Mucin-19-like isoform X3

Overview
NameMucin-19-like isoform X3
Smed IDSMED30026544
Length (bp)1835
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mucin-19-like isoform X3 (SMED30026544) t-SNE clustered cells

Violin plots show distribution of expression levels for Mucin-19-like isoform X3 (SMED30026544) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mucin-19-like isoform X3 (SMED30026544) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mucin-19-like isoform X3 (SMED30026544) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026544

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026544SMESG000001496.1 SMESG000001495.1 SmedASXL_014725SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30026544SMESG000001496.1 SMESG000001495.1 dd_Smed_v4_14943_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026544SMESG000001496.1 SMESG000001495.1 dd_Smed_v4_14943_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30026544SMESG000001496.1 SMESG000001495.1 dd_Smed_v4_14943_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026544SMESG000001496.1 SMESG000001495.1 dd_Smed_v6_14943_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026544SMESG000001496.1 SMESG000001495.1 dd_Smed_v4_14943_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mucin-19-like isoform X3 vs. Ensembl Human
Match: KIAA1549L (KIAA1549 like [Source:HGNC Symbol;Acc:HGNC:24836])

HSP 1 Score: 62.3882 bits (150), Expect = 2.281e-9
Identity = 43/140 (30.71%), Postives = 73/140 (52.14%), Query Frame = 3
Query:  240 YWVVTVCNI--STLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRR-KRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVF 650
            YWV+TV     ++L  +   +F   ME RL+  + +    SQ  GRR KRA T G+ T+Q+V   R+   + P  L YY + +    +  +    I++ +++Q+M++ L+ +V   A   +   +NP  +  LWII AV 
Sbjct:  625 YWVITVLQGVDNSLVGLHNQSFARVMEQRLAQLFMM----SQQQGRRFKRATTLGSYTVQMVKMQRVPGPKDPAELTYYTLYNGKPLLG-TAAAKILSTIDSQRMALTLHHVVLLQA---DPVVKNPPNN--LWIIAAVL 754          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Human
Match: KIAA1549L (KIAA1549 like [Source:HGNC Symbol;Acc:HGNC:24836])

HSP 1 Score: 62.3882 bits (150), Expect = 2.316e-9
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  240 YWVVTVCNI--STLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRR-KRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVFG 653
            YWV+TV     ++L  +   +F   ME RL+  + +    SQ  GRR KRA T G+ T+Q+V   R+   + P  L YY + +    +  +    I++ +++Q+M++ L+ +V   A   +   +NP  +  LWII AV  
Sbjct: 1058 YWVITVLQGVDNSLVGLHNQSFARVMEQRLAQLFMM----SQQQGRRFKRATTLGSYTVQMVKMQRVPGPKDPAELTYYTLYNGKPLLG-TAAAKILSTIDSQRMALTLHHVVLLQA---DPVVKNPPNN--LWIIAAVLA 1188          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Human
Match: KIAA1549L (KIAA1549 like [Source:HGNC Symbol;Acc:HGNC:24836])

HSP 1 Score: 62.003 bits (149), Expect = 3.004e-9
Identity = 43/140 (30.71%), Postives = 73/140 (52.14%), Query Frame = 3
Query:  240 YWVVTVCNI--STLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRR-KRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVF 650
            YWV+TV     ++L  +   +F   ME RL+  + +    SQ  GRR KRA T G+ T+Q+V   R+   + P  L YY + +    +  +    I++ +++Q+M++ L+ +V   A   +   +NP  +  LWII AV 
Sbjct: 1355 YWVITVLQGVDNSLVGLHNQSFARVMEQRLAQLFMM----SQQQGRRFKRATTLGSYTVQMVKMQRVPGPKDPAELTYYTLYNGKPLLG-TAAAKILSTIDSQRMALTLHHVVLLQA---DPVVKNPPNN--LWIIAAVL 1484          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Human
Match: KIAA1549L (KIAA1549 like [Source:HGNC Symbol;Acc:HGNC:24836])

HSP 1 Score: 61.2326 bits (147), Expect = 5.539e-9
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  240 YWVVTVCNI--STLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRR-KRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVFG 653
            YWV+TV     ++L  +   +F   ME RL+  + +    SQ  GRR KRA T G+ T+Q+V   R+   + P  L YY + +    +  +    I++ +++Q+M++ L+ +V   A   +   +NP  +  LWII AV  
Sbjct: 1106 YWVITVLQGVDNSLVGLHNQSFARVMEQRLAQLFMM----SQQQGRRFKRATTLGSYTVQMVKMQRVPGPKDPAELTYYTLYNGKPLLG-TAAAKILSTIDSQRMALTLHHVVLLQA---DPVVKNPPNN--LWIIAAVLA 1236          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Zebrafish
Match: kiaa1549lb (KIAA1549-like b [Source:ZFIN;Acc:ZDB-GENE-050419-18])

