factor mcm3 OS=Xenopus laevis OX=8355 GN=zmcm3 PE=1 SV=1)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 396/690 (57.39%), Postives = 514/690 (74.49%), Query Frame = -3
Query:  364 MTDITDQESYQAESAYLNFLDSEIK---YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKK--KDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHG------QYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPLNESDSDGEETN 2400
            +T++ DQE  +A+  YL+FLD E     YQ +++ +I +   RLI+++NDLR     R   L+   F  +I+ Q ALK  +A+I+  YA  YE+F++G EGSFGS+ +TPRT+TS +L ++VC+EGIVTK S+++ K+V SVHYCPATKK +ER YTDLTSL     + A YPTKDE  N LETEYGLS YKD QTIT+QEMPE APAGQLPRS+++ILD+DLVD  K GDR+ V G YRC+P K+ G+T+A FRTILIA NV  ++K     F   D  KI+  +K   KD+ + L+RS+APSI GH +IK+A+LC LLGGVE++L NGTRIRGDIN+L++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGIHARLNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLFI++DQ D   DREI++ V RMH+YR  G++DG+AL L +   I    +  ++ +E +     +++EK +      HG      +  + +F+ KYIH A+  +P L++EA++ + ++Y  LR+Q+ +MS + +     RT PVTAR++ETLIRL+TAHAK R  K V  +DAEAA +LV YA FK+VL+K KKR +   ESD++ E+T 
Sbjct:    4 VTELDDQEMREAQREYLDFLDDEEDQGIYQSKVRDMISENQYRLIVNINDLRRKNEKRASLLMNNAFEGLIAFQRALKDFVASIDGTYAKQYEDFYIGLEGSFGSKHVTPRTLTSRFLSSVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERKYTDLTSLEA-FPSSAVYPTKDEENNPLETEYGLSIYKDHQTITIQEMPEKAPAGQLPRSVDIILDDDLVDKVKPGDRVQVIGTYRCLPSKQNGYTSASFRTILIACNVIQMSKEVTPVFSADDLAKIKKFSKSHSKDVFEQLSRSLAPSIHGHSYIKKAILCMLLGGVEKVLDNGTRIRGDINVLLIGDPSVAKSQLLRYVLFTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEHDREISDHVLRMHRYRSAGEQDGDALPLGSAVDILATEDPNVTSEEQQEL---QVYEKHDSLL---HGVKKRREKVLSMEFMRKYIHVAKIFKPVLTQEAASFIAEEYTRLRNQD-QMSTDVA-----RTSPVTARSLETLIRLSTAHAKVRMSKTVQLQDAEAALELVQYAYFKKVLEKEKKRRRREGESDTEEEQTQ 679          
BLAST of SMED30026560 vs. TrEMBL
Match: A0A4Z2D7F0 (DNA helicase OS=Schistosoma japonicum OX=6182 GN=EWB00_003802 PE=3 SV=1)

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 443/831 (53.31%), Postives = 570/831 (68.59%), Query Frame = -3
Query:   61 MTDITDQESYQAESAYLNFLDSEIKYQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDES---------------KPTKTDEIFEKSNKFAVEKHGQ---YFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKY----RTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPLNESD----SDGEETNGIIEDMATTSIRSNKKQRT-------------------------AEHAXXXXXXXXXXXXXXINNFKISVSRTFQDARVDFMDLNTLIVALQQIHPDVNAAGITALLRKLDADSKIMMTDNEVYII 2400
            M    D    ++E  Y+ FLD   +Y+DRI  LI +   RL+I++NDLR     R  KLL+   +EI++ Q A+KKCI NINPD+A T  EFFVGFEGSFGSR +TPRT+ S++LGNMVC+EGIVTK S+++ K+V SVHYCPATKK +ER Y DLTSL P    G  YPTKD+ GN+LETEYGLS Y D QT+T+QEMPE AP GQLPRSI+ +LDNDLVD  + GDR+ + G YRC+PGKK GFTTA FRT++IANNV S++K +   F   D   +R ++K+ D++ LLTRSIAPSICGHE IK+A+L  LLGGVER L NG+RIRGDIN+L++GDPSVAKSQ LRFVL  A  RAIATTGRG+SGVGLTAAV  D E+GER LEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGI A+LNARCSVLAAANPVYG+YDQ+KTPMENIGLQDSLLSRFDLLFI++D++D   DR IAE V ++H+YR PG+++GEAL LQ    +   G + L+                   +  + D+++E+ N+F +   G+     T +FL+KYIH ARQL+P+L++EA++IL +KYCDLR+QE   +    G  +     RTQP+TAR++ETLIRL+TAHAKAR  K V+ KDAEAA  L+S+ +FKEVL+K+ +R +  NE D    SD E  NG  +D      + + K+R                          +E     +     + Q         +SR FQ+ RV+ + +  +   ++      N + I A L  +  D++IM+  ++V++I
Sbjct:    1 MNQTVDHSLIESEREYVEFLDETDEYKDRINALITRDGIRLMININDLRRQNSGRANKLLENTCSEIVACQRAIKKCIQNINPDFAKTKHEFFVGFEGSFGSRHVTPRTLNSKFLGNMVCLEGIVTKASLIRPKVVCSVHYCPATKKTIERRYADLTSLEPYPSVGI-YPTKDDEGNLLETEYGLSVYSDHQTLTIQEMPETAPVGQLPRSIDALLDNDLVDAVQPGDRVQIVGHYRCLPGKKNGFTTANFRTVIIANNVQSLSKETGPNFSEKDISMMRLISKRNDVISLLTRSIAPSICGHEHIKQAILLLLLGGVERHLTNGSRIRGDINLLLMGDPSVAKSQFLRFVLHIAH-RAIATTGRGSSGVGLTAAVTADMETGERSLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIQAKLNARCSVLAAANPVYGKYDQYKTPMENIGLQDSLLSRFDLLFIVLDKADPDSDRTIAEHVLKIHRYRGPGEQEGEALPLQCGMHLLTTGADPLTTISQGDHDDDDVDGGDISRRQQEEDQVYEQHNEFLIPSRGRKQDQLTIKFLQKYIHVARQLKPQLTKEAASILAEKYCDLRAQEASEAIGRPGRGEQNRMRRTQPITARSLETLIRLSTAHAKARMSKTVTKKDAEAAVQLLSFVLFKEVLEKT-RRKRDRNEDDGVNESDNESENG--DDTERNIPQQSAKRRPVVSGSQSAPDPNDPYAFADDPIVARSEPLAETVPISSALHQERTAQISTMISRIFQERRVEQLTVTEITNIVRSRGSGFNQSDIRATLESMHKDNRIMLAGDDVWLI 826          
BLAST of SMED30026560 vs. TrEMBL
Match: A0A183MJT9 (DNA helicase OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS16314 PE=3 SV=1)

HSP 1 Score: 810.446 bits (2092), Expect = 0.000e+0
Identity = 445/833 (53.42%), Postives = 571/833 (68.55%), Query Frame = -3
Query:   61 MTDITDQESYQAESAYLNFLDSEIKYQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELS------------DDESKPTKTDEIFEKSNKFAVEKHGQ---YFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVE--MSNNESGANK--YRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKK-------------------------------RTKPL---NESDSDGEETNGIIEDMATTSIRSNKKQRTAEHAXXXXXXXXXXXXXXINNFKISVSRTFQDARVDFMDLNTLIVALQQIHPDVNAAGITALLRKLDADSKIMMTDNEVYII 2400
            M    D    ++E  Y+ FLD   +Y+DRI +LI +   RL+I++NDLR     R +KLL+   +EI++ Q A+KKCI N NPD+A T  EFFVGFEGSFGSR +TPRT+ S+ LGNMVC+EGIVTK S++  K+V SVHYCPATKK +ER Y DLTSL P    GA YPTKD+ GN+LETEYGLS Y D QTIT+QEMPE APAGQLPRSI+ +LDNDLVD  + GDR+ V G YRC+PGKK GFTTA FRT++IANNV S++K +  +F   D   +R ++K+ D++ LLTRSIAPSICGHE IK A+L  LLGGVER L NG+RIRGDIN+L++GDPSVAKSQ LRFVL  A  RAIATTGRG+SGVGLTAAV TD E+GER LEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGI A+LNARCSVLAAANPVYG+YDQ+KTPMENIGLQDSLLSRFDLLFI++D++D   DR IAE V ++H+YR PG+++GEAL L     +   G + L+            D+ S+  + D+++E+ N+F +   G+     T +FL+KYIH ARQL+P+L++EA++IL +KYCDLR+QE    MS    G      RTQP+TAR++ETLIRL+TAHAKAR  K V+ KDAEAA  L+S+ +FKEVL+K+++                               + +P+   N+S  D  +     ED   T        RT E     +     + Q   +     +SR FQ+ RV+ + +  +   +Q      + + +   L  +  D++IM+  ++V++I
Sbjct:    1 MDQTMDHSLIESEREYVEFLDETDEYKDRINSLITRDGIRLMININDLRRQNSGRAKKLLENTCSEIVACQRAVKKCIQNTNPDFAKTKHEFFVGFEGSFGSRHVTPRTLNSKLLGNMVCLEGIVTKASLIHPKVVCSVHYCPATKKTIERRYADLTSLEPYPFVGA-YPTKDDEGNLLETEYGLSVYSDHQTITIQEMPETAPAGQLPRSIDALLDNDLVDAVQPGDRVQVVGHYRCLPGKKNGFTTANFRTVIIANNVQSLSKETGPSFSEKDISMMRLISKRNDVISLLTRSIAPSICGHEHIKEAILLLLLGGVERQLTNGSRIRGDINLLLMGDPSVAKSQFLRFVLHIAH-RAIATTGRGSSGVGLTAAVTTDMETGERSLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIQAKLNARCSVLAAANPVYGKYDQYKTPMENIGLQDSLLSRFDLLFIVLDKADPDSDRAIAEHVLKIHRYRGPGEQEGEALQLHCATHLLTTGADPLTIVSQDDHDDDLDDNSSRRQEEDQVYEQQNEFLLPSRGRKQDQLTIKFLQKYIHVARQLKPQLTKEAASILAEKYCDLRAQEASETMSRPNRGEQNRMRRTQPITARSLETLIRLSTAHAKARMSKTVTKKDAEAAVQLISFVLFKEVLEKTRRKRDRHLDDDDKDSDEGENADGAERSHSQQPAKRRPVATGNDSAPDPNDPYAFTEDPTVT--------RT-EPLAETVPISSALQQERTSQLSTMISRIFQERRVEQLTVTEITNVVQSRGGGFSQSDVRITLESMHKDNRIMLAGDDVWLI 822          
BLAST of SMED30026560 vs. TrEMBL
Match: A0A430QE77 (DNA helicase OS=Schistosoma bovis OX=6184 GN=DC041_0009047 PE=3 SV=1)

HSP 1 Score: 806.594 bits (2082), Expect = 0.000e+0
Identity = 419/680 (61.62%), Postives = 518/680 (76.18%), Query Frame = -3
Query:  418 MTDITDQESYQAESAYLNFLDSEIKYQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELS------------DDESKPTKTDEIFEKSNKFAVEKHGQ---YFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVE--MSNNESGANK--YRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKS 2400
            M    D    ++E  Y+ FLD   +Y+DRI +LI +   RL+I++NDLR     R +KLL+   +EI++ Q A+KKCI N NPD+A T  EFFVGFEGSFGSR +TPRT+ S+ LGNMVC+EGIVTK S++  K+V SVHYCPATKK +ER Y DLTSL P    GA YPTKD+ GN+LETEYGLS Y D QTIT+QEMPE APAGQLPRSI+ +LDNDLVD  + GDR+ + G YRC+PGKK GFTTA FRT++IANNV S++K +  +F   D   +R ++K+ D++ LLTRSIAPSICGHE IK A+L  LLGGVER L NG+RIRGDIN+L++GDPSVAKSQ LRFVL  A  RAIATTGRG+SGVGLTAAV TD E+GER LEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGI A+LNARCSVLAAANPVYG+YDQ+KTPMENIGLQDSLLSRFDLLFI++D++D   DR IAE V ++H+YR PG+++GEAL L     +   G + L+             + S+  + D+++E+ N+F +   G+     T +FL+KYIH ARQL+P+L++EA++IL +KYCDLR+QE    MS    G      RTQP+TAR++ETLIRL+TAHAKAR  K V+ KDAEAA  L+S+ +FKEVL+K+
Sbjct:    1 MDQTMDHSLIESEREYVEFLDETDEYKDRINSLITRDGIRLMININDLRRQNSGRAKKLLENTCSEIVACQRAVKKCIQNTNPDFAKTKHEFFVGFEGSFGSRHVTPRTLNSKLLGNMVCLEGIVTKASLIHPKVVCSVHYCPATKKTIERRYADLTSLEPYPFVGA-YPTKDDEGNLLETEYGLSVYSDHQTITIQEMPETAPAGQLPRSIDALLDNDLVDAVQPGDRVQIVGHYRCLPGKKNGFTTANFRTVIIANNVQSLSKETGPSFSEKDISMMRLISKRNDVISLLTRSIAPSICGHEHIKEAILLLLLGGVERQLTNGSRIRGDINLLLMGDPSVAKSQFLRFVLHIAH-RAIATTGRGSSGVGLTAAVTTDMETGERSLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIQAKLNARCSVLAAANPVYGKYDQYKTPMENIGLQDSLLSRFDLLFIVLDKADPDSDRAIAEHVLKIHRYRGPGEQEGEALQLHCATHLLTTGADPLTIVSQDDHDDDLDGNSSRRQEEDQVYEQQNEFLLPSRGRKQDQLTIKFLQKYIHVARQLKPQLTKEAASILAEKYCDLRAQEASETMSRPNRGEQNRMRRTQPITARSLETLIRLSTAHAKARMSKTVTKKDAEAAVQLISFVLFKEVLEKT 678          
BLAST of SMED30026560 vs. TrEMBL
Match: A0A075A3E8 (DNA helicase OS=Opisthorchis viverrini OX=6198 GN=T265_00045 PE=3 SV=1)

