Protocadherin

Overview
NameProtocadherin
Smed IDSMED30026540
Length (bp)3804
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin (SMED30026540) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin (SMED30026540) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin (SMED30026540) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin (SMED30026540) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026540

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30026540SMESG000076551.1 dd_Smed_v4_7552_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026540SMESG000076551.1 dd_Smed_v4_7552_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30026540SMESG000076551.1 dd_Smed_v4_7552_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 224.942 bits (572), Expect = 6.047e-59
Identity = 248/878 (28.25%), Postives = 390/878 (44.42%), Query Frame = 1
Query:  286 LFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPN------VDYSVTYDNKYFSIIXXXXXXKEV------IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQID--DENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVP--------------------PLSND---ASITVHVQDNGRFANIN------LTIIIGMIAITVSISVFL-IVAIICVRRQPRFQ 2748
            +F + +   +F+  A Q  N +I EE P N ++GN+   L+ +  PN      + + + Y      +I       E+      ID EKLC             + EV IL         I   I+DINDN P F      +SIPENS + S   +  A+D D    N V++Y+   S   F +D     +     +L +QK +D E+++ Y   ++  ED          ++Q+   D NDN P F +   E +I E+ PVG  + ++ A D D  +  K  +   S    N+  R F ++  TG + +K  LD     +  K  + ASD        +  R  V+++V D+NDN P+I +     +   +  T+ + EN P    I L +V+D+D   NGRV+C    ++    L+ V    + L +    DYE  KE  IK L    D GKP L +   + I ++D N+  P F  +    S+ EN  PG  ++ V ATD D    AE+ Y +       FS+D +TG++ T     DRE      F +  KD+   P T+NV V + I+D NDN PVF  +  +F+V EN+  +    G +  TD D    N+ V    +   D          F I   TG I   +  DREK  ++T  VKA D G  +R + A  TI V D+NDN+P +I P P N+   +       P+ N   +      + ++ A+D D      V Y +   N  ++F +++ TG  ITL+       LG + +   A D G P                     L N+    SI   V  N   A+++      + I++  +A T+++ V + I A++  R+ P  +
Sbjct:   41 IFAVLLVCVVFHSGA-QEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC--FYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGI-NGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKV-EDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSF-SNLVSNIARRLFHLNATTGLITIKEPLDREETPN-HKLLVLASDG-----GLMPARAMVLVNVTDVNDNVPSIDI---RYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI-PFRLRPVFSNQFLLENAAYLDYESTKEYAIKLL--AADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGML-TVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLP-RHGTVGLITVTDPDYGD-NSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP-PYNYSYELV-----LPSTNPGTV------VFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGN-ITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVVRCRQAPHLK 875          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 223.016 bits (567), Expect = 7.083e-59
Identity = 216/708 (30.51%), Postives = 329/708 (46.47%), Query Frame = 1
Query:  499 IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQT-NGDNMFGLNETTGELITL---VSPLKLGTYVLKFTARDNGVP 2586
            ID EKLC       E+ C  + EV+IL +       I I +KD NDN P F +    +SIPEN+ + S   I  A D D +  N V+ Y+  +    F +D     +     +L +Q+++D E+++ Y   ++  +  T   +   I+ + + D NDN P F +   E  I E+ PVG  ++++ A D D     +  Y I          R F ++  TG + ++  LD     ++ K  + ASD      +S   R  V I+V D+NDN P I +     +   +  T+ + E +P    I L +VSD+D   NG+V C ++ ++    LK V    Y L ++   DYE            D GKPSL +   + + +ED N+ PP F       S+ EN   G  + T+ ATD D  K+A+++Y +       F +D KTG+++ S V FDRE      F V  +D+ T P  +   V + +LD NDN P F  +  QFFV EN+  K    G +  TD D  + N  V    +   D+         F + P +G I++ V  DRE+  ++T  VKA D G P R + A  TI V D+NDN P  I P P N    + P      AI  S +AE       + A+D D      + Y + + N   +F ++  TG  ITL    +P  +G + L     D G P
Sbjct:   92 IDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRY-IFGAQVAPATKRLFALNNTTGLITVQRSLD-REETAIHKVTVLASDG-----SSTPARATVTINVTDVNDNPPNIDL---RYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA-SFFDLDRKTGVLTASRV-FDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLP-KYSTVGVITVTDADAGE-NKAVTLSILNDNDN---------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISP-PSNTSFKLVPL----SAIPGSVVAE-------VFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGN-ITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 118.627 bits (296), Expect = 3.317e-26
Identity = 147/550 (26.73%), Postives = 236/550 (42.91%), Query Frame = 1
Query: 1078 YKIVSK-GNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSK-FTSVE---------DRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDV----GGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVL----KHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDP----VFLLSSLQ--FFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGR---VCYYLQTNGDNMFGLNETTGELIT--LVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            Y++VSK G+  L+    K+S  TG +        SNRI   K    AS   +++ F  +E             + I V+D NDN P            S  + I I EN        + S +D D   NG    EL        L  V    G  +  L      D E++D      + +D G P       +++ + DVN+  P F+  +    + EN P G+ V+ + ATD D   +AE+ Y    +V     + F+++N TGLI+      DRE T+I +  V   D  + P  A   V I + DVNDN P     +++S +    ++ E   + TK+   +  +D+D D     V  + +   + ++  H+K V+  +     +ET  +LD E    ++  + A DSG P+    A   + + D NDN P                 I+  P I +S ++E ++  L L  I   + D+G+   + Y L  N  + F L+  TG L    +    +   ++   TARDNG PPL + A++ V V D