HSP 1 Score: 65.4698 bits (158), Expect = 1.004e-10
Identity = 45/144 (31.25%), Postives = 77/144 (53.47%), Query Frame = 3
Query:  237 PYWVVTVC-NISTLT-DVTTSTFKNDMELRLSNAYAVALSASQTSGRRKRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVFGSLA 662
            P+W++TV  ++S  + +V   +F + ME RL+  + VA    Q   R KRA T G+ T+Q+VS  R+  T+ P  + YY V  + T +  ++   ++N +++Q M++ L   V   A    +  +NP  +  LWII AV   + 
Sbjct:  189 PFWIITVIQDVSNSSLEVQYQSFASLMEERLAELFMVA---HQQGVRFKRATTVGSYTVQMVSIRRVHGTKNPAEMTYY-VQQNGTPMLGTSAAKLLNTVDSQTMALTLGYFVQLQA---EAVVKNPPNN--LWIIAAVLAPIG 323          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Zebrafish
Match: si:dkeyp-27e10.3 (si:dkeyp-27e10.3 [Source:ZFIN;Acc:ZDB-GENE-041210-96])

HSP 1 Score: 53.5286 bits (127), Expect = 8.290e-7
Identity = 31/105 (29.52%), Postives = 52/105 (49.52%), Query Frame = 3
Query:  243 WVVTVCNISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRRKRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIIL 557
            WV TV        V   TF+  ME RL+      L     + R +R+ + G N++Q+V A+R+     P  LVY++   S   +      +++N+LN Q+ +I+L
Sbjct:  681 WVKTVLLGVLDQRVNERTFQAKMERRLALLVGEGLGIGINNRRWRRSTSVGNNSVQIVRASRLDGPDYPLELVYFVEEGSGERLPAQATAAMLNRLNLQRAAIVL 785          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Zebrafish
Match: si:ch211-1e14.1 (si:ch211-1e14.1 [Source:ZFIN;Acc:ZDB-GENE-050420-149])

HSP 1 Score: 53.1434 bits (126), Expect = 8.888e-7
Identity = 37/136 (27.21%), Postives = 63/136 (46.32%), Query Frame = 3
Query:  243 WVVTVCNISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRR-KRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQK---LWII 638
            WV TV         T   F   +E RL    A+ L     +GRR KRA + G N+LQ+V  T +     P  ++Y++ G++   +  +T  +++N L+ Q  +II+   +  +         +P +D +    WII
Sbjct:  202 WVRTVLLGVLDQRATDKVFHITIERRL----ALLLGDVLGTGRRFKRATSVGNNSLQIVQTTHLVGPDNPLEIIYFVEGANGQRLPATTTANMLNSLDVQHAAIIMGYRIQGILAQPVEKQASPPSDTEKTNTWII 333          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Zebrafish
Match: si:ch211-1e14.1 (si:ch211-1e14.1 [Source:ZFIN;Acc:ZDB-GENE-050420-149])

HSP 1 Score: 50.447 bits (119), Expect = 6.698e-6
Identity = 37/136 (27.21%), Postives = 63/136 (46.32%), Query Frame = 3
Query:  243 WVVTVCNISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRR-KRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQK---LWII 638
            WV TV         T   F   +E RL    A+ L     +GRR KRA + G N+LQ+V  T +     P  ++Y++ G++   +  +T  +++N L+ Q  +II+   +  +         +P +D +    WII
Sbjct:  962 WVRTVLLGVLDQRATDKVFHITIERRL----ALLLGDVLGTGRRFKRATSVGNNSLQIVQTTHLVGPDNPLEIIYFVEGANGQRLPATTTANMLNSLDVQHAAIIMGYRIQGILAQPVEKQASPPSDTEKTNTWII 1093          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Zebrafish
Match: si:ch211-1e14.1 (si:ch211-1e14.1 [Source:ZFIN;Acc:ZDB-GENE-050420-149])

HSP 1 Score: 50.447 bits (119), Expect = 7.483e-6
Identity = 37/136 (27.21%), Postives = 63/136 (46.32%), Query Frame = 3
Query:  243 WVVTVCNISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRR-KRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQK---LWII 638
            WV TV         T   F   +E RL    A+ L     +GRR KRA + G N+LQ+V  T +     P  ++Y++ G++   +  +T  +++N L+ Q  +II+   +  +         +P +D +    WII
Sbjct:  962 WVRTVLLGVLDQRATDKVFHITIERRL----ALLLGDVLGTGRRFKRATSVGNNSLQIVQTTHLVGPDNPLEIIYFVEGANGQRLPATTTANMLNSLDVQHAAIIMGYRIQGILAQPVEKQASPPSDTEKTNTWII 1093          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Xenopus
Match: ENSXETT00000043419.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:1230002:1246220:1 gene:ENSXETG00000010223.1 transcript:ENSXETT00000043419.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 2.376e-7
Identity = 37/115 (32.17%), Postives = 61/115 (53.04%), Query Frame = 3
Query:  294 TFKNDMELRLSNAYAVALSASQTSGRRKRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWII 638
            TF+ DME +L+   + A S  +   R KRA   G+ T+Q+V+ +R+  ++ P  LVY++       +  + V S++N++N Q+ +IIL   V  +      A Q     Q LWII
Sbjct: 1263 TFQADMERKLAQLISEASSQRR---RWKRASLAGSRTVQVVNVSRLDGSEDPVQLVYFVEDQFGKRLPAADVSSLINEVNVQRAAIILGYRVQGIV-----AQQADRQAQNLWII 1369          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Xenopus
Match: ENSXETT00000043410.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:1230002:1246220:1 gene:ENSXETG00000010223.1 transcript:ENSXETT00000043410.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 2.402e-7
Identity = 37/115 (32.17%), Postives = 61/115 (53.04%), Query Frame = 3
Query:  294 TFKNDMELRLSNAYAVALSASQTSGRRKRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWII 638
            TF+ DME +L+   + A S  +   R KRA   G+ T+Q+V+ +R+  ++ P  LVY++       +  + V S++N++N Q+ +IIL   V  +      A Q     Q LWII
Sbjct: 1263 TFQADMERKLAQLISEASSQRR---RWKRASLAGSRTVQVVNVSRLDGSEDPVQLVYFVEDQFGKRLPAADVSSLINEVNVQRAAIILGYRVQGIV-----AQQADRQAQNLWII 1369          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Mouse
Match: D430041D05Rik (RIKEN cDNA D430041D05 gene [Source:MGI Symbol;Acc:MGI:2181743])