HSP 1 Score: 806.594 bits (2082), Expect = 0.000e+0
Identity = 448/809 (55.38%), Postives = 577/809 (71.32%), Query Frame = -3
Query:   61 MTDITDQESYQAESAYLNFLDSEIKYQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELS----------DDESKPTKTDEIFEKSNKFAVEKHGQ---YFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESG----ANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPLNESDSDGEETNGIIEDMA-------TTSIRSNKKQRTAEHAXXXXXXXXXXXXXXINNFKIS-----VSRTFQDARVDFMDLNTLIVALQQIHPDVNAAGITALLRKLDADSKIMMTDNEVYII 2400
            M    DQ    +E  YL FLD   +Y+DRI +LI +   RLII++NDLR    DR ++LL  + TE+I+ Q ALKKCI N+NPDYA    +FFVGFEGSFGS+ +TPRT+TS+ LG+MVC+EGIVTK S+++ KIV SVHYCPATKK +ER Y DLTSL     +G  YPTKDE GN+LETEYGLS Y+D QT+T+QEMPE APAGQLPRS++V+LD+DLVD  + GDR+ V GQYRC+PGKK G+T+A FRT+LIANN+ S++K+S  +F   D   +R +AK+ D++ LLTRS+APSI GH+ IK+A+L  LLGGVER L NG+RIRGDIN+L++GDPSVAKSQ LRFVL  A  RAIATTGRG+SGVGLTAAV TD E+GER LEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTI+KAGI A+LNARCSVLAAANPVYG YDQ+KTPMENIGLQDSLLSRFDLLFII+D++D   DR IAE V RMH+YR P +++GEAL LQ   ++   G + LS          D  ++    D+++E  N       G+     T +FL+KYIH ARQL+P+L++EA++IL +KYCDLRSQE  +S+   G    +   RTQP+TAR++ETLIRLATAHAKAR  K V+ KDAEAA  ++S+ +FKEVL+K +KR +   E     +E    +E          T+++ S+     A+  +             +++ ++      VSR FQ+ RV+ + +  L   + Q     N A I A L  + A++++M+T ++V++I
Sbjct:    1 MEATVDQTLVDSERDYLEFLDETEEYKDRINSLITRDATRLIININDLRRENPDRCKRLLTNSSTELIACQKALKKCIQNVNPDYAKQKYDFFVGFEGSFGSKHVTPRTLTSKLLGHMVCLEGIVTKASLIRPKIVCSVHYCPATKKSIERRYADLTSLEAYPSSGI-YPTKDENGNLLETEYGLSVYQDHQTLTIQEMPETAPAGQLPRSVDVLLDHDLVDAVQPGDRVQVVGQYRCLPGKKSGYTSANFRTVLIANNIQSLSKDSGPSFSDKDISMMRLIAKRTDVVSLLTRSVAPSIHGHDHIKKAILLLLLGGVERQLTNGSRIRGDINLLLMGDPSVAKSQFLRFVLHVAH-RAIATTGRGSSGVGLTAAVTTDMETGERHLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTIAKAGIQAKLNARCSVLAAANPVYGNYDQYKTPMENIGLQDSLLSRFDLLFIILDKADPETDRAIAEHVLRMHRYRGPREQEGEALPLQNMARLLSTGTDPLSAAAQDEADEDDSGTRQRDEDQVYEPHNDLLQPGRGRGSDKLTIKFLQKYIHVARQLKPQLTQEAASILAEKYCDLRSQEGAVSDGRFGGVDQSRMRRTQPITARSLETLIRLATAHAKARMSKTVTKKDAEAAVQILSFVLFKEVLEKRRKRDRNAAEDGESEDEGEVTVESRPAKRKVTKTSAVDSDDPYAFADEPEPSTTATQPTTSGALSSDRLRQLSTLVSRLFQERRVEQLPIGELTSTIIQQGTGFNQAEIRAGLEAMHAENRVMLTPDDVWLI 807          
BLAST of SMED30026560 vs. TrEMBL
Match: A0A419PHL0 (DNA helicase OS=Clonorchis sinensis OX=79923 GN=Mcm3 PE=3 SV=1)

HSP 1 Score: 806.594 bits (2082), Expect = 0.000e+0
Identity = 452/815 (55.46%), Postives = 574/815 (70.43%), Query Frame = -3
Query:   61 MTDITDQESYQAESAYLNFLDSEIKYQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELS----------DDESKPTKTDEIFEKSNKFAVEKHGQ---YFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESG----ANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPLNESDSDGEETNGIIEDMATTSIRSNKKQRT------------------AEHAXXXXXXXXXXXXXXINNFKISVSRTFQDARVDFMDLNTLIVALQQIHPDVNAAGITALLRKLDADSKIMMTDNEVYII 2400
            M    DQ    +E  YL FLD   +Y+DRI +LI +   RLII++NDLR    DR ++LL  + +E+I+ Q ALKKCI N+NPDYA    +FF+GFEGSFGS+ +TPRT+TS+ LG+MVC+EGIVTK S+++ KIV SVHYCPATKK +ER Y DLTSL     +G  YPTKDE GN+LETEYGLS Y+D QT+TVQEMPE APAGQLPRS++V+LD+DLVD  + GDR+ V GQYRC+PGKK G+T+A FRT+LIANN+ S++K+S  +F   D   +R +AK+ D++ LLTRS+APSI GH+ IK+A+L  LLGGVER L NG+RIRGDIN+L++GDPSVAKSQ LRFVL  A  RAIATTGRG+SGVGLTAAV TD E+GER LEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTI+KAGI A+LNARCSVLAAANPVYG YDQ+KTPMENIGLQDSLLSRFDLLFII+D++D   DR IAE V RMH+YR P +++GEAL LQ   ++   G + LS          D  ++    D+++E  N       G+     T +FL+KYIH ARQL+P+L++EA++IL +KYCDLRSQE  +S+   G    +   RTQP+TAR++ETLIRLATAHAKAR  K V+ KDAEAA  L+S+ +FKEVL+K +KR +      S  E+     ED  T   R  K++ T                     A  +      +    +      VSR FQ+ RV+ + +  L  A+ Q     N A I A L  + A++++M+T ++V++I
Sbjct:    1 MEATVDQTLVDSERDYLEFLDETEEYKDRINSLITRDATRLIININDLRRENPDRCKRLLTNSSSELIACQKALKKCIQNVNPDYAKQKYDFFIGFEGSFGSKHVTPRTLTSKLLGHMVCLEGIVTKASLIRPKIVCSVHYCPATKKCIERRYADLTSLEAYPSSGV-YPTKDESGNLLETEYGLSVYQDHQTLTVQEMPETAPAGQLPRSVDVLLDHDLVDAVQPGDRVQVVGQYRCLPGKKSGYTSANFRTVLIANNIQSLSKDSGPSFSDKDISMMRLIAKRTDVVSLLTRSVAPSIHGHDHIKKAILLLLLGGVERQLTNGSRIRGDINLLLMGDPSVAKSQFLRFVLHVAH-RAIATTGRGSSGVGLTAAVTTDMETGERHLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTIAKAGIQAKLNARCSVLAAANPVYGNYDQYKTPMENIGLQDSLLSRFDLLFIILDKADPETDRAIAEHVLRMHRYRGPREQEGEALPLQNMARLLSTGTDPLSAAAQDEADEDDSGTRQRDEDQVYEPHNDLLQPGRGRGSDKLTIKFLQKYIHVARQLKPQLTQEAASILAEKYCDLRSQEGAISDGRFGGADQSRMRRTQPITARSLETLIRLATAHAKARMSKTVTKKDAEAAVQLLSFVLFKEVLEKRRKRDR------SAAEDGESEDEDEVTEESRPAKRKVTKTPAVDSDDPYAFVDEPGPATAVTQPTTSGALSSDRLRQLSTLVSRLFQERRVEQLPIGELTSAIIQQGTGFNQAEIRAGLEAMHAENRVMLTPDDVWLI 807          
BLAST of SMED30026560 vs. Ensembl Cavefish
Match: mcm3l (maternal DNA replication licensing factor mcm3-like [Source:NCBI gene;Acc:103027693])

HSP 1 Score: 719.924 bits (1857), Expect = 0.000e+0
Identity = 384/679 (56.55%), Postives = 504/679 (74.23%), Query Frame = -3
Query:  313 YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHG------QYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPLNESDSDGEETNGIIEDMATTSIRSNKKQ 2325
            Y ++++ ++ +G  RLII++NDLR     R ++LL   F+E+++ Q ALK  +A+I+  YA  ++EF VGFEGSFG++ ++PRT+++ +LGN+VC+EGIVTK S+++ KI+ SVHYCPATKK LER YTDLTSL+    + A YPTKDE  N LETE+GL  YKD QT+T+QEMPE APAGQLPRS+++I ++DLVD  K GDR+ + G YRC+P K+GGFT+  FRTIL+ NNV  ++K    TF   D  KI+   K   KD+ + L+RS+APSI GHE+IK+A+LC LLGG E  L NGTRIRGDINIL++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGI ARLNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLFI++DQ D   DREI+E V RMH+YRPPG+++G A+ L +T  +D    E+ +  E+   +  +I+EK +      HG      +  T +F+ KYIH A+ ++P L++EAS+ + ++Y  LR      S+++  ++  RT PVTAR +ET+IRLATAHAKAR  K +  +DAE A +L+ +A FK++L+K+KKR       DS  + T    +   T S RS +K+
Sbjct:   30 YHEKVRNMVSEGQSRLIININDLRRRNEKRAKELLTNAFSELVAFQRALKDLVASIDATYAKQFDEFHVGFEGSFGNKHVSPRTLSARFLGNLVCVEGIVTKCSLVRPKIMRSVHYCPATKKSLERKYTDLTSLDA-FPSSAVYPTKDEENNPLETEFGLCCYKDHQTLTIQEMPEKAPAGQLPRSVDIIANDDLVDKVKPGDRVQLVGVYRCLPAKQGGFTSGTFRTILLTNNVKLMSKEIVPTFSADDVAKIKKFCKTHSKDVFEHLSRSLAPSIHGHEYIKKAILCLLLGGNETNLENGTRIRGDINILLIGDPSVAKSQLLRYVLFTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIQARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIVLDQMDPDCDREISEHVLRMHRYRPPGEQEGTAMPLGST--VDIFATEDPNITEAAEQEL-QIYEKKDNVL---HGHRKQKEKVVTMEFIRKYIHVAKLVKPVLTQEASDYIAEEYSKLR------SHDQVNSDSARTMPVTARALETMIRLATAHAKARMSKTIDLRDAETALELMQFAYFKKILEKTKKRKLSDENVDSQMDRT----QSEETQSQRSVRKR 690          
BLAST of SMED30026560 vs. Ensembl Cavefish
Match: mcm3 (minichromosome maintenance complex component 3 [Source:ZFIN;Acc:ZDB-GENE-020419-4])