Sbjct:   64 YRLVSKAGDAPLV----KVSSSTGEI-----FTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFP---------SPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQR-SLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKI-ALITVSDKDTD-----VNGKVICFIEREVPFHLKAVYDNQYL---LETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPP-----------------IFNQPVIELS-VSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA-SFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD 564          

HSP 3 Score: 88.9669 bits (219), Expect = 4.154e-17
Identity = 141/594 (23.74%), Postives = 243/594 (40.91%), Query Frame = 1
Query:  922 QIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTG---SLILKSQLDLSNRIS-VFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRV----SCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGS-------LRENTPPGSPV--LTVRATDRDKSAELIYSIDRKVLKHFSI--DNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKP---VFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVS--PLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +I I + D NDN P F       +I E+  +        A D D   FN  ++  +  G +++       +P+      LI++  LD   + + V K ++      +   T++     + + V D+NDN+P  K   G V        + I EN P    +I L  +D D+  N  +      ++    + L   +   G   +  +   D E+  + K      D    S     T+ I++ DVN+ PP   +  Y+ S       L E  P  + +  +TV   D D + ++I  I+R+V  H     DN+  L ++S +  D E T    F++   D          LV++++ D NDN P+F    ++  V EN +    L   ++ATD D  +             +  ++  + P    F +   TG +    V DRE+   +  TV A D+G+P   + A   + V D NDN P++ +        H   F+ E           K+  +  +   D D  +   V   +  + DN F L+  +G + + VS    +  +Y     A D G PP S+ A +T++V D
Sbjct:  127 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDT-GFNGVQHYELLNG-QSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAI-----LQVTVSDVNDNRPVFK--EGQV-------EVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRS--LDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNI-DLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLL--DYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLT-TISATDEDSGK-------------NADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH-------NHFQFFVSEN--------LPKYSTVGVITVTDADAGENKAVTLSILNDNDN-FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD 667          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 221.476 bits (563), Expect = 2.049e-58
Identity = 248/878 (28.25%), Postives = 390/878 (44.42%), Query Frame = 1
Query:  286 LFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPN------VDYSVTYDNKYFSIIXXXXXXKEV------IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQID--DENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY-YLQTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVP--------------------PLSND---ASITVHVQDNGRFANIN------LTIIIGMIAITVSISVFL-IVAIICVRRQPRFQ 2748
            +F + +   +F+  A Q  N +I EE P N ++GN+   L+ +  PN      + + + Y      +I       E+      ID EKLC             + EV IL         I   I+DINDN P F      +SIPENS + S   +  A+D D    N V++Y+   S   F +D     +     +L +QK +D E+++ Y   ++  ED          ++Q+   D NDN P F +   E +I E+ PVG  + ++ A D D  +  K  +   S    N+  R F ++  TG + +K  LD     +  K  + ASD        +  R  V+++V D+NDN P+I +     +   +  T+ + EN P    I L +V+D+D   NGRV+C    ++    L+ V    + L +    DYE  KE  IK L    D GKP L +   + I ++D N+  P F  +    S+ EN  PG  ++ V ATD D    AE+ Y +       FS+D +TG++ T     DRE      F +  KD+   P T+NV V + I+D NDN PVF  +  +F+V EN+  +    G +  TD D    N+ V    +   D          F I   TG I   +  DREK  ++T  VKA D G  +R + A  TI V D+NDN+P +I P P N+   +       P+ N         ++ ++ A+D D      V Y  +  N  ++F +++ TG  ITL+       LG + +   A D G P                     L N+    SI   V  N   A+++      + I++  +A T+++ V + I A++  R+ P  +
Sbjct:   30 IFAVLLVCVVFHSGA-QEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC--FYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGI-NGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVK-VEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSF-SNLVSNIARRLFHLNATTGLITIKEPLDREETPN-HKLLVLASDG-----GLMPARAMVLVNVTDVNDNVPSIDI---RYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI-PFRLRPVFSNQFLLENAAYLDYESTKEYAIKLL--AADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGML-TVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLP-RHGTVGLITVTDPDYGD-NSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP-PYNYSYELV-----LPSTN------PGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGN-ITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVVRCRQAPHLK 864          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 221.476 bits (563), Expect = 2.049e-58
Identity = 248/878 (28.25%), Postives = 390/878 (44.42%), Query Frame = 1