HSP 1 Score: 62.7734 bits (151), Expect = 1.030e-9
Identity = 43/140 (30.71%), Postives = 73/140 (52.14%), Query Frame = 3
Query:  240 YWVVTVCNI--STLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRR-KRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVF 650
            YWV+TV     ++L  +   +F   ME RL+  + +    SQ  GRR KRA T G+ T+Q+V   R+   + P  L YY + +    +  +    I++ +++Q+M++ L+ +V   A   +   +NP  +  LWII AV 
Sbjct:  510 YWVITVLQGVDNSLVGLHNQSFARVMEQRLAQLFMM----SQQQGRRFKRATTLGSYTVQMVKMQRVPGPKDPAELTYYTLYNGKPLLG-TAAAKILSTIDSQRMALTLHHVVLLQA---DPVVKNPPNN--LWIIAAVL 639          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Mouse
Match: D430041D05Rik (RIKEN cDNA D430041D05 gene [Source:MGI Symbol;Acc:MGI:2181743])

HSP 1 Score: 60.4622 bits (145), Expect = 6.718e-9
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  240 YWVVTVCN--ISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRR-KRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVFG 653
            YWV+TV     ++L  +   +F   ME RL+  + +    SQ  GRR KRA T G+ T+Q+V   R+   + P  L YY + +    +  +    I++ +++Q+M++ L+ +V   A   +   +NP  +  LWII AV  
Sbjct:  625 YWVITVLQGVDNSLVGLHNQSFARVMEQRLAQLFMM----SQQQGRRFKRATTLGSYTVQMVKMQRVPGPKDPAELTYYTLYNGKPLLG-TAAAKILSTIDSQRMALTLHHVVLLQA---DPVVKNPPNN--LWIIAAVLA 755          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Mouse
Match: D430041D05Rik (RIKEN cDNA D430041D05 gene [Source:MGI Symbol;Acc:MGI:2181743])

HSP 1 Score: 60.077 bits (144), Expect = 7.073e-9
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  240 YWVVTVCN--ISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRR-KRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVFG 653
            YWV+TV     ++L  +   +F   ME RL+  + +    SQ  GRR KRA T G+ T+Q+V   R+   + P  L YY + +    +  +    I++ +++Q+M++ L+ +V   A   +   +NP  +  LWII AV  
Sbjct:  625 YWVITVLQGVDNSLVGLHNQSFARVMEQRLAQLFMM----SQQQGRRFKRATTLGSYTVQMVKMQRVPGPKDPAELTYYTLYNGKPLLG-TAAAKILSTIDSQRMALTLHHVVLLQA---DPVVKNPPNN--LWIIAAVLA 755          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Mouse
Match: D430041D05Rik (RIKEN cDNA D430041D05 gene [Source:MGI Symbol;Acc:MGI:2181743])

HSP 1 Score: 60.077 bits (144), Expect = 8.556e-9
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  240 YWVVTVCN--ISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRR-KRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVFG 653
            YWV+TV     ++L  +   +F   ME RL+  + +    SQ  GRR KRA T G+ T+Q+V   R+   + P  L YY + +    +  +    I++ +++Q+M++ L+ +V   A   +   +NP  +  LWII AV  
Sbjct: 1309 YWVITVLQGVDNSLVGLHNQSFARVMEQRLAQLFMM----SQQQGRRFKRATTLGSYTVQMVKMQRVPGPKDPAELTYYTLYNGKPLLG-TAAAKILSTIDSQRMALTLHHVVLLQA---DPVVKNPPNN--LWIIAAVLA 1439          
BLAST of Mucin-19-like isoform X3 vs. UniProt/SwissProt
Match: sp|Q6ZVL6|K154L_HUMAN (UPF0606 protein KIAA1549L OS=Homo sapiens OX=9606 GN=KIAA1549L PE=2 SV=2)