HSP 1 Score: 719.539 bits (1856), Expect = 0.000e+0
Identity = 387/740 (52.30%), Postives = 513/740 (69.32%), Query Frame = -3
Query:   61 RVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKK--KDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHG----QYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSN-------NESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPLNESDSDGEETNGIIEDMATTSIRSNKKQRTAEHAXXXXXXXXXXXXXXINNFKISVSRTFQDARVDFMDLNTLIVALQQI-HPDVNAAGITALLRKLDADSKIMMTDNEVYII 2238
            R  KL+   F E+++ Q ALK  +A+++  YA  +EEFF+G EGSFGS+ ++PRT+TS  LG+MVC+EGIVTK S+++ K+V SVHYCPATKK LER YTD+TSL+    + A YPTKDE  N LETE+GLS YKD QTITVQEMPE APAGQLPRS+++ILDND+VD  K GDR+ V G YRC+PGKKGGFT+  FRTI+IA  V  ++K     F   D  KIR+ +K   K++ D L RS+APSI GHE+IK+A+LC LLGGVE++L NG+RIRGDIN+L++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVL DRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGIHARLNARCSVLAAANPVYGRY+Q+KTPMENIGLQDSLLSRFDLLFI++DQ D   DREI++ V RMH+YR P +++G AL+L  T  +    + + + +E       +++EK N      HG    +  +K+F+ KYIH A+ + P L++EA+N + ++Y  LR+Q+   S+        +   N   T PVTART+ETLIRL+TAHAKAR  K V   D E A +LV +A FK+VL+K +KR +   + D D            + S    +++ T         +        +  FK ++   F+ A    + +N L+  + +      + A +   L ++  D+++M+ D+ +++I
Sbjct:   61 RAAKLMNNAFEELLAFQRALKDVVASVDATYAKQFEEFFIGLEGSFGSKHVSPRTLTSRLLGSMVCVEGIVTKCSLVRPKVVRSVHYCPATKKTLERKYTDMTSLDA-FPSSAIYPTKDEENNPLETEFGLSIYKDHQTITVQEMPEKAPAGQLPRSVDIILDNDMVDGAKPGDRVQVVGTYRCLPGKKGGFTSGTFRTIMIACQVKQMSKEVTPYFSADDVAKIRNFSKSRTKNVFDQLARSLAPSIHGHEYIKKAILCLLLGGVEKVLENGSRIRGDINVLLIGDPSVAKSQLLRYVLHTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLGDRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYNQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHRYRDPHEQEGAALALGGTVDVLATDDPDAAQEEEGEL---QVYEKHNHLL---HGNRRDRIVSKEFMRKYIHVAKAISPVLTQEAANHIAEEYARLRNQDQLGSDIARDNICLKPSVNINPTSPVTARTLETLIRLSTAHAKARMSKSVDLVDTEVAVELVQFAYFKKVLEKERKRAR---KGDQD------------SASEDEEEEEETQGTPTAAEKEFCTFFFFRLKEFKAALLEVFRSAHAQSVGMNALMEGVNKTCSTPFDQAEVRTALGRMQDDNQVMVADDIIFLI 777          
BLAST of SMED30026560 vs. Ensembl Cavefish
Match: mcm3l (maternal DNA replication licensing factor mcm3-like [Source:NCBI gene;Acc:103027693])

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 371/641 (57.88%), Postives = 484/641 (75.51%), Query Frame = -3
Query:  427 YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHG------QYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVL 2325
            Y ++++ ++ +G  RLII++NDLR     R ++L+     E+++ Q ALK  +A+I+  YA  ++EF VGFEGSFG++ ++PRT+++ +LGN+VC+EGIVTK S+++ KI+ SVHYCPATKK LER YTDLTSL+    + A YPTKDE  N LETE+GL  YKD QT+T+QEMPE APAGQLPRS+++I ++DLVD  K GDR+ + G YRC+P K+GGFT+  FRTIL+ NNV  ++K    TF   D  KI+   K   KD+ + L+RS+APSI GHE+IK+A+LC LLGG E  L NGTRIRGDINIL++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGI ARLNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLFI++DQ D   DREI+E V RMH+YRPPG+++G A+ L +T  +D    E+ +  E+   +  +I+EK +      HG      +  T +F+ KYIH A+ ++P L++EAS+ + ++Y  LR      S+++  ++  RT PVTAR +ET+IRLATAHAKAR  K +  +DAE A +L+ +A FK+VL
Sbjct:   32 YHEKVRNMVSEGQSRLIININDLRRRNEKRAKELVN-ELYELVAFQRALKDLVASIDATYAKQFDEFHVGFEGSFGNKHVSPRTLSARFLGNLVCVEGIVTKCSLVRPKIMRSVHYCPATKKSLERKYTDLTSLDA-FPSSAVYPTKDEENNPLETEFGLCCYKDHQTLTIQEMPEKAPAGQLPRSVDIIANDDLVDKVKPGDRVQLVGVYRCLPAKQGGFTSGTFRTILLTNNVKLMSKEIVPTFSADDVAKIKKFCKTHSKDVFEHLSRSLAPSIHGHEYIKKAILCLLLGGNETNLENGTRIRGDINILLIGDPSVAKSQLLRYVLFTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIQARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIVLDQMDPDCDREISEHVLRMHRYRPPGEQEGTAMPLGST--VDIFATEDPNITEAAEQEL-QIYEKKDNVL---HGHRKQKEKVVTMEFIRKYIHVAKLVKPVLTQEASDYIAEEYSKLR------SHDQVNSDSARTMPVTARALETMIRLATAHAKARMSKTIDLRDAETALELMQFAYFKKVL 657          
BLAST of SMED30026560 vs. Ensembl Cavefish
Match: mcm4 (minichromosome maintenance complex component 4 [Source:ZFIN;Acc:ZDB-GENE-030131-9544])

HSP 1 Score: 288.886 bits (738), Expect = 9.080e-85
Identity = 193/569 (33.92%), Postives = 290/569 (50.97%), Query Frame = -3
Query:  418 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGK---KGGFTTAVFRTILIA--------NNVYSINK-NSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTR--IRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQ-LQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKS 2079
            R++  E +  ++ I G+V + S +  ++  +   C          ++    ++   +A  A        + L   +  S + D Q I +QE PE+ PAGQ P +  V   NDLVD  + GDR+ + G YR  P +   +     +V++T + A          ++S+++ N    F       ++++A K D+ + L+ ++APSI  HE IK+ +L QL GG  +      R   R ++NIL+ GDP  +KSQ+L++V      R   T+G+G+S VGLTA V+ D E+ +  L+ GA+VL+D GI CIDEFDKMSD  R+ +HEVMEQ  ++I+KAGI  +LNAR S+LAAANPV  +++  KT +ENI L  +LLSRFDL+F+++D  DE  DR +A  +               AL  Q+  QI                             VE   +Y     L+ YI  AR  + P+LS EAS  L + Y D+R    ++ +     + Y       R +E+LIRLA AHAK RF   V   D E A  L      +E LK+S
Sbjct:  224 RSLNPEDIDQLITISGMVIRTSQLIPEMQEAFFRCQVCA------FSTRVEVDRGRIAEPAVCRHCNTTHSLALVHNRSVFSDKQMIKLQESPEDMPAGQTPHTTVVYAHNDLVDKVQPGDRVNITGIYRAAPMRVNPRQSQVKSVYKTHIDAIHFRKTDERRLHSLDEENEQKLFTEERVATLKELAAKPDVYERLSSALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRGNFRAEVNILLCGDPGTSKSQLLQYVFNLV-PRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLV--------------ALYYQSEEQI-----------------------------VE---EYLDMAVLKDYIAYARTYINPRLSEEASQALIEAYVDMR----KIGSGRGMVSAY------PRQLESLIRLAEAHAKVRFSDKVETIDVEEAKRL-----HREALKQS 724          
BLAST of SMED30026560 vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 289.271 bits (739), Expect = 2.247e-84
Identity = 193/544 (35.48%), Postives = 279/544 (51.29%), Query Frame = -3
Query:  466 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTA----VFRTILIANNVYSINKNSATT-FEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKY-IHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAA 2079
            R++   +L  ++   G+VT  + +  ++    + C      L  ++    S N  +  G+  P    +G   E     + Y+++Q IT+QE P    AG+LPRS + IL  DLVD CK GD I + G Y       G    A    VF T+++AN++   +   A       D   I  ++K + I + +  SI PSI GHE IKR +   L GG  +      ++RGDIN+LM GDP  AKSQ L++V + A  RA+ TTG+G S VGLTA V     + E  LEAGA+VLADRG+  IDEFDKM+D DRT+IHE MEQ  ++ISKAGI   L ARC+V+AAANP+ GRYD   T  EN+ L + ++SRFD+L ++ D  D V D  +A FV   H    P  K+G    L+            L +    P                       ++ L KY I+A  +++PKL++   + + + Y DLR + +             + P+T R +E++IR+A AHA+   R  V   D   A
Sbjct:  274 RSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCSFILGPFFQ---SQNQEVKPGSC-PECQSLGP-FEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDHCKPGDEIELTGIYHN--NYDGSLNMANGFPVFATVILANHIARKDDRVAVAELTDEDVKAIVALSKDERIGERIFASIGPSIYGHEDIKRGLALALFGGEAKNPGGKHKVRGDINVLMCGDPGTAKSQFLKYVEKVA-SRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEV---------VLPNSSDVPP--------------------IPQELLRKYIIYAKERVRPKLNQMDQDKVARIYSDLRKESMATG----------SIPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMA 770          
BLAST of SMED30026560 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008164.1 (pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:ENSPMAG00000007367.1 transcript:ENSPMAT00000008164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 308/455 (67.69%), Postives = 378/455 (83.08%), Query Frame = -3
Query:  871 KLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAK--KKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGE 2229
            +LL  +F E+++ Q ALK+ + N++  YA  +E F+VG EGSFG+R L+PRT+TS +LGNMVC+EGIVTK S+++ K+V SVHYCPAT+K +ER Y+DLTSL+    + AAYPTKDE  N LETEYGLS Y+D QTI++QEMPE APAGQLPRS +V+LD+DLVD CK GDR+ V G +RC+PGKK G+T+  FRTILI NNV  +NK    TF G D  KI+  +K   K+I D L++S+APSI GHE+IK+AVLC LLGG E+IL NG+RIRGDIN+L++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVL DRG+VCIDEFDKM+D+DRTAIHEVMEQGRVTI+KAGIHARLNARCSVLAAANP+YGRYDQ+KTPMENIGLQDSLLSRFDLLFI++DQ+D   DREI++ V RMH+YR  G++DG+
Sbjct:    1 RLLNSSFEELLAFQQALKELVGNVDGTYAKQFESFYVGLEGSFGARHLSPRTLTSRFLGNMVCVEGIVTKCSLVRPKVVRSVHYCPATQKSIERKYSDLTSLDA-FPSSAAYPTKDEESNPLETEYGLSIYRDHQTISLQEMPEKAPAGQLPRSADVVLDDDLVDRCKPGDRVQVIGTFRCLPGKKAGYTSGTFRTILIGNNVKQMNKEVVPTFSGEDVNKIKTFSKTHSKNIFDQLSKSLAPSIHGHEYIKKAVLCLLLGGTEKILDNGSRIRGDINVLLIGDPSVAKSQMLRYVLHTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLGDRGVVCIDEFDKMTDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPIYGRYDQYKTPMENIGLQDSLLSRFDLLFIVLDQTDPEYDREISDHVLRMHRYRAVGEQDGD 453          
BLAST of SMED30026560 vs. Ensembl Sea Lamprey
Match: mcm5 (minichromosome maintenance complex component 5 [Source:ZFIN;Acc:ZDB-GENE-021209-1])

HSP 1 Score: 250.751 bits (639), Expect = 5.047e-74
Identity = 168/486 (34.57%), Postives = 243/486 (50.00%), Query Frame = -3
Query:  418 DFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRC------MPGKK-----GGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRV-TISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNE-ELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAAR-QLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKS 1833
            D+QT+ +QE P+  P G++PR +++  D  L D    G+RI V G Y        M GK       G      R + I  +     ++        +  +IR +A    + + + RSIAPSI G   IK+A+   L+GG  + L +G   RGDIN+L+LGDP  AKSQ+L+FV +C+    + T+G+G+S  GLTA+V+ D  +    +E GAMVLAD G+VCIDEFDKM + DR AIHE MEQ  + T+   GI   LN+RCSVLAAAN V+GR+D  K   ENI    ++LSRFD++FII D+ +E  D  +A+ V  +H              L    Q+  V  E ELS                                L+K+I   R +  P++S EA   L  +Y  +RS   E   +    N     P+T R +E ++R++ + AK R +   +    + A  L   +     L  S
Sbjct:   31 DYQTLKLQEAPDAVPHGEMPRHMQLYCDRYLCDRVVPGNRITVMGIYSIKKAFTKMQGKGRDRTGAGIRNPYLRVVGITVDTDGAGRSMGIALHPQEEEEIRQLAASPSVYETIARSIAPSIYGFMDIKKAIASLLIGGSRKRLPDGLTRRGDINLLLLGDPGTAKSQLLKFVERCS-PIGVYTSGKGSSAAGLTASVMRDPATRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISTLRIGGITTTLNSRCSVLAAANSVFGRWDDSKGE-ENIDFMPTILSRFDMIFIIKDEHNEKRDMILAKHVMNVH--------------LNAKTQMQAVEGEIELST-------------------------------LKKFIAYCRSKCGPRMSAEACEKLKNRYVLMRSGAREHDRDRDHRNSI---PITVRQLEAIVRISESQAKMRLQPFATEAHVDEALRLFQVSTLDAALSGS 466          
BLAST of SMED30026560 vs. Ensembl Sea Lamprey
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:ZFIN;Acc:ZDB-GENE-120927-1])