HSP 1 Score: 62.3882 bits (150), Expect = 1.112e-8
Identity = 43/141 (30.50%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  240 YWVVTVCNI--STLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRR-KRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVFG 653
            YWV+TV     ++L  +   +F   ME RL+  + +    SQ  GRR KRA T G+ T+Q+V   R+   + P  L YY + +    +  +    I++ +++Q+M++ L+ +V   A   +   +NP  +  LWII AV  
Sbjct: 1058 YWVITVLQGVDNSLVGLHNQSFARVMEQRLAQLFMM----SQQQGRRFKRATTLGSYTVQMVKMQRVPGPKDPAELTYYTLYNGKPLLG-TAAAKILSTIDSQRMALTLHHVVLLQA---DPVVKNPPNN--LWIIAAVLA 1188          
BLAST of Mucin-19-like isoform X3 vs. TrEMBL
Match: A0A267F403 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020322g1 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 2.420e-18
Identity = 76/242 (31.40%), Postives = 135/242 (55.79%), Query Frame = 3
Query:  237 PYWVVTV-CNISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRRKRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVFGSLAGVALIIWLVFFIYSRCIRPWDEPLLLKESEDLER--NDSFSDDQIKVLNITDENRNFPKVMSLNIE-EHLNEEMNSKLDKNYNQNLKESTENKQIGNEL 950
            P+W+ TV  ++    DV++  +++ ME RL      A + S +  RRKRA T G   LQL++ATR +   + T LVYY++ S N Y++   +++ +  +++   SI+  ++ +  +TY     +  G  ++LW+IGA+ GSL+G+ LIIW+V F+Y RC+RP+D P   K   D     +D F  D   V ++    R  P++     +   + +E+   LD + ++ ++ STE +Q G+ +
Sbjct:   80 PFWIKTVLSSVPATIDVSSCQWRDQMETRLLTLLETARAQSSSGKRRKRAATRGQLALQLINATRSSGNNSVT-LVYYVMLSGN-YLAADPLVTSLATVSSSAASILGYSVESVASTY-----EPLGNSRRLWLIGAILGSLSGLLLIIWVVLFVYQRCLRPFD-PAKDKRYPDDSAIIDDFFYPDGAHVPDM----RANPRIGYSRADIGTIADEVAKHLDSHMSELVRTSTEAEQNGHSI 309          
BLAST of Mucin-19-like isoform X3 vs. TrEMBL
Match: A0A267G3G6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025107g1 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.228e-17
Identity = 75/243 (30.86%), Postives = 138/243 (56.79%), Query Frame = 3
Query:  237 PYWVVTV-CNISTLTDVTTST-FKNDMELRLSNAYAVALSASQTSGRRKRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVFGSLAGVALIIWLVFFIYSRCIRPWDEPLLLKESEDLER--NDSFSDDQIKVLNITDENRNFPKVMSLNIE-EHLNEEMNSKLDKNYNQNLKESTENKQIGNEL 950
            P+W+ TV  ++    DV+++  +++ ME RL      A + S +  RRKRA T G   LQL++ATR +   + T LVYY++ S N Y++  ++++ +  +++   SI+  ++ +  +TY     ++ G  ++LW+IGA+ GSL+G+ LIIW+V F+Y RC+RP+D P   K   D     +D F  D+  V ++    R  P++     +   + +E+   LD + ++ ++ S E +Q G+ +
Sbjct:   80 PFWITTVLSSVPATIDVSSNCQWRDQMETRLLTLLETARAQSSSGKRRKRAATRGQLALQLINATRSSGNNSVT-LVYYVMLSGN-YLAADSLVTSLATVSSSAASILGYSVESLASTY-----ESLGNSRRLWLIGAILGSLSGLLLIIWVVLFVYQRCLRPFD-PAKDKRYPDDSAIIDDFFYPDEAHVPDM----RANPRIGYSRADIGTIADEVAKHLDSHMSELVRTSAEAEQNGHSI 310          
BLAST of Mucin-19-like isoform X3 vs. TrEMBL
Match: A0A267E0E0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015781g1 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.295e-17
Identity = 75/242 (30.99%), Postives = 133/242 (54.96%), Query Frame = 3
Query:  237 PYWVVTV-CNISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRRKRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVFGSLAGVALIIWLVFFIYSRCIRPWDEPLLLKESEDLER--NDSFSDDQIKVLNITDENRNFPKVMSLNIE-EHLNEEMNSKLDKNYNQNLKESTENKQIGNEL 950
            P+W+ TV  ++    DV++  +++ ME RL      A + S    RRKRA T G   LQL++ATR +   + T LVYY++ S N Y++   +++ +  +++   SI+  ++ +  +TY     +  G  ++LW+IGA+ GSL+G+ LIIW+V F+Y RC+RP+D P   K   D     +D F  D   V ++    R  P++     +   + +E+   LD + ++ ++ S E +Q G+ +
Sbjct:   80 PFWIKTVLSSVPATIDVSSCQWRDQMETRLLTLLETARAQSSNGKRRKRAATRGQLALQLINATRSSGNNSVT-LVYYVMLSGN-YLAADPLVTSLATVSSSAASILGYSVESVASTY-----EPLGNSRRLWLIGAILGSLSGLLLIIWVVLFVYQRCLRPFD-PAKDKRYPDDSAIIDDFFYPDGAHVPDM----RANPRIGYSRADIGTIADEVAKHLDSHMSELVRTSAEAEQNGHSI 309          
BLAST of Mucin-19-like isoform X3 vs. TrEMBL
Match: A0A1I8GI66 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.403e-17
Identity = 75/240 (31.25%), Postives = 136/240 (56.67%), Query Frame = 3
Query:  237 PYWVVTV-CNISTLTDVTTST-FKNDMELRLSNAYAVALSASQTSGRRKRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVFGSLAGVALIIWLVFFIYSRCIRPWDEPLLLKESEDLER--NDSFSDDQIKVLNITDENRNFPKVMSLNIE-EHLNEEMNSKLDKNYNQNLKESTENKQIG 941
            P+W+ TV  ++    DV+++  +++ ME RL      A + S +  RRKRA T G   LQL++ATR +   + T LVYY++ S N Y++  ++++ +  +++   SI+  ++ +  +TY     ++ G  ++LW+IGA+ GSL+G+ LIIW+V F+Y RC+RP+D P   K   D     +D F  D+  V ++    R  P++     +   + +E+   LD + ++ ++ S E +Q G
Sbjct:   80 PFWITTVLSSVPATIDVSSNCQWRDQMETRLLTLLETARAQSSSGKRRKRAATRGQLALQLINATRSSGNNSVT-LVYYVMLSGN-YLAADSLVTSLATVSSSAASILGYSVESLASTY-----ESLGNSRRLWLIGAILGSLSGLLLIIWVVLFVYQRCLRPFD-PAKDKRYPDDSAIIDDFFYPDEAHVPDM----RANPRIGYSRADIGTIADEVAKHLDSHMSELVRTSAEAEQNG 307          
BLAST of Mucin-19-like isoform X3 vs. TrEMBL
Match: A0A267DDP3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016056g1 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.012e-16
Identity = 70/246 (28.46%), Postives = 128/246 (52.03%), Query Frame = 3
Query:  237 PYWVVTVC-NISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRRKRAVT-NGTNTLQLVSATRITATQTPTNLVYYIVGSSNT-YISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVFGSLAGVALIIWLVFFIYSRCIRPWDEPLLLKESEDLERNDSFSDDQIKVLNITDENR-NFPKVMSLNIE----EHLNEEMNSKLDKNYNQNLKESTENKQIGNEL 950
            P+WV+TV  ++++ TDV+   + +DME  L      + + S T GRR+R    N +  LQLVSATR   ++   +LVYY + +    Y+   +V+S +N  N+ ++ ++L   V + A     +     +  KLW+IGAV G L  + LI+W V F Y +C+RP++ P    + E        + ++++ L +  + + +F     L I     + L E +  +LD++  + L++S    + G ++
Sbjct:   79 PFWVLTVLQSVTSATDVSACQWADDMESLLLTLLTESQALSSTGGRRRRRFAENSSLRLQLVSATRDAGSER-VSLVYYAMSAGGAAYLPADSVVSAING-NSARVPVVLGYSVESPAASVYDSAAA-ASSSKLWVIGAVLGCLGALLLIVWAVLFAYHKCLRPYEAPKFAHQHE------GPAAEELEFLGLEGDGKTHFGAKAGLAISGAEMDQLAERVAERLDRSVARVLRDSQRQPRRGRDV 315          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Cavefish
Match: ENSAMXT00000003188.2 (pep primary_assembly:Astyanax_mexicanus-2.0:18:4066830:4102665:1 gene:ENSAMXG00000003098.2 transcript:ENSAMXT00000003188.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 7.883e-9
Identity = 39/144 (27.08%), Postives = 72/144 (50.00%), Query Frame = 3
Query:  240 YWVVTVCNISTLT-DVTTSTFKNDMELRLSNAYAVALSASQTSGRRKRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVFGSLAGV 668
            +W++T+ ++   + +    +F + +E RL+  + VA    Q   R KRA T G+ T+Q+V+  R++  + P  L YY V  + T +  ++   I+N +++Q M++ L   V   A      + N      LWI+ AV   +  V
Sbjct:  187 FWIITIQDVENASLEGQYQSFASLLEQRLAELFVVA---HQQGARFKRATTVGSYTVQMVAMRRVSGLKNPAELTYY-VQLNGTPLPGTSAAKILNTVDSQTMALTLGYFVQLQAEVVKIPSNN------LWILAAVLAPIGVV 320          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Cavefish
Match: si:ch211-1e14.1 (UPF0606 protein KIAA1549-like [Source:NCBI gene;Acc:103046273])

HSP 1 Score: 50.447 bits (119), Expect = 6.053e-6
Identity = 31/106 (29.25%), Postives = 54/106 (50.94%), Query Frame = 3
Query:  243 WVVTVCNISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRRKRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILN 560
            WV TV        V+   F+  ME RL+      L   +   R KRA + G N++Q+V  TR+     P +++Y++ G S   +   T  +++N+L+ Q+ +I+L 
Sbjct: 1010 WVRTVLLGVMEQRVSDRIFQAKMERRLALLLGEGLGTGR---RFKRATSIGNNSVQIVQTTRLAGPDNPLDMIYFVEGPSGERLPAVTTANLLNRLDVQRAAIVLG 1112          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Cavefish
Match: si:ch211-1e14.1 (UPF0606 protein KIAA1549-like [Source:NCBI gene;Acc:103046273])

HSP 1 Score: 50.447 bits (119), Expect = 6.302e-6
Identity = 31/106 (29.25%), Postives = 54/106 (50.94%), Query Frame = 3
Query:  243 WVVTVCNISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRRKRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILN 560
            WV TV        V+   F+  ME RL+      L   +   R KRA + G N++Q+V  TR+     P +++Y++ G S   +   T  +++N+L+ Q+ +I+L 
Sbjct:  875 WVRTVLLGVMEQRVSDRIFQAKMERRLALLLGEGLGTGR---RFKRATSIGNNSVQIVQTTRLAGPDNPLDMIYFVEGPSGERLPAVTTANLLNRLDVQRAAIVLG 977          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Cavefish
Match: si:ch211-1e14.1 (UPF0606 protein KIAA1549-like [Source:NCBI gene;Acc:103046273])