HSP 1 Score: 224.557 bits (571), Expect = 3.187e-62
Identity = 177/564 (31.38%), Postives = 279/564 (49.47%), Query Frame = -3
Query:  442 GNMVCIEGIVTKVSMMK---SKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEM--PENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTT----AVFRTILIANNVYSIN------------KNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRI--RGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQK--DGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYI-HAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAI 2055
            G +V I G V +V  +K   +++  S + C  T++ L   Y   T   P      A         +      L+   D+Q I VQE+   E   AG++PR++E  L +DLVD C  GD I + G  +     +G   +     +F   + A  V +                 A  F   +   ++++  +  +  LL  SI P+I GHE +K  +   L GGV+R   +  RI  RGD ++L++GDP + KSQ+L+ V   A  R +   G  T+  GLT  +  D  SG+  LEAGA+VL D+G+ CIDEFDKM +    A+ E MEQ  ++++KAG+   L AR S++AAANPV G Y++ KT  EN+ +  +LLSRFDL+FI++D  DE  D  ++E V  MH     G++   G ++S      +    +    D     + +D +  +  + A++          L KY+ +A R ++P LS EA+  L   Y +LR Q         G +     P+T R +E+LIRL  A A+   R+  + +DA+   D++ ++ 
Sbjct:  220 GRLVAIRGTVVRVGNIKPLCTRLAFSCNAC-GTEQVLRLPYGKFTL--PTKRVKCADEDCRSRTFMPNRRSQLTETVDWQNIKVQELMHGEQREAGRIPRTVECELTHDLVDSCVPGDVITLTGIVKVASSDEGRNKSNKDKCMFLLYIQAVAVSNTKGQRSDGGGEDTAPGVALDFSLKELYAVQEIQAQPHLFRLLVHSICPTIYGHELVKAGLALALFGGVQRYGTDKNRIPVRGDPHVLIVGDPGLGKSQMLQAVCNIA-PRGVYVCGNTTTTAGLTVTLSKDGPSGDYALEAGALVLGDQGLCCIDEFDKMPN-QHQALLEAMEQQSISLAKAGVVCSLPARTSIVAAANPVCGHYNKSKTVSENLKMGSALLSRFDLVFILVDTPDEERDHVLSEHVMAMHA----GKRMLAGASVSRAAAPGLKLTASSSSDDVLGGLSLSDRLKARRGE-ALDP----VPHSLLRKYVGYARRYVRPCLSAEAAQTLQDFYLELRRQ-------HHGGDG---TPITTRQLESLIRLTEARARLELRENATKEDADDVIDIMKHSF 759          
BLAST of SMED30026560 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006035.1 (pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 gene:ENSPMAG00000005356.1 transcript:ENSPMAT00000006035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.779 bits (556), Expect = 6.119e-61
Identity = 174/552 (31.52%), Postives = 274/552 (49.64%), Query Frame = -3
Query:  466 RQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYT-DLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTA----VFRTILIANNVYSINKNSATTFEGSDFVK--IRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQ--YRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAA 2094
            + L+ R + +  +G +V + G+VT+ + +K  +V + + C       E Y     TS  P  L  +     ++ G  L  +   S +  FQ + +QE  +  P G +PR++ V +  +   + + GD I + G +  +P  K GF       +  T L A+ V  +NK      +  +  +  +R + ++ D  + L  SIAP I GHE +K+A+L  L+GGV+R    G +IRG+INI ++GDP VAKSQ+L ++ + A  R+  TTGRG+SGVGLTAAV+ D  +GE  LE GA+VLAD G+ CIDEFDKM+D DRT+IHEVMEQ  ++I+K       + R  VL       G      +    I L  +LLSRFDLL++I D+ D   D  +A+ +  +HQ  ++PP Q                             T  D                    + + +YI   ++ QP +    ++ +   Y ++R +E  +S +        T   +ART+  ++RL+TA A+ R   VV  +D   A
Sbjct:  144 KPLSVRDVKANSIGRLVTVRGVVTRATEVKPMMVVATYTCDQCGA--ETYQPIASTSFMPLALCPSRDCQTNKSGGRLYLQSRGSKFVKFQELKIQEHSDQVPVGCIPRAMTVCVRGENTRLAQPGDHISITGIF--LPVLKQGFRAMQQGLLSETFLEAHRVVKMNKTEDNELDVEELSESELRQITEE-DFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDRS-PRGMKIRGNINICLMGDPGVAKSQLLCYIDRLA-PRSQYTTGRGSSGVGLTAAVLQDPLTGEMTLEGGALVLADHGVCCIDEFDKMADSDRTSIHEVMEQQTISIAKVTWGVGASTRTRVLQLVGYGRGGGGSCCSRWLGIKLPAALLSRFDLLWLIQDKPDRDNDIRLAQHITYVHQHCHQPPSQH----------------------------TPLD-------------------MKLMRRYIALCQRRQPAVPDTLADYITAAYVEMR-KEARVSKD--------TTFTSARTLLAILRLSTALARLRLVDVVEKEDVNEA 632          
BLAST of SMED30026560 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006014.1 (pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 gene:ENSPMAG00000005356.1 transcript:ENSPMAT00000006014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 212.231 bits (539), Expect = 1.138e-58
Identity = 175/551 (31.76%), Postives = 276/551 (50.09%), Query Frame = -3
Query:  478 RQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYT-DLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTA----VFRTILIANNVYSINKNSATTFEGSDFVK--IRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKA--GIHARLNARCSVLAAANPVYGRYDQF-KTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQ--YRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKD 2094
            + L+ R + +  +G +V + G+VT+ + +K  +V + + C       E Y     TS  P  L  +     ++ G  L  +   S +  FQ + +QE  +  P G +PR++ V +  +   + + GD I + G +  +P  K GF       +  T L A+ V  +NK      +  +  +  +R + ++ D  + L  SIAP I GHE +K+A+L  L+GGV+R    G +IRG+INI ++GDP VAKSQ+L ++ + A  R+  TTGRG+SGVGLTAAV+ D  +GE  LE GA+VLAD G+ CIDEFDKM+D DRT+IHEVMEQ  ++I+K   G+ A   A CS         GR  +        + L  +LLSRFDLL++I D+ D   D  +A+ +  +HQ  ++PP Q                             T  D                    + + +YI   ++ QP +    ++ +   Y ++R +E  +S +        T   +ART+  ++RL+TA A+ R   VV  +D
Sbjct:  144 KPLSVRDVKANSIGRLVTVRGVVTRATEVKPMMVVATYTCDQCGA--ETYQPIASTSFMPLALCPSRDCQTNKSGGRLYLQSRGSKFVKFQELKIQEHSDQVPVGCIPRAMTVCVRGENTRLAQPGDHISITGIF--LPVLKQGFRAMQQGLLSETFLEAHRVVKMNKTEDNELDVEELSESELRQITEE-DFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDRS-PRGMKIRGNINICLMGDPGVAKSQLLCYIDRLA-PRSQYTTGRGSSGVGLTAAVLQDPLTGEMTLEGGALVLADHGVCCIDEFDKMADSDRTSIHEVMEQQTISIAKVTWGVGASTRALCSDGGGRTVAAGRASRIDDCVWLALMLPAALLSRFDLLWLIQDKPDRDNDIRLAQHITYVHQHCHQPPSQH----------------------------TPLD-------------------MKLMRRYIALCQRRQPAVPDTLADYITAAYVEMR-KEARVSKD--------TTFTSARTLLAILRLSTALARLRLVDVVEKED 631          
BLAST of SMED30026560 vs. Ensembl Yeast
Match: MCM3 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex [Source:SGD;Acc:S000000758])

HSP 1 Score: 521.546 bits (1342), Expect = 4.413e-172
Identity = 304/599 (50.75%), Postives = 389/599 (64.94%), Query Frame = -3
Query:  433 LTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLER-YYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGF------TTAVFRTILIANNVYSINKNSA--------TTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEA------LSLQTTNQIDYVGNE----------ELSDDESKPTKTDEIFEKSN-------KFAVEKHGQY--------FTKQFLEKYIHAARQ-LQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKE 2088
            L+PRT+T+++L  +V +EGIVTK S+++ K++ SVHY   T +F  R Y    T+L   +   A YPT+D  GN L TEYG ST+ D Q ITVQEMPE APAGQLPRSI+VILD+DLVD  K GDR+ V G ++ +    GG       T   F+T+++ N VY ++  S         T F   D   I  ++KKKDI D+L++S+APSI GH+ IK+A+L  L+GGVE+ L NG+ +RGDINILM+GDPS AKSQ+LRFVL  A   AIATTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKM+D+DR AIHEVMEQ  VTI+KAGIH  LNARCSV+AAANPV+G+YD  + P +NI L DSLLSRFDLLF++ D  +E+ DR I+E V R H+Y PPG  +GE       LSL      D    E          E  DDE      D +FEK N       K A  K G Y         T  FL KY+  A++ + P+L++EA N++ + Y DLR+ +             +  P+TART+ETLIRLATAHAK R  K V+  DA+ AA+L+ +A+  E
Sbjct:  166 LSPRTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTPAIYPTEDTEGNKLTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKPGDRVNVVGVFKSL--GAGGMNQSNSNTLIGFKTLILGNTVYPLHARSTGVAARQMLTDF---DIRNINKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTA-SLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTHRYLPPGYLEGEPVRERLNLSLAVGEDADINPEEHSNSGAGVENEGEDDE------DHVFEKFNPLLQAGAKLAKNK-GNYNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQEAINVIVKNYTDLRNDD-----------NTKKSPITARTLETLIRLATAHAKVRLSKTVNKVDAKVAANLLRFALLGE 740          
BLAST of SMED30026560 vs. Ensembl Yeast
Match: MCM2 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000000119])

HSP 1 Score: 302.753 bits (774), Expect = 2.498e-90
Identity = 191/487 (39.22%), Postives = 271/487 (55.65%), Query Frame = -3
Query:  454 STYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYR----CMPGKKGGFTTAVFRTILIANNVYSINKNSATTFE-GSDFV--------KIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMH-QYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAV--------EKHGQYFTKQFLEKYIHAAR-QLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLV 1845
            + Y+++Q +T+QE P   P G+LPR  EVIL  DLVD+ K G+ + V G Y+         K GF   VF TI+ AN++     N+A   E G D          + R +++ + I+D +  S+APSI GH  IK AV C L GGV + +     IRGDIN+L+LGDP  AKSQIL++V + A  RA+  TG+G S VGLTA+V  D  + E  LE GA+VLAD+G+  IDEFDKM+D DRT+IHE MEQ  ++ISKAGI   L ARCS++AAANP  GRY+      +N+ L + +LSRFD+L ++ D  DE  D  +A FV   H +  P   +D E   L+        G   +   E      DEI E+ N            E+      ++ L KYIH AR ++ PKL +   + + + Y DLR + +             + P+T R +E+++R+A + AK R  + VS+ D + A  +V
Sbjct:  380 TVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIYKNNYDGNLNAKNGF--PVFATIIEANSIKRREGNTANEGEEGLDVFSWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAH-RAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKNN------GESAIEQGE------DEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQMDMDKVSRVYADLRRESISTG----------SFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKVV 841          
BLAST of SMED30026560 vs. Ensembl Yeast
Match: MCM5 (Component of the Mcm2-7 hexameric helicase complex; MCM complex is important for priming origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation when activated by Cdc7p-Dbf4p in S-phase [Source:SGD;Acc:S000004264])

HSP 1 Score: 291.967 bits (746), Expect = 3.785e-87
Identity = 193/587 (32.88%), Postives = 299/587 (50.94%), Query Frame = -3
Query:  457 QLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGL--------------------------STYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKG---------------GFTTAVFRTILIANNVYSIN-KNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADL 2091
            Q+  R + SE++  +V + GI+   S++ S+  +    C        R+ T +T  N N + G          + +E+E  +                          S + D Q + +QE+PE  P G++PR++ +  D  L +    G R+ + G Y     K G                  T   + + I ++V + +  NS T F   +  +   +++   + ++LT SIAPSI G+E IK+A++C L+GG ++IL +G R+RGDIN+L+LGDP  AKSQ+L+FV + +   A+ T+G+G+S  GLTA+V  D  + E  LE GAMVLAD G+VCIDEFDKM D DR AIHE MEQ  ++I+KAGI   LN+R SVLAAANP+YGRYD  K+P +NI  Q ++LSRFD++FI+ D  +E  D  IA  V  +H         G A ++Q  NQ +  G+E                      ++EK  +Y T        +   +  P+LS +A+  L   +  +R Q   +  NE  + +  + P+T R +E +IR+  + AK     +   +  + A  L
Sbjct:  145 QIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNC-----RHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDPYIIIHESSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIYSIYNSKNGAGSGRSGGGNGGSGVAIRTPYIKILGIQSDVETSSIWNSVTMFTEEEEEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVS-PIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHT--------GNANAMQ--NQQEENGSE---------------------ISIEKMKRYIT--------YCRLKCAPRLSPQAAEKLSSNFVTIRKQ---LLINELESTERSSIPITIRQLEAIIRITESLAKLELSPIAQERHVDEAIRL 683          
BLAST of SMED30026560 vs. Ensembl Yeast
Match: MCM4 (Essential helicase component of heterohexameric MCM2-7 complexes; MCM2-7 complexes bind pre-replication complexes on DNA and melt DNA prior to replication; forms an Mcm4p-6p-7p subcomplex; shows nuclear accumulation in G1; homolog of S. pombe Cdc21p [Source:SGD;Acc:S000006223])

HSP 1 Score: 290.041 bits (741), Expect = 2.750e-85
Identity = 177/495 (35.76%), Postives = 258/495 (52.12%), Query Frame = -3
Query:  442 TYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMP---------------------------GKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYI-HAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAI 1842
            ++ D Q I +QE P+  P GQ P SI + + ++LVD C++GDRI V G +R +P                            K+    T+     L+ N V              D  KIR++A ++D+  LL RSIAPSI   E +K+ +L QL GG  +    G R RGDINIL+ GDPS +KSQIL++V +    R + T+G+G+S VGLTA +  D ++ +  LE+GA+VL+D G+ CIDEFDKMSD  R+ +HEVMEQ  ++I+KAGI   LNAR S+LA+ANP+  RY+      ENI L   LLSRFDL+++++D+ DE  DRE+A+ +  ++    P                     E +S D+  P                        +FL  YI +A   + P ++  A   L + Y  +R    +M ++     K  T   T R +E++IRLA AHAK + + VV  +D + A  L+  AI
Sbjct:  390 SFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKIT-PRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKP---------------------EHISQDDVLPV-----------------------EFLTMYISYAKEHIHPIITEAAKTELVRAYVGMR----KMGDDSRSDEKRIT--ATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAI 833          
BLAST of SMED30026560 vs. Ensembl Yeast
Match: MCM6 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex; forms a subcomplex with Mcm4p and Mcm7p [Source:SGD;Acc:S000003169])

HSP 1 Score: 270.396 bits (690), Expect = 9.915e-78
Identity = 166/460 (36.09%), Postives = 248/460 (53.91%), Query Frame = -3
Query:  304 LIANNVYSINKNSATTFEGS----DFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLK-----------KSKKRTKPLNESDSDGEETNGIIEDMATTSIRSNKKQRTA 1638
            L ANNVY  N+     F  S    +  ++++M K + I D L RSIAP++ GHE +K+ +L Q+LGGV +  V G ++RGDINI ++GDPS +KSQ L++V+  A  R++ T+G+ +S  GLTAAVV D+E G+  +EAGA++LAD GI CIDEFDKM   D+ AIHE MEQ  ++I+KAGIHA LNAR S+LAAANPV GRY++  +   N+ +   ++SRFDL F+I+D  +E +D E+A  +  +H  R                                    DE  E             F+ + L +YI  AR  +P L++EA + L +KY +LR  + +  +  S    YR   +T R +E++IRL+ A A+A     ++      A DL+  +I +  +            +S+      N  D+D    +G+I       I   + + TA
Sbjct:  488 LQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFA-PRSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMKR------------------------------------DEAIEPP-----------FSAEQLRRYIKYARTFKPILTKEARSYLVEKYKELRKDDAQGFSRSS----YR---ITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDVDDVEMDEEFDNIESQSHAASGNNDDNDDGTGSGVITSEPPADIEEGQSEATA 892          

HSP 2 Score: 53.1434 bits (126), Expect = 1.752e-7
Identity = 31/133 (23.31%), Postives = 57/133 (42.86%), Query Frame = -3
Query: 1681 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMP 2079
            R + SE +G+++ I G VT+ S ++ ++  +   C   +  ++          P      +   +             S + D+Q + +QE     P G +PR+++VIL  D V+  K GDR    G    +P
Sbjct:  277 RDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCPNPSCENR----AFWTLNVTRSRFLDWQKVRIQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVP 405          
BLAST of SMED30026560 vs. Ensembl Nematostella
Match: EDO34425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPE9])

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 402/794 (50.63%), Postives = 548/794 (69.02%), Query Frame = -3
Query:   61 DQESY--QAESAYLNFLDSEIK---YQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKK-KDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAV----EKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTK--PLNESDS-DGEETNGIIEDMA---TTSIRSNKKQRTAE-HAXXXXXXXXXXXXXXINNFKISVSRTFQDARVDFMDLNTLIVALQQIHP--DVNAAGITALLRKLDADSKIMMTDNEVYII 2385
            D E Y    +  YL+FLD +     Y  +++ +I +G  RL++++NDLR     R  KL+  +F E+I+ Q ALK+ ++  N +Y   +EEFFVGFEGSFGS+ +TPR+++S Y+G+MVC+EGIVTK S+++ K+V SVHYCP TKK L R YTD+TSL   +   + YPTKDE GN LETEYGL TYKD QT T+QEMPE APAGQLPRS+++I DNDLVD CK GDR+ V G YRC+P K+ GFT+  FRT+LI NNV  ++K  A  F  SD  KI+  +K  +D+ ++L +S+APSI GHEFIK+AVLC LLGG E++L NGTR+RGDINIL++GDPS AKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD E+G+R LEAGAMVLADRG+VCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHA+LNARCSVLAAANPV+GRYD+FK PM+NIG+QDSLLSRFDLLFI++DQ D   DR I+E V R+H+YR PG+++GEAL      + D +   +   +E    +   ++EK +        +K  ++ +  F++KYIH A+ ++P L++ A++++ + Y +LR QE        G +K +T PVTART+ET+IRL+TAHAKAR  K ++  DA+AA D+VS+A F +V +K  K  +   ++E  S DGE +       A   T   R  KK+   E +   +     +  + ++N FK S+ + F  A    + L+ +  A+ + HP    +       L+ ++ ++KI + +N +++I
Sbjct:    4 DNEQYLRGVQREYLDFLDDDEDQGVYHGKVRDMIDRGETRLLVNINDLRRKNEQRAVKLVNNSFEELIAFQNALKEFVSTANTEYGKKHEEFFVGFEGSFGSKHVTPRSLSSRYIGSMVCVEGIVTKCSLVRPKVVRSVHYCPKTKKTLIRKYTDMTSLEA-VPTSSVYPTKDEDGNPLETEYGLCTYKDHQTFTIQEMPERAPAGQLPRSVDIIADNDLVDKCKPGDRVQVIGTYRCLPSKRSGFTSGTFRTVLIVNNVQVMSKEVAPNFSASDISKIKKFSKSKQDVFEVLAKSLAPSIHGHEFIKKAVLCLLLGGTEKVLENGTRLRGDINILLIGDPSTAKSQMLRYVLHSA-PRAIPTTGRGSSGVGLTAAVTTDPETGDRRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHAKLNARCSVLAAANPVFGRYDEFKNPMDNIGMQDSLLSRFDLLFIVLDQMDPDNDRRISEHVLRIHRYRKPGEQEGEALPF--GEESDVLATRDPDQEEE--DEDTPVYEKHDPMLFGKQKDKKDKFVSMAFMKKYIHVAKAIKPALTKPAADLISKAYSELRDQE------NIGNDKAKTTPVTARTLETMIRLSTAHAKARMSKTITEGDAQAAVDMVSFAYFHKVERKPGKERQGSEIDEDVSEDGEPSQRKRSKGAKKGTKKPRVPKKKEGEEGYDPYDFESDEEETEGELNKFKSSLQQVFTKAHTQTLPLSDVRSAIDRDHPRDKFSEQEFKKALQIMEDENKIYVAENSIFLI 785          
BLAST of SMED30026560 vs. Ensembl Nematostella
Match: EDO28468 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6D7])

HSP 1 Score: 408.297 bits (1048), Expect = 7.721e-136
Identity = 209/360 (58.06%), Postives = 268/360 (74.44%), Query Frame = -3
Query:  682 VDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKK-KDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTD--KESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAV----EKHGQYFTKQFLEKYIHAARQLQ 1740
            V   K GDR+ V G YRC+P K+ GFT+  FRT+LI NNV  ++K  A  F  SD  KI+  +K  +D+ ++L +S+APSI GHEFIK+AVLC LLGG E++L NGTR+RGDINIL++GDPS AKSQ+LR+VL  A  RAI TTGRG+SGVGLTAA +      +G+R LEAGAMVLADRG+VCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHA+LNARCSVLAAANPV+GRYD+FK PM+NIG+QDSLLSRFDLLFI++DQ D   DR I+E V R+H+YR PG+++GEAL      + D +   +    + +  +   ++EK +        +K  ++ +  F++KYIH A+ ++
Sbjct:   10 VFFAKPGDRVQVIGTYRCLPSKRSGFTSGTFRTVLIVNNVQVMSKEVAPNFSASDISKIKKFSKSKQDVFEVLAKSLAPSIHGHEFIKKAVLCLLLGGTEKVLENGTRLRGDINILLIGDPSTAKSQMLRYVLHSA-PRAIPTTGRGSSGVGLTAAYLITFFVFTGDRRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHAKLNARCSVLAAANPVFGRYDEFKNPMDNIGMQDSLLSRFDLLFIVLDQMDPDNDRRISEHVLRIHRYRKPGEQEGEALPF--GEESDVLATRDPD--QEEEDEDTPVYEKHDPMLFGKQKDKKDKFVSMAFMKKYIHVAKAIK 364          
BLAST of SMED30026560 vs. Ensembl Nematostella
Match: EDO35060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMI2])

HSP 1 Score: 289.656 bits (740), Expect = 1.816e-85
Identity = 181/466 (38.84%), Postives = 255/466 (54.72%), Query Frame = -3
Query:  466 STYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYR----CMPGKKGGFTTAVFRTILIANNVYSIN-KNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKY-IHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAA 1845
            + Y+++Q I +QE P    AG+LPR  +VIL  DLVD CK GD I + G Y+        +  GF   VF TI+ AN +   + K + T+    D   I  ++K + I + +  SI PSI GHE IKRA+   L GGV +      +IRGDIN+L+ GDP  AKSQ L++V + A  RA+ TTG+G S VGLTA V     + E  LEAGA+VLAD+G+  IDEFDKM+D DRT+IHE MEQ  ++ISKAGI   L ARCS+LAAANP+ GRYD   T  EN+ L + +LSRFD+L ++ D  D + D  +A FV   H    P                            + P   DE  E  + F + ++     +  L+KY I+A  ++ P+L+    + + + + DLR + +             + P+T R +E++IR+A +HAK   R+ V   D   A
Sbjct:  292 TLYQNYQKIKIQESPSKVAAGRLPRYKDVILMADLVDSCKPGDEIELTGIYKINYDSSLNRSNGF--PVFATIIEANFITKQDDKMAVTSLTDEDIKAINALSKDERIGERIIASIGPSIYGHEDIKRALALSLFGGVAKDPGGKHKIRGDINVLLCGDPGTAKSQFLKYVEKTA-PRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADKGMCLIDEFDKMNDADRTSIHEAMEQQSISISKAGIVTSLQARCSILAAANPIGGRYDPSLTFAENVDLTEPILSRFDILCVVRDTVDAIQDELLARFVVNSHVRHHP----------------------------NTPENEDEDME-VHMFTLRRNA--IPQDLLKKYMIYARERVHPRLNNMDQDKVAKMFADLRKESMATG----------SIPITVRHIESMIRMAESHAKMHLREYVMEDDVNMA 713          
BLAST of SMED30026560 vs. Ensembl Nematostella
Match: EDO37946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEF9])

HSP 1 Score: 283.493 bits (724), Expect = 4.741e-84
Identity = 194/551 (35.21%), Postives = 289/551 (52.45%), Query Frame = -3
Query:  454 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYT-DLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGF---TTAVFR-TILIANNVYSINKNSATTFEGSDFV--KIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQY--RPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLV 2079
            R + ++ +G +  + GIV + + +K  +  + + C       E Y T    +  P L+  +     +  G  L  +   S +  FQ + +QE  +  P G +PRS+ +I   +   +   GD + V G +  +P  K GF   T  +   T L A+ +  +NK         D    +IR ++ + D  D L  S+AP I GHE IK+A+L  L+GGV+    +G +IRG+INIL++GDP VAKSQ+L ++ + A  R+  TTGRG++GVGLTAAV+ D  +GE  LE GA+VLAD+G+ CIDEFDKM D DRTAIHEVMEQ  V+I+KAGI   LNAR S+LAAANP YGRY+  K+  +NI L  +LLSRFDLL++I D+ D+  D  +A+ +  +HQ+   PP   D   ++L                                               + +YI A ++ QP +  E S+ +   Y ++R         +   N + T   +ART+  ++RLATA A+ R   VV  +D   A  L+
Sbjct:  149 RNVKADCIGKLTVVRGIVMRCTEVKPVVEVATYTCDQCGA--ESYQTIQSQTFMPLLMCPSEECKTNRAGGRLYLQTRGSKFVKFQELKIQEHSDQVPVGHIPRSMTIIAKGENTRLATPGDHVSVTGIF--LPMMKTGFRQMTQGLLSDTFLEAHRIVRMNKTEDDEMPTDDLSDEEIRALSTEADFYDKLASSLAPEIYGHEDIKKALLLLLVGGVD-CTPHGMKIRGNINILLMGDPGVAKSQMLSYIDRLA-PRSQYTTGRGSTGVGLTAAVMKDPLTGEMILEGGALVLADKGVCCIDEFDKMMDGDRTAIHEVMEQQTVSIAKAGIMTTLNARVSILAAANPAYGRYNPKKSAEQNIQLPAALLSRFDLLWLIQDKPDKENDLRLAQHITYVHQHSAHPPSHYDPLDMNL-----------------------------------------------MRRYIAACKEKQPIVPGELSDYIVSAYVEMR---------KDARNNHDTTFTSARTLLAVLRLATALARLRLADVVEKEDVNEAMRLM 637          
BLAST of SMED30026560 vs. Ensembl Nematostella
Match: EDO33971 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQR1])