HSP 1 Score: 50.447 bits (119), Expect = 6.583e-6
Identity = 31/106 (29.25%), Postives = 54/106 (50.94%), Query Frame = 3
Query:  243 WVVTVCNISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRRKRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILN 560
            WV TV        V+   F+  ME RL+      L   +   R KRA + G N++Q+V  TR+     P +++Y++ G S   +   T  +++N+L+ Q+ +I+L 
Sbjct: 1010 WVRTVLLGVMEQRVSDRIFQAKMERRLALLLGEGLGTGR---RFKRATSIGNNSVQIVQTTRLAGPDNPLDMIYFVEGPSGERLPAVTTANLLNRLDVQRAAIVLG 1112          
BLAST of Mucin-19-like isoform X3 vs. Ensembl Medaka
Match: si:dkeyp-27e10.3 (UPF0606 protein KIAA1549-like [Source:NCBI gene;Acc:105358172])

HSP 1 Score: 51.9878 bits (123), Expect = 1.565e-6
Identity = 42/155 (27.10%), Postives = 70/155 (45.16%), Query Frame = 3
Query:  243 WVVTVCNISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRR-KRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQK--LWIIGAVFGSLAGVALIIWLVFFI 698
            WV T+  +     V   +FK  +E RL+      L   +TS RR +RA   G N+LQ+V  +R+++ + P  + Y++ GS    +      + +N L+ Q+ +I+L   V             P   Q   +W+I        GVA+ + L  FI
Sbjct:  292 WVRTLLGVQEQL-VAERSFKARLERRLALLLEEGLQ--ETSRRRWRRATAVGNNSLQVVRVSRLSSPENPLEVFYFVEGSGGERVPAEVTAATLNSLDLQRAAIVLGHRVLKPLAQVEELFVPPAETQSNNIWLI-------VGVAVPVLLAVFI 436          
BLAST of Mucin-19-like isoform X3 vs. Planmine SMEST
Match: SMESG000001495.1 (SMESG000001495.1)

HSP 1 Score: 925.62 bits (2391), Expect = 0.000e+0
Identity = 548/554 (98.92%), Postives = 549/554 (99.10%), Query Frame = 3
Query:  102 MKYYGVKLIFGYWFLIYSLVXXXXXXXXXXXXXXXXXXXXXXXXXPYWVVTVCNISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRRKRAVTNGTNTLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSIILNAIVTTVATYYNSATQNPGTDQKLWIIGAVFGSLAGVALIIWLVFFIYSRCIRPWDEPLLLKESEDLERNDSFSDDQIKVLNITDENRNFPKVMSLNIEEHLNEEMNSKLDKNYNQNLKESTENKQIGNELVIKHVYESRPRKYHKRHXXXXXXXXXXXXXXXXXXXXEAKITFDSSNNDTNVINEXXXXXXXXXXXXXXXXXXXXXXXXDIIVSTTLGMEMMASXXXXXXXXXXXXXSDLTPIEEKYAEILKYKDQLTNIEDDRSIESEQPLQSPRSSENKININLIEVQPKSLPQNDINSFELVEPVLFMNNYGPQHIFPNYSTEIYAISDTSLNLVEIKETDKLESQRSEMKSKQNLRTFEPLPRKNVQKINYDISTDDLIASLNKEMNEVKQYNSKTD 1763
            MKYYGVKLIFGYWFLIYSLVQSQTTGISSTITLTATTLSTDQITSPYWVVTVCNISTLTDVTTSTFKNDME RLSNAYAVALSASQTSGRRKRA TNGTNTLQLVSATRITATQTPTNLVYYIVGS NTYISPSTVISIMNQLNTQQMSI+LNAIVTTVATYYNSATQNPGTDQKLWIIGAVFGSLAGVALIIWLVFFIYSRCIRPWDEPLLLKESEDLERNDSFSDDQIKVLNITDENRNF KVMSLNIEEHLNEEMNSKLDKNYNQNLKESTENKQIGNELVIKHVYESRPRKYHKRHSSSSSSSSSSDSKKKKKSSKEAKITFDSSNNDTNVINEKQKVKKKSKIKQQSIKKKKKPQISDIIVSTTLGMEMMASNTTLNTNLTKENNSDLTPIEEKYAEILKYKDQLTNIEDDRSIESEQPLQSPRSSENKININLIEVQPKSLPQNDINSFELVEPV FMNNYGPQHIFPNYSTEIYAISDTSLNLVEIKETDKLESQRSEMKSKQNLRTFEPLPRKNVQKINYDISTDDLIASLNKEMNEVKQYNSKTD
Sbjct:    1 MKYYGVKLIFGYWFLIYSLVQSQTTGISSTITLTATTLSTDQITSPYWVVTVCNISTLTDVTTSTFKNDMEFRLSNAYAVALSASQTSGRRKRAATNGTNTLQLVSATRITATQTPTNLVYYIVGSGNTYISPSTVISIMNQLNTQQMSILLNAIVTTVATYYNSATQNPGTDQKLWIIGAVFGSLAGVALIIWLVFFIYSRCIRPWDEPLLLKESEDLERNDSFSDDQIKVLNITDENRNFTKVMSLNIEEHLNEEMNSKLDKNYNQNLKESTENKQIGNELVIKHVYESRPRKYHKRHSSSSSSSSSSDSKKKKKSSKEAKITFDSSNNDTNVINEKQKVKKKSKIKQQSIKKKKKPQISDIIVSTTLGMEMMASNTTLNTNLTKENNSDLTPIEEKYAEILKYKDQLTNIEDDRSIESEQPLQSPRSSENKININLIEVQPKSLPQNDINSFELVEPVPFMNNYGPQHIFPNYSTEIYAISDTSLNLVEIKETDKLESQRSEMKSKQNLRTFEPLPRKNVQKINYDISTDDLIASLNKEMNEVKQYNSKTD 554          
The following BLAST results are available for this feature:
BLAST of Mucin-19-like isoform X3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
KIAA1549L2.281e-930.71KIAA1549 like [Source:HGNC Symbol;Acc:HGNC:24836][more]
KIAA1549L2.316e-930.50KIAA1549 like [Source:HGNC Symbol;Acc:HGNC:24836][more]
KIAA1549L3.004e-930.71KIAA1549 like [Source:HGNC Symbol;Acc:HGNC:24836][more]
KIAA1549L5.539e-930.50KIAA1549 like [Source:HGNC Symbol;Acc:HGNC:24836][more]
back to top
BLAST of Mucin-19-like isoform X3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mucin-19-like isoform X3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mucin-19-like isoform X3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kiaa1549lb1.004e-1031.25KIAA1549-like b [Source:ZFIN;Acc:ZDB-GENE-050419-1... [more]
si:dkeyp-27e10.38.290e-729.52si:dkeyp-27e10.3 [Source:ZFIN;Acc:ZDB-GENE-041210-... [more]
si:ch211-1e14.18.888e-727.21si:ch211-1e14.1 [Source:ZFIN;Acc:ZDB-GENE-050420-1... [more]
si:ch211-1e14.16.698e-627.21si:ch211-1e14.1 [Source:ZFIN;Acc:ZDB-GENE-050420-1... [more]
si:ch211-1e14.17.483e-627.21si:ch211-1e14.1 [Source:ZFIN;Acc:ZDB-GENE-050420-1... [more]
back to top
BLAST of Mucin-19-like isoform X3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000043419.12.376e-732.17pep primary_assembly:Xenopus_tropicalis_v9.1:3:123... [more]
ENSXETT00000043410.12.402e-732.17pep primary_assembly:Xenopus_tropicalis_v9.1:3:123... [more]
back to top
BLAST of Mucin-19-like isoform X3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
D430041D05Rik1.030e-930.71RIKEN cDNA D430041D05 gene [Source:MGI Symbol;Acc:... [more]
D430041D05Rik6.718e-930.50RIKEN cDNA D430041D05 gene [Source:MGI Symbol;Acc:... [more]
D430041D05Rik7.073e-930.50RIKEN cDNA D430041D05 gene [Source:MGI Symbol;Acc:... [more]
D430041D05Rik8.556e-930.50RIKEN cDNA D430041D05 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Mucin-19-like isoform X3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q6ZVL6|K154L_HUMAN1.112e-830.50UPF0606 protein KIAA1549L OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Mucin-19-like isoform X3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F4032.420e-1831.40Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G3G61.228e-1730.86Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E0E01.295e-1730.99Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GI662.403e-1731.25Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DDP32.012e-1628.46Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Mucin-19-like isoform X3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000003188.27.883e-927.08pep primary_assembly:Astyanax_mexicanus-2.0:18:406... [more]
si:ch211-1e14.16.053e-629.25UPF0606 protein KIAA1549-like [Source:NCBI gene;Ac... [more]
si:ch211-1e14.16.302e-629.25UPF0606 protein KIAA1549-like [Source:NCBI gene;Ac... [more]
si:ch211-1e14.16.583e-629.25UPF0606 protein KIAA1549-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Mucin-19-like isoform X3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mucin-19-like isoform X3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mucin-19-like isoform X3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mucin-19-like isoform X3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkeyp-27e10.31.565e-627.10UPF0606 protein KIAA1549-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Mucin-19-like isoform X3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000001495.10.000e+098.92SMESG000001495.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026544 ID=SMED30026544|Name=Mucin-19-like isoform X3|organism=Schmidtea mediterranea sexual|type=transcript|length=1835bp
TTTAACAATTGAAATTTAATCAAAATATTTATTTTAAATGATTTTCTGTT
AAAAATTGATTTTATTAAGCCATTTAAGATTTATTCAAATAGATTATAAA
TATGAAGTATTATGGTGTTAAGTTAATTTTTGGATACTGGTTTCTTATAT
ATTCATTGGTACAAAGTCAAACAACGGGAATTTCCTCGACAATTACATTA
ACAGCCACAACTCTCAGTACGGACCAAATTACCTCGCCATATTGGGTAGT
AACAGTATGTAACATATCCACCTTAACTGATGTGACAACTTCTACATTTA
AAAACGACATGGAACTTCGCCTATCAAATGCGTATGCAGTGGCTCTTAGT
GCTAGTCAGACATCTGGACGACGAAAAAGAGCCGTAACTAATGGTACAAA
TACCTTACAATTAGTCAGTGCTACGCGGATTACAGCTACGCAAACCCCAA
CAAATTTAGTTTACTATATTGTTGGGTCGAGTAATACTTATATCTCACCA
TCAACGGTCATTAGCATTATGAATCAATTGAACACTCAACAGATGTCAAT
TATTTTAAATGCAATCGTTACAACGGTGGCGACATATTATAATTCTGCAA
CTCAAAATCCGGGGACTGATCAAAAGTTGTGGATAATTGGCGCTGTGTTT
GGTTCTTTGGCCGGAGTAGCGCTGATTATTTGGCTAGTATTTTTTATCTA
TTCACGGTGCATTCGACCATGGGATGAGCCACTCCTTCTCAAAGAGTCGG
AAGATCTGGAAAGAAATGACTCATTCAGTGATGATCAAATCAAAGTATTA
AATATTACAGATGAAAATAGAAATTTCCCAAAAGTAATGAGTTTGAACAT
CGAAGAACATTTAAATGAGGAAATGAATAGTAAACTTGATAAAAATTATA
ATCAGAATTTGAAAGAATCAACAGAAAACAAACAAATTGGAAATGAATTA
GTCATCAAACATGTTTATGAATCACGGCCAAGAAAATACCATAAACGACA
TTCATCGTCATCATCATCATCTAGCTCCAGTGATAGTAAGAAGAAAAAGA
AATCTTCCAAAGAGGCTAAAATTACATTTGATTCTTCAAATAATGATACT
AACGTTATAAATGAAAAGCAGAAAGTAAAAAAGAAATCTAAAATTAAACA
ACAATCAATTAAAAAGAAAAAGAAACCTCAAATTTCAGACATAATAGTGA
GCACTACGTTAGGAATGGAAATGATGGCTTCAAATACTACATTAAACACA
AATCTCACAAAAGAAAACAACAGTGATCTGACGCCTATCGAAGAAAAATA
TGCTGAGATCTTAAAATATAAAGATCAATTAACAAACATTGAGGATGATC
GCAGTATTGAATCAGAACAACCTTTACAGTCTCCAAGATCATCTGAAAAT
AAGATCAACATAAATTTGATAGAAGTCCAGCCGAAAAGTTTGCCGCAGAA
TGACATCAACAGTTTTGAATTAGTTGAGCCAGTCCTTTTCATGAATAATT
ATGGACCTCAGCATATCTTCCCAAATTATTCCACTGAAATATATGCAATA
TCTGATACATCTTTGAATCTTGTTGAAATAAAAGAGACAGATAAATTGGA
ATCACAACGATCAGAAATGAAATCTAAACAAAATTTAAGAACATTTGAGC
CACTACCTAGAAAAAATGTCCAAAAAATAAATTACGACATTTCTACGGAT
GATTTGATTGCCTCTCTGAATAAAGAAATGAACGAAGTCAAACAATATAA
CTCGAAAACAGATTAAAATAAGTTAAATTTTCAGAAAAAAGACATTTATA
CTTTTTATAAAATTATATTTTTCAGTTATTTTCAC
back to top