HSP 1 Score: 270.396 bits (690), Expect = 1.914e-78
Identity = 181/594 (30.47%), Postives = 296/594 (49.83%), Query Frame = -3
Query:  436 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMP---------------------------GKKG----GFTTAVFRTILIANNVYSIN-KNSATTFEGSD--------------FVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFK 2079
            R +TS+ +G+++ I G V +   +  ++V +   C   +  ++          P +        +         +   S Y DFQ + +QE     P G +PRS+EVIL  + V+  ++GD+    G    +P                           G +G    G     +R   +A +V + N +      +G D              + KI +M++ K++   +  SI P+I G++ +KR VL  L GGV +  +  T +RGDINI ++GDPS AKSQ L+ V + +  RA+ T+G+ +S  GLTAAVV D+ES E  +EAGAM+LAD G+ CIDEFDKM   D+ AIHE MEQ  ++++KAG+ A LNAR SVLAAANP+ GRYD+ K+  +N+ +   ++SRFDL FI++D+ +EVVD  IA  +  +H  R            Q+  ++                           +AV++         +++Y+  ARQ +P +++EA + + ++Y  LR    E   + +  + +R   +T R +E++IRL+ A A+   +  V  K  + A  L++ +I +
Sbjct:  118 RELTSQKIGSLLRISGQVVRTHPVHPELVTATFTCLDCQTVIKDVEQQFKYTQPTVCRNPICQNRARFA----LDINKSRYVDFQKVRIQETQAELPRGCIPRSVEVILRAEAVEQAQAGDKCDFTGTLIVVPDIAQLATPGTRSETGQRQTSGEGYEAEGVRGLKALGVRDLTYRLSFLACSVQATNPRFGGKDLDGDDMTAEAIKKQMTPQEWQKIYEMSRDKNLYQNIINSIFPTIHGNDEVKRGVLLMLFGGVPKKTLEKTSLRGDINICVVGDPSTAKSQFLKHVEEFSA-RAVYTSGKASSAAGLTAAVVKDEESSEFVIEAGAMMLADNGVCCIDEFDKMDPRDQVAIHEAMEQQTISLTKAGVKASLNARTSVLAAANPIGGRYDRTKSLKQNLNMSAPIMSRFDLFFILVDECNEVVDYAIARRIVDLHSRRE-----------QSVERV---------------------------YAVDE---------VQRYLTFARQFKPTITKEAQDYMVEQYKHLR----ERDGSSTTKSAWR---ITVRQLESMIRLSEAMARLYCQDKVEPKHVKEAYRLLNKSIIR 652          
BLAST of SMED30026560 vs. Ensembl Medaka
Match: mcm3 (minichromosome maintenance complex component 3 [Source:NCBI gene;Acc:101165859])

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 376/624 (60.26%), Postives = 481/624 (77.08%), Query Frame = -3
Query:  382 RVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKK--DILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKF---AVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPLNESDS 2238
            R  KL+   F E+++ Q ALK  +A+++  YA  +EEFFVG EGSFG++ ++PRT+TS  LG+MVC+EGI+TK S+++ K+V SVHYCPATKK +ER YTDLTSL+    + A+YPTKDE  N LETE+GLS YKD QTITVQEMPE APAGQLPRS+++ILDNDLVD+ K GDR+ V G YRC+PGKKGGFT+  FRTI+IA NV  ++K  +  F   D  KIR+ ++ +  ++ D L RS+APSI GHE+IK+A+LC LLGGVE++L NG+RIRGDINIL++GDPSVAKSQ+LR+VL  A  RAI TTGRG+SGVGLTAAV TD+E+GER LEAGAMVLADRG+VCIDEFDKMSD+DRTAIHEVMEQGRVTI+KAGIHARLNARCSVLAAANPVYGRYDQ+KTPMENIGLQDSLLSRFDLLFI++DQ D   DRE+++ V RMH+YR P +++G A++L  T  +    + + + DE +     +I+EK N     +  K  +  +K+F+ KYIH A+ + P L+ EA+N + ++Y  LR QE      + G++  RT PVTART+ETLIRL+TAHAK+R  KVV   D+E A +LV +A FK+VL+K KKR++   +S S
Sbjct:   60 RAAKLMTNAFEELVAFQRALKDLVASVDATYAKQHEEFFVGLEGSFGAKHVSPRTLTSRLLGSMVCVEGIITKCSLVRPKVVRSVHYCPATKKTMERKYTDLTSLDA-FPSSASYPTKDEENNPLETEFGLSIYKDHQTITVQEMPEKAPAGQLPRSVDIILDNDLVDMVKPGDRVQVIGTYRCLPGKKGGFTSGTFRTIMIACNVKQMSKEVSPCFSADDAAKIRNFSQTRSINVFDQLARSLAPSIHGHEYIKKAILCMLLGGVEKVLENGSRIRGDINILLIGDPSVAKSQLLRYVLHTA-PRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIVLDQMDPEQDREVSDHVLRMHRYRDPREQEGTAMALGGTVDVLTTEDPDAAADEREEL---QIYEKHNVLLHGSRRKKDKILSKEFMRKYIHIAKAVTPVLTEEAANHIAEEYSRLRGQE------QLGSDMARTSPVTARTLETLIRLSTAHAKSRISKVVERVDSEVAVELVQFAYFKKVLEKEKKRSRQERDSGS 672          
BLAST of SMED30026560 vs. Ensembl Medaka
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:101173930])

HSP 1 Score: 290.812 bits (743), Expect = 6.478e-85
Identity = 196/540 (36.30%), Postives = 277/540 (51.30%), Query Frame = -3
Query:  466 GNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTA----VFRTILIANNVYSINKNSATT-FEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDG----EALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKY-IHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAA 2055
            G + C  G++ ++SM+K       + C      L  ++    S N  +  G+    + +     E     + Y+++Q IT+QE P    AG+LPRS + IL  DLVD CK GD I + G Y       G    A    VF T+++AN++   ++  A       D   I  ++K + I + +  S+APSI GHE IKRA+   L GG  +      ++RGDIN+L+ GDP  AKSQ L++V + A  RA+ TTG+G S VGLTA V     S E  LEAGA+VLADRG+  IDEFDKM+D DRT+IHE MEQ  ++ISKAGI   L ARC+V+AAANP+ GRYD   T  EN+ L + ++SRFD+L ++ D  D V D  +A FV   H    P  K+G    E + L  T  +              P   D                      L KY I+A  ++ PKL++   + + + Y DLR + +             + P+T R +E++IR+A AHAK   R  V   D   A
Sbjct:  298 GVVSCCTGVLPQLSMVK-------YNCSKCSFVLGPFFQ---SQNQEVKPGSCPECQSQ--GPFEVNMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHN--NYDGSLNMANGFPVFATVILANHISRRDEGVAVAELTDEDVKAIVALSKDECIGERIFASVAPSIYGHEDIKRALALSLFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVA-SRAVFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDADRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFAENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSTKEGGVALEEMVLPNTTDV-------------SPIPQD---------------------LLRKYIIYAKERVHPKLNQMDQDKVARIYSDLRKESMATG----------SIPITVRHIESMIRMAEAHAKMHLRDYVLEDDVNMA 778          
BLAST of SMED30026560 vs. Ensembl Medaka
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:101173977])

HSP 1 Score: 280.411 bits (716), Expect = 1.518e-81
Identity = 177/491 (36.05%), Postives = 263/491 (53.56%), Query Frame = -3
Query:  418 STYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGK---KGGFTTAVFRTILIA--------NNVYSINKNSATTFEGSDFVK-IRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTR--IRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQ-LQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKS 1845
            S + D Q I +QE PE+ PAGQ P +  +   NDLVD  + GDR+ + G YR +P +   +     +V++T + A          ++ ++++        D V+ ++++A K D+ + L  ++APSI  HE IK+ +L QL GG  +      R   R ++NIL+ GDP  +KSQ+L++V      R   T+G+G+S VGLTA V+ D E+ +  L+ GA+VL+D GI CIDEFDKMSD  R+ +HEVMEQ  ++I+KAGI  +LNAR +VLAAANPV  +++  KT +ENI L  +LLSRFDL+F+++D  DE  DR +A  +  +                       Y  +EE  ++E                       +     L+ YI  AR  + P+LS EAS  L + Y D+R    ++ +     + Y       R +E+LIRLA AHAK RF + V   D E A  L      +E LK+S
Sbjct:  339 SVFSDKQMIKIQESPEDMPAGQTPHTTILYAHNDLVDKVQPGDRVNITGIYRAVPMRVHPRQSNVRSVYKTHIDAIHFRKTDEKRLHGLDQDGEQKLFTEDRVQTLKELAAKPDVYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRGNFRAEVNILLCGDPGTSKSQLLQYVYNLV-PRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTAVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSL-----------------------YYQSEEQMEEE-----------------------FLDMAVLKDYIAYARTYISPRLSEEASQALIEAYVDMR----KIGSGRGMVSAY------PRQLESLIRLAEAHAKVRFSEKVETIDVEEAKRL-----HREALKQS 767          
BLAST of SMED30026560 vs. Ensembl Medaka
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:101173977])

HSP 1 Score: 280.026 bits (715), Expect = 1.974e-81
Identity = 177/491 (36.05%), Postives = 263/491 (53.56%), Query Frame = -3
Query:  418 STYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGK---KGGFTTAVFRTILIA--------NNVYSINKNSATTFEGSDFVK-IRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTR--IRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQ-LQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKS 1845
            S + D Q I +QE PE+ PAGQ P +  +   NDLVD  + GDR+ + G YR +P +   +     +V++T + A          ++ ++++        D V+ ++++A K D+ + L  ++APSI  HE IK+ +L QL GG  +      R   R ++NIL+ GDP  +KSQ+L++V      R   T+G+G+S VGLTA V+ D E+ +  L+ GA+VL+D GI CIDEFDKMSD  R+ +HEVMEQ  ++I+KAGI  +LNAR +VLAAANPV  +++  KT +ENI L  +LLSRFDL+F+++D  DE  DR +A  +  +                       Y  +EE  ++E                       +     L+ YI  AR  + P+LS EAS  L + Y D+R    ++ +     + Y       R +E+LIRLA AHAK RF + V   D E A  L      +E LK+S
Sbjct:  303 SVFSDKQMIKIQESPEDMPAGQTPHTTILYAHNDLVDKVQPGDRVNITGIYRAVPMRVHPRQSNVRSVYKTHIDAIHFRKTDEKRLHGLDQDGEQKLFTEDRVQTLKELAAKPDVYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRGNFRAEVNILLCGDPGTSKSQLLQYVYNLV-PRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTAVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSL-----------------------YYQSEEQMEEE-----------------------FLDMAVLKDYIAYARTYISPRLSEEASQALIEAYVDMR----KIGSGRGMVSAY------PRQLESLIRLAEAHAKVRFSEKVETIDVEEAKRL-----HREALKQS 731          
BLAST of SMED30026560 vs. Ensembl Medaka
Match: mcm5 (minichromosome maintenance complex component 5 [Source:NCBI gene;Acc:101167880])

HSP 1 Score: 274.633 bits (701), Expect = 3.732e-80
Identity = 191/575 (33.22%), Postives = 286/575 (49.74%), Query Frame = -3
Query:  418 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTY---------KDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQY--------RCMPGKKG---GFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAAR-QLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKS 2079
            R + SE +  +V + GI+   + +K+K       C   +  +         L P L  G A P K    N    +  +  Y          DFQT+ +QE P+  P G++PR +++  D  L D    G+R+ + G Y        +    +KG   G  ++  R + I  +     + +       +  ++R ++   +I   L +S+APSI G + +K+A+ C L GG  + L +G   RGDIN+LMLGDP  AKSQ+L+FV +C+    + T+G+G+S  GLTA+V+ D  +    +E GAMVLAD G+VCIDEFDKM + DR AIHE MEQ  ++I+KAGI   LN+RCSVLAAAN VYGR+D  K   +NI    ++LSRFD++FII D  D+  D  +A  V  +H            LS QT  Q + V  E        P  T                        +KYI  AR +  P+LS  A+  L  +Y  +RS   E   +E  ++K  + P+T R +E +IR+A + AK + + V   ++ + A  L   +     L  S
Sbjct:  154 RNLKSEQVSRLVKVHGIIISATAVKAKATKVCLQCRGCRSVIPN-----IPLPPGL-QGYALPRKCNSENAGRVKCPMDPYFIIPDRCVCVDFQTLRLQESPDAVPHGEMPRHLQLYCDRYLCDRVVPGNRVTIMGIYSIKKMAAVKAKGKEKGIGVGIRSSYLRVVGIQVDTEGAGRGATGPVSAQEEEELRALSTSPNIYSSLAQSLAPSIYGSDDLKKAITCLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVERCS-PIGVYTSGKGSSAAGLTASVLRDPSTRGFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVYGRWDDTKGE-DNIDFMPTILSRFDMIFIIKDHHDQQRDMTLARHVMNVH------------LSAQT--QTEGVEGE-------IPLAT-----------------------FKKYIAYARAKCGPRLSAAAAEKLKNRYVVMRSGARE---HERESDKRPSIPITVRQLEAVIRIAESLAKMKLQAVAGEEEVDEALRLFQVSTLDAALSGS 673          
BLAST of SMED30026560 vs. Planmine SMEST
Match: SMESG000037542.1 (SMESG000037542.1)