protein sequence of SMED30026544-orf-1

>SMED30026544-orf-1 ID=SMED30026544-orf-1|Name=SMED30026544-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=555bp
MKYYGVKLIFGYWFLIYSLVQSQTTGISSTITLTATTLSTDQITSPYWVV
TVCNISTLTDVTTSTFKNDMELRLSNAYAVALSASQTSGRRKRAVTNGTN
TLQLVSATRITATQTPTNLVYYIVGSSNTYISPSTVISIMNQLNTQQMSI
ILNAIVTTVATYYNSATQNPGTDQKLWIIGAVFGSLAGVALIIWLVFFIY
SRCIRPWDEPLLLKESEDLERNDSFSDDQIKVLNITDENRNFPKVMSLNI
EEHLNEEMNSKLDKNYNQNLKESTENKQIGNELVIKHVYESRPRKYHKRH
SSSSSSSSSSDSKKKKKSSKEAKITFDSSNNDTNVINEKQKVKKKSKIKQ
QSIKKKKKPQISDIIVSTTLGMEMMASNTTLNTNLTKENNSDLTPIEEKY
AEILKYKDQLTNIEDDRSIESEQPLQSPRSSENKININLIEVQPKSLPQN
DINSFELVEPVLFMNNYGPQHIFPNYSTEIYAISDTSLNLVEIKETDKLE
SQRSEMKSKQNLRTFEPLPRKNVQKINYDISTDDLIASLNKEMNEVKQYN
SKTD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR024606DUF3827
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 396..416
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 290..359
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.671
NoneNo IPR availableTMHMMTMhelixcoord: 149..166
NoneNo IPR availableTMHMMTMhelixcoord: 176..198
IPR024606Protein of unknown function DUF3827PFAMPF12877DUF3827coord: 37..200
e-value: 2.0E-25
score: 89.3
IPR024606Protein of unknown function DUF3827PANTHERPTHR21590UNCHARACTERIZEDcoord: 37..196