HSP 1 Score: 1513.43 bits (3917), Expect = 0.000e+0
Identity = 780/780 (100.00%), Postives = 780/780 (100.00%), Query Frame = -3
Query:   61 MTDITDQESYQAESAYLNFLDSEIKYQDRIKTLILKGXXXXXXXXXXXRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYXXXXXXXXXXXXSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPLNESDSDGEETNGIIEDMATTSIRSNKKQRTAEHAXXXXXXXXXXXXXXINNFKISVSRTFQDARVDFMDLNTLIVALQQIHPDVNAAGITALLRKLDADSKIMMTDNEVYII 2400
            MTDITDQESYQAESAYLNFLDSEIKYQDRIKTLILKGLRRLIIDLNDLRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYEEFFVGFEGSFGSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPLNESDSDGEETNGIIEDMATTSIRSNKKQRTAEHADIEIVDVFDIDQVDINNFKISVSRTFQDARVDFMDLNTLIVALQQIHPDVNAAGITALLRKLDADSKIMMTDNEVYII
Sbjct:    1 MTDITDQESYQAESAYLNFLDSEIKYQDRIKTLILKGLRRLIIDLNDLRAAKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYEEFFVGFEGSFGSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAVFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTKPLNESDSDGEETNGIIEDMATTSIRSNKKQRTAEHADIEIVDVFDIDQVDINNFKISVSRTFQDARVDFMDLNTLIVALQQIHPDVNAAGITALLRKLDADSKIMMTDNEVYII 780          
BLAST of SMED30026560 vs. Planmine SMEST
Match: SMESG000005389.1 (SMESG000005389.1)

HSP 1 Score: 286.189 bits (731), Expect = 1.732e-84
Identity = 198/574 (34.49%), Postives = 291/574 (50.70%), Query Frame = -3
Query:  427 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLN----PNLLAGAAYPTKDEVGNILET----EYGLSTYK----DFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCG-----QYRCMPGKKGGFTTAVFRTILI-----ANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAAR-QLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVL 2079
            R + S  +  ++ I G+V   S +KSK       C   +++L         LN    P     +A   +  VG   ++     Y +   K    DFQ + +QE PEN P G++PR  ++ +D  L +    G+R+ V G     Q   M   K G   +  R + +      +    I+    T  E  +F   R+ + K  + +++ RSIAP I G+  IK+A+ C L GG  + +  G  +RGDIN++MLGDP  AKSQ+L+FV QCA   A+ T+G+G+S  GLTA+V+ D  +    +E GAMVLAD G+VCIDEFDKM + DR AIHE MEQ  ++I+KAGI   LN+RCSVLAAAN V+G +D+ K   ENI    +++SRFD++F++ D  DE  D++I E V  +H        DG+A  +          NE +S         D +  ++    V K         L+KYI   R Q  P+L+ EA  I+   Y  +RS   E    E+G N   + P+T R +E ++R+A + AK R        DA  A  L   +     L
Sbjct:  130 REIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVK-PGLNGYVLPRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQDSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEKEF---REFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGGSRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCA-PIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKGD-ENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVH------MGDGQAADV----------NENIS--------LDSLTAETGIMPVLK---------LKKYIAFCRDQCGPRLTPEALKIITNHYVSMRSGASEY-EKETGKNT--SIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSAL 661          
BLAST of SMED30026560 vs. Planmine SMEST
Match: SMESG000060238.1 (SMESG000060238.1)

HSP 1 Score: 258.84 bits (660), Expect = 2.830e-74
Identity = 183/562 (32.56%), Postives = 277/562 (49.29%), Query Frame = -3
Query:  442 RTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLERYYTDLTSLNPNLLAGA-AYPTKDEVGNILETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGK---KGGFTTAVFRTILIANNVYSINKNSATTFEGSDF-----VKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGG---VERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVD----REIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAI 2079
            R +  E L  +V + G+V ++S +  +++ +   C       +        ++P       A  T+  V N  E       + D Q + +QE PE+ PAG+ P ++ +    DLVD  + GDR+ V G YR    +   K     AVF+T L   + +  +KN     E +       V+IR +++K D+ + L+ +IAP+I G+E IK+ +L  L GG     + L  G  +R +I++L+ GDP  +KSQ+L++V      R   T+G+G+S VGLTA +  D E+G   L++GA+ L+D GI CIDEFDKM+D  R+ +HEVMEQ  ++I+KAGI  +L+AR SVLAAANP+   +D  KT +ENI L  +LLSRFDL+F+I+D  DE  D    R I    C  ++   PG  D   L        DY+                                           +A   + P LS EA N + ++Y ++R          +G  +    P   R +E+LIRLA AHA+ R    V+  D   A  L   A+
Sbjct:  185 RNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCE-------FIDKQMVKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLH-FQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLT-PRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLR-------DYIA------------------------------------------YAKENIHPILSEEAENYVTEEYVEMRKV------GNAGKGQISAYP---RQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREAL 679          
BLAST of SMED30026560 vs. Planmine SMEST
Match: SMESG000038798.1 (SMESG000038798.1)

HSP 1 Score: 258.455 bits (659), Expect = 5.281e-74
Identity = 169/518 (32.63%), Postives = 265/518 (51.16%), Query Frame = -3
Query:  436 STYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPG------------------------------KKGGFTTAVFRTILIANNVYSINKNSATT-----------------FEGSDFVKIRDMAKKKDILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSNNESGA-NKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFK 1845
            S Y DFQ + VQE     P G +PR ++VIL N+ V+  + GD+    G    +P                               K+ G     +R   +AN+V ++N     T                     +  K+  M +  +++  +   + P+  G++ +KR +L  L GGV ++   GT++RGDINI ++GDPS AKSQ L+ +   +  RA+ T+G+ +S  GLTAAVV D+ESGE  +EAGA++LA+ G+ CIDEFDKM   D+ AIHE MEQ  ++++KAGI A LNA+ SVLAAANPV GRYD+ ++  +NI L   ++SRFDL F++ID+  E VD EIA+   R+ + + P               +D             P K+D               + + +  +++YI  AR  +P+++ EA  ++  +Y  +R ++       SG+ + +R   +T R +E+L+RL+ A A+ RF   V   D   A  L+S +I +
Sbjct:  194 SKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEEGTKLRGDINICIVGDPSTAKSQFLKRIAGFS-PRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAK---RITESQRP---------------VD-------------PEKSD--------------TRIYNEDDIQRYITFARCFEPRVTEEAFKLMVTEYAKMRERDA-----ASGSRSAWR---ITVRQLESLVRLSEATARMRFSDFVEECDVVEANRLLSKSIIR 657          
BLAST of SMED30026560 vs. Planmine SMEST
Match: SMESG000057772.1 (SMESG000057772.1)

HSP 1 Score: 249.98 bits (637), Expect = 2.302e-71
Identity = 196/581 (33.73%), Postives = 295/581 (50.77%), Query Frame = -3
Query:  403 RQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCP--ATKKFLERYYTDLTSLNPNLLAGAAYPTKDEVGNI-----LETEYGLSTYKDFQTITVQEMPENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTA----VFRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKD--ILDLLTRSIAPSICGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRFVLQ-CARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVYGRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQYR--PPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAVEKHGQYFTKQFLEKYIHAAR-QLQPKLSREASNILHQKYCDLRSQEVEMSNNESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVSYAIFKEVLKKSKKRTK 2094
            + L+ R + S+ +G+++ ++ +V + +M+K  +  + + C    ++ F E        LN  LL        +EV  I     L  +   S Y   Q I +QE+ +  P G +PRS+ V        + + GD +++ G +  +P    G  T     V    L A+ +  I K+ +     +      ++ K KD  +  L+ RSIAP I GHE +K+ +L  ++ G   I   GT+IRG +NI ++GDP VAKSQ+L FV + C R +   T GRG+SG GLTA+VV D+ +GE  LEAG++VLAD GI CIDEFDKM+D DRTAIHEVMEQ  ++I+KAGI   LNAR S+LAAANP YGRY+  +T  +NI L  +LLSRFDLL++I D+ D   D  +A+ +  +H     PP        S+ TT   D  G   LS  E                             L +Y+   R Q  P +     N L   Y  +R         ES A    +   +AR++  LIR++TA ++ + +  V   D + A  L+  +       ++++RT+
Sbjct:  148 KALSIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQE-------ILNKTLLP--LLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVF--LPLLNTGMRTLNRGLVTELFLDAHFINRITKDESDDLGETIPATEAELEKLKDPEMYSLMARSIAPEIFGHEDVKKGLLI-MMAGGAGIDAAGTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQY--TNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYVHTNNEAPP--------SVLTTAAGDSAGLLPLSMAE-----------------------------LRRYLAIIRSQPDPAVPETLLNYLVGCYISMR--------KESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRLLEASKASVKSDRARQRTR 669          
The following BLAST results are available for this feature:
BLAST of SMED30026560 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MCM30.000e+050.18minichromosome maintenance complex component 3 [So... [more]
MCM30.000e+050.18minichromosome maintenance complex component 3 [So... [more]
MCM30.000e+051.19minichromosome maintenance complex component 3 [So... [more]
MCM30.000e+051.19minichromosome maintenance complex component 3 [So... [more]
MCM22.164e-8636.10minichromosome maintenance complex component 2 [So... [more]
back to top
BLAST of SMED30026560 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm-30.000e+051.76DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q9XVR7][more]
mcm-51.919e-8533.57DNA replication licensing factor mcm-5 [Source:Un... [more]
mcm-51.919e-8533.57DNA replication licensing factor mcm-5 [Source:Un... [more]
mcm-21.476e-8439.14DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6][more]
mcm-21.476e-8439.14DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6][more]
back to top
BLAST of SMED30026560 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcm30.000e+057.08gene:FBgn0284442 transcript:FBtr0070762[more]
Mcm30.000e+056.89gene:FBgn0284442 transcript:FBtr0340476[more]
Mcm25.186e-8438.01gene:FBgn0014861 transcript:FBtr0081827[more]
Mcm64.949e-8031.38gene:FBgn0025815 transcript:FBtr0070952[more]
Mcm58.153e-8032.99gene:FBgn0017577 transcript:FBtr0082279[more]
back to top
BLAST of SMED30026560 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm30.000e+059.63minichromosome maintenance complex component 3 [So... [more]
mcm3l0.000e+058.58MCM3 minichromosome maintenance deficient 3 (S. ce... [more]
mcm3l0.000e+051.48MCM3 minichromosome maintenance deficient 3 (S. ce... [more]
mcm23.446e-8435.48minichromosome maintenance complex component 2 [So... [more]
mcm43.048e-8133.39minichromosome maintenance complex component 4 [So... [more]
back to top
BLAST of SMED30026560 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm30.000e+057.37minichromosome maintenance complex component 3 [So... [more]
ctnnd10.000e+052.42catenin delta 1 [Source:Xenbase;Acc:XB-GENE-919827... [more]
ctnnd10.000e+050.39catenin delta 1 [Source:Xenbase;Acc:XB-GENE-919827... [more]
ctnnd10.000e+059.87catenin delta 1 [Source:Xenbase;Acc:XB-GENE-919827... [more]
ctnnd10.000e+059.87catenin delta 1 [Source:Xenbase;Acc:XB-GENE-919827... [more]
back to top
BLAST of SMED30026560 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcm30.000e+058.87minichromosome maintenance complex component 3 [So... [more]
Mcm23.013e-8636.46minichromosome maintenance complex component 2 [So... [more]
Mcm43.963e-8133.22minichromosome maintenance complex component 4 [So... [more]
Mcm78.293e-8034.30minichromosome maintenance complex component 7 [So... [more]
Mcm53.637e-7932.05minichromosome maintenance complex component 5 [So... [more]
back to top
BLAST of SMED30026560 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9XYU1|MCM3_DROME0.000e+057.08DNA replication licensing factor Mcm3 OS=Drosophil... [more]
sp|P25206|MCM3_MOUSE0.000e+058.87DNA replication licensing factor MCM3 OS=Mus muscu... [more]
sp|Q28BS0|MCM3Z_XENTR0.000e+057.37Zygotic DNA replication licensing factor mcm3 OS=X... [more]
sp|Q5ZMN2|MCM3_CHICK0.000e+049.69DNA replication licensing factor MCM3 OS=Gallus ga... [more]
sp|Q7ZXZ0|MCM3Z_XENLA0.000e+057.39Zygotic DNA replication licensing factor mcm3 OS=X... [more]
back to top
BLAST of SMED30026560 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D7F00.000e+053.31DNA helicase OS=Schistosoma japonicum OX=6182 GN=E... [more]
A0A183MJT90.000e+053.42DNA helicase OS=Schistosoma margrebowiei OX=48269 ... [more]
A0A430QE770.000e+061.62DNA helicase OS=Schistosoma bovis OX=6184 GN=DC041... [more]
A0A075A3E80.000e+055.38DNA helicase OS=Opisthorchis viverrini OX=6198 GN=... [more]
A0A419PHL00.000e+055.46DNA helicase OS=Clonorchis sinensis OX=79923 GN=Mc... [more]
back to top
BLAST of SMED30026560 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm3l0.000e+056.55maternal DNA replication licensing factor mcm3-lik... [more]
mcm30.000e+052.30minichromosome maintenance complex component 3 [So... [more]
mcm3l0.000e+057.88maternal DNA replication licensing factor mcm3-lik... [more]
mcm49.080e-8533.92minichromosome maintenance complex component 4 [So... [more]
mcm22.247e-8435.48minichromosome maintenance complex component 2 [So... [more]
back to top
BLAST of SMED30026560 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008164.10.000e+067.69pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:... [more]
mcm55.047e-7434.57minichromosome maintenance complex component 5 [So... [more]
mcm83.187e-6231.38minichromosome maintenance 8 homologous recombinat... [more]
ENSPMAT00000006035.16.119e-6131.52pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 g... [more]
ENSPMAT00000006014.11.138e-5831.76pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 g... [more]
back to top
BLAST of SMED30026560 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MCM34.413e-17250.75Protein involved in DNA replication; component of ... [more]
MCM22.498e-9039.22Protein involved in DNA replication; component of ... [more]
MCM53.785e-8732.88Component of the Mcm2-7 hexameric helicase complex... [more]
MCM42.750e-8535.76Essential helicase component of heterohexameric MC... [more]
MCM69.915e-7836.09Protein involved in DNA replication; component of ... [more]
back to top
BLAST of SMED30026560 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO344250.000e+050.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284687.721e-13658.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350601.816e-8538.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379464.741e-8435.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339711.914e-7830.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30026560 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm30.000e+060.26minichromosome maintenance complex component 3 [So... [more]
mcm26.478e-8536.30minichromosome maintenance complex component 2 [So... [more]
mcm41.518e-8136.05minichromosome maintenance complex component 4 [So... [more]
mcm41.974e-8136.05minichromosome maintenance complex component 4 [So... [more]
mcm53.732e-8033.22minichromosome maintenance complex component 5 [So... [more]
back to top
BLAST of SMED30026560 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037542.10.000e+0100.00SMESG000037542.1[more]
SMESG000005389.11.732e-8434.49SMESG000005389.1[more]
SMESG000060238.12.830e-7432.56SMESG000060238.1[more]
SMESG000038798.15.281e-7432.63SMESG000038798.1[more]
SMESG000057772.12.302e-7133.73SMESG000057772.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026560 ID=SMED30026560|Name=SMED30026560|organism=Schmidtea mediterranea sexual|type=transcript|length=2531bp
CAAGAACACAAACGGTTGAAATTTATAAAAAATACACATCTAGTTAGCAA
CATAAATTCAGATAATATAGACTTCATTGTCGGTCATCATAATCTTGCTG
TCGGCATCGAGTTTACGCAAGAGAGCCGTAATTCCGGCTGCGTTGACATC
CGGATGTATCTGTTGCAGGGCCACTATCAGCGTATTCAAATCCATAAAAT
CAACACGAGCATCTTGAAATGTCCGACTGACACTGATTTTGAAGTTATTG
ATATCGACCTGGTCAATATCGAAAACATCGACAATTTCTATGTCGGCGTG
CTCAGCCGTCCGTTGTTTTTTATTCGATCTGATGCTAGTTGTGGCCATGT
CCTCAATGATGCCATTGGTTTCCTCACCATCGCTGTCAGACTCGTTCAGA
GGTTTCGTGCGCTTCTTCGACTTTTTAAGGACTTCCTTGAAAATTGCGTA
TGAAACGAGATCAGCAGCGGCTTCTGCATCTTTTGCGGAAACAACTTTCC
TAAATCGTGCTTTCGCGTGAGCAGTAGCCAATCGAATCAGTGTTTCCATG
GTTCTGGCAGTGACTGGCTGGGTACGATATTTGTTTGCACCGGACTCGTT
GTTGCTCATTTCCACTTCTTGGCTTCTTAAATCGCAATATTTCTGGTGGA
GAATGTTACTGGCCTCTCTTGACAGTTTCGGCTGCAACTGACGAGCAGCA
TGGATATATTTCTCCAGGAATTGCTTGGTGAAATATTGCCCGTGTTTTTC
CACAGCGAATTTATTAGATTTCTCAAATATCTCATCGGTTTTCGTTGGTT
TTGATTCGTCATCAGATAATTCTTCGTTACCGACATAATCGATTTGATTG
GTTGTTTGTAAAGATAACGCTTCGCCGTCTTTTTGTCCCGGTGGCCTATA
TTGATGCATGCGACACACAAATTCCGCGATTTCTCTATCGACCACTTCAT
CGGATTGGTCAATAATGATAAATAACAAGTCAAATCGTGACAATAACGAG
TCTTGCAGTCCGATATTTTCCATTGGAGTTTTGAATTGATCGTAACGTCC
ATATACGGGATTGGCAGCTGCTAATACAGAGCACCTGGCATTTAGTCTGG
CATGAATGCCAGCTTTTGATATTGTCACCCGTCCCTGTTCCATCACCTCG
TGTATTGCGGTACGATCAATGTCACTCATTTTGTCAAACTCGTCAATGCA
AACGATACCGCGATCAGCAAGAACCATAGCTCCTGCTTCGAGACCTCTTT
CACCACTTTCTTTGTCGGTAACAACAGCCGCGGTCAAACCAACACCAGAA
GTTCCACGGCCGGTTGTTGCAATAGCTCTATCTCGTGCACACTGCAAAAC
AAATCTCAGGATTTGAGATTTAGCAACCGATGGATCTCCCAGCATCAAAA
TATTTATGTCACCTCTAATTCGTGTTCCATTTACGAGTATACGCTCGACT
CCGCCTAATAATTGACACAAAACCGCTCGTTTGATGAATTCATGGCCACA
AATCGATGGAGCAATTGATCTAGTCAATAGATCCAAAATGTCCTTTTTCT
TAGCCATATCTCGAATTTTAACAAAATCGCTACCTTCAAAGGTTGTCGCC
GAGTTTTTATTGATTGAATACACATTGTTAGCTATTAATATAGTTCGGAA
AACTGCAGTAGTAAATCCACCTTTCTTTCCCGGCATGCACCGATATTGTC
CACAAACATAAATTCTATCGCCAGATTTGCAAATGTCTACTAAATCATTG
TCCAAGATGACTTCAATTGAGCGTGGTAACTGTCCAGCAGGTGCATTTTC
AGGCATTTCTTGAACAGTTATGGTTTGGAAATCTTTATAAGTCGACAAAC
CGTATTCTGTTTCAAGAATATTTCCAACCTCATCTTTTGTTGGATATGCC
GCACCAGCTAATAGGTTTGGATTTAAACTCGTTAAATCAGTGTAATATCG
TTCTAAGAATTTTTTCGTAGCAGGACAATAGTGAACACTGTGAACAATTT
TTGATTTCATCATTGAAACTTTGGTTACAATTCCTTCAATACACACCATA
TTTCCTAAATATTCCGATGTCATTGTTCTTGGAGTCAATTGACGACTACC
GAAACTTCCTTCAAAACCAACAAAAAACTCTTCGTAAGTATTGGCATAAT
CAGGGTTAATATTTGCAATACATTTTTTTAAAGCAATTTGCAATGAGATA
ATCTCTGTAAAGTTAAATTTTAAAAGTTTTTCGACTCTATCAACTTTAGC
GGCTCTTAAATCATTTAAATCAATTATAAGACGTCTCAGACCTTTTAAAA
TTAAAGTTTTTATCCGATCTTGATATTTAATCTCTGAATCCAAAAAATTT
AAATATGCGCTTTCAGCTTGGTATGATTCCTGATCGGTTATATCTGTCAT
TTTATTATAAATGGCTTTAAAAGTTATATTTAAACAATTATTTAAATTTA
AATTGTAAATGGTAAAAAACTGATGGGATTTATTACGAGTAATTTGCTAA
CAAAATAAATAAATTTAAATCAAATAAATTT
back to top

protein sequence of SMED30026560-orf-1

>SMED30026560-orf-1 ID=SMED30026560-orf-1|Name=SMED30026560-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=781bp
MTDITDQESYQAESAYLNFLDSEIKYQDRIKTLILKGLRRLIIDLNDLRA
AKVDRVEKLLKFNFTEIISLQIALKKCIANINPDYANTYEEFFVGFEGSF
GSRQLTPRTMTSEYLGNMVCIEGIVTKVSMMKSKIVHSVHYCPATKKFLE
RYYTDLTSLNPNLLAGAAYPTKDEVGNILETEYGLSTYKDFQTITVQEMP
ENAPAGQLPRSIEVILDNDLVDICKSGDRIYVCGQYRCMPGKKGGFTTAV
FRTILIANNVYSINKNSATTFEGSDFVKIRDMAKKKDILDLLTRSIAPSI
CGHEFIKRAVLCQLLGGVERILVNGTRIRGDINILMLGDPSVAKSQILRF
VLQCARDRAIATTGRGTSGVGLTAAVVTDKESGERGLEAGAMVLADRGIV
CIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHARLNARCSVLAAANPVY
GRYDQFKTPMENIGLQDSLLSRFDLLFIIIDQSDEVVDREIAEFVCRMHQ
YRPPGQKDGEALSLQTTNQIDYVGNEELSDDESKPTKTDEIFEKSNKFAV
EKHGQYFTKQFLEKYIHAARQLQPKLSREASNILHQKYCDLRSQEVEMSN
NESGANKYRTQPVTARTMETLIRLATAHAKARFRKVVSAKDAEAAADLVS
YAIFKEVLKKSKKRTKPLNESDSDGEETNGIIEDMATTSIRSNKKQRTAE
HADIEIVDVFDIDQVDINNFKISVSRTFQDARVDFMDLNTLIVALQQIHP
DVNAAGITALLRKLDADSKIMMTDNEVYII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR033762MCM_OB
IPR041562MCM_lid
IPR001208MCM_dom
IPR008046Mcm3
IPR031327MCM
IPR012340NA-bd_OB-fold
IPR027925MCM_N
IPR027417P-loop_NTPase
IPR018525MCM_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003677DNA binding
GO:0003678DNA helicase activity
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006270DNA replication initiation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0042555MCM complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001208MCM domainPRINTSPR01657MCMFAMILYcoord: 329..344
score: 69.22
coord: 469..477
score: 78.73
coord: 418..431
score: 65.51
coord: 390..404
score: 76.42
coord: 442..454
score: 72.95
IPR001208MCM domainPFAMPF00493MCMcoord: 278..499
e-value: 3.0E-92
score: 307.8
IPR001208MCM domainPROSITEPS50051MCM_2coord: 288..495
score: 87.466
IPR008046DNA replication licensing factor Mcm3PRINTSPR01659MCMPROTEIN3coord: 181..195
score: 72.44
coord: 491..501
score: 55.76
coord: 641..656
score: 50.83
coord: 458..468
score: 81.82
coord: 207..219
score: 63.59
IPR031327Mini-chromosome maintenance proteinSMARTSM00350mcmcoord: 103..654
e-value: 1.1E-239
score: 812.2
IPR031327Mini-chromosome maintenance proteinPANTHERPTHR11630DNA REPLICATION LICENSING FACTORcoord: 4..727
IPR027925MCM N-terminal domainPFAMPF14551MCM_Ncoord: 20..96
e-value: 3.8E-6
score: 27.4
IPR033762MCM OB domainPFAMPF17207MCM_OBcoord: 108..239
e-value: 1.4E-29
score: 102.5
IPR041562MCM, AAA-lid domainPFAMPF17855MCM_lidcoord: 561..650
e-value: 5.5E-21
score: 74.8
NoneNo IPR availableGENE3DG3DSA:2.20.28.10coord: 134..189
e-value: 2.4E-46
score: 158.9
NoneNo IPR availableGENE3DG3DSA:3.30.1640.10coord: 6..103
e-value: 2.4E-16
score: 62.1
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 112..260
e-value: 2.4E-46
score: 158.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 664..687
NoneNo IPR availablePANTHERPTHR11630:SF72DNA REPLICATION LICENSING FACTOR MCM3coord: 4..727
NoneNo IPR availableCDDcd17754MCM3coord: 291..652
e-value: 4.16887E-170
score: 490.056
IPR018525Mini-chromosome maintenance, conserved sitePROSITEPS00847MCM_1coord: 398..406
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 298..663
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 21..259