Query:  286 LFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPN------VDYSVTYDNKYFSIIXXXXXXKEV------IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQID--DENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY-YLQTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVP--------------------PLSND---ASITVHVQDNGRFANIN------LTIIIGMIAITVSISVFL-IVAIICVRRQPRFQ 2748
            +F + +   +F+  A Q  N +I EE P N ++GN+   L+ +  PN      + + + Y      +I       E+      ID EKLC             + EV IL         I   I+DINDN P F      +SIPENS + S   +  A+D D    N V++Y+   S   F +D     +     +L +QK +D E+++ Y   ++  ED          ++Q+   D NDN P F +   E +I E+ PVG  + ++ A D D  +  K  +   S    N+  R F ++  TG + +K  LD     +  K  + ASD        +  R  V+++V D+NDN P+I +     +   +  T+ + EN P    I L +V+D+D   NGRV+C    ++    L+ V    + L +    DYE  KE  IK L    D GKP L +   + I ++D N+  P F  +    S+ EN  PG  ++ V ATD D    AE+ Y +       FS+D +TG++ T     DRE      F +  KD+   P T+NV V + I+D NDN PVF  +  +F+V EN+  +    G +  TD D    N+ V    +   D          F I   TG I   +  DREK  ++T  VKA D G  +R + A  TI V D+NDN+P +I P P N+   +       P+ N         ++ ++ A+D D      V Y  +  N  ++F +++ TG  ITL+       LG + +   A D G P                     L N+    SI   V  N   A+++      + I++  +A T+++ V + I A++  R+ P  +
Sbjct:   30 IFAVLLVCVVFHSGA-QEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC--FYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGI-NGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVK-VEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSF-SNLVSNIARRLFHLNATTGLITIKEPLDREETPN-HKLLVLASDG-----GLMPARAMVLVNVTDVNDNVPSIDI---RYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI-PFRLRPVFSNQFLLENAAYLDYESTKEYAIKLL--AADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGML-TVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLP-RHGTVGLITVTDPDYGD-NSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP-PYNYSYELV-----LPSTN------PGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGN-ITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVVRCRQAPHLK 864          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 222.631 bits (566), Expect = 2.208e-58
Identity = 216/708 (30.51%), Postives = 329/708 (46.47%), Query Frame = 1
Query:  499 IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQT-NGDNMFGLNETTGELITL---VSPLKLGTYVLKFTARDNGVP 2586
            ID EKLC       E+ C  + EV+IL +       I I +KD NDN P F +    +SIPEN+ + S   I  A D D +  N V+ Y+  +    F +D     +     +L +Q+++D E+++ Y   ++  +  T   +   I+ + + D NDN P F +   E  I E+ PVG  ++++ A D D     +  Y I          R F ++  TG + ++  LD     ++ K  + ASD      +S   R  V I+V D+NDN P I +     +   +  T+ + E +P    I L +VSD+D   NG+V C ++ ++    LK V    Y L ++   DYE            D GKPSL +   + + +ED N+ PP F       S+ EN   G  + T+ ATD D  K+A+++Y +       F +D KTG+++ S V FDRE      F V  +D+ T P  +   V + +LD NDN P F  +  QFFV EN+  K    G +  TD D  + N  V    +   D+         F + P +G I++ V  DRE+  ++T  VKA D G P R + A  TI V D+NDN P  I P P N    + P      AI  S +AE       + A+D D      + Y + + N   +F ++  TG  ITL    +P  +G + L     D G P
Sbjct:   92 IDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRY-IFGAQVAPATKRLFALNNTTGLITVQRSLD-REETAIHKVTVLASDG-----SSTPARATVTINVTDVNDNPPNIDL---RYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA-SFFDLDRKTGVLTASRV-FDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLP-KYSTVGVITVTDADAGE-NKAVTLSILNDNDN---------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISP-PSNTSFKLVPL----SAIPGSVVAE-------VFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGN-ITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 118.242 bits (295), Expect = 5.443e-26
Identity = 147/550 (26.73%), Postives = 236/550 (42.91%), Query Frame = 1
Query: 1078 YKIVSK-GNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSK-FTSVE---------DRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDV----GGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVL----KHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDP----VFLLSSLQ--FFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGR---VCYYLQTNGDNMFGLNETTGELIT--LVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            Y++VSK G+  L+    K+S  TG +   S     NRI   K    AS   +++ F  +E             + I V+D NDN P            S  + I I EN        + S +D D   NG    EL        L  V    G  +  L      D E++D      + +D G P       +++ + DVN+  P F+  +    + EN P G+ V+ + ATD D   +AE+ Y    +V     + F+++N TGLI+      DRE T+I +  V   D  + P  A   V I + DVNDN P     +++S +    ++ E   + TK+   +  +D+D D     V  + +   + ++  H+K V+  +     +ET  +LD E    ++  + A DSG P+    A   + + D NDN P                 I+  P I +S ++E ++  L L  I   + D+G+   + Y L  N  + F L+  TG L    +    +   ++   TARDNG PPL + A++ V V D
Sbjct:   64 YRLVSKAGDAPLV----KVSSSTGEIFTTS-----NRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFP---------SPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRS-LDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKI-ALITVSDKDTD-----VNGKVICFIEREVPFHLKAVYDNQYL---LETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPP-----------------IFNQPVIELS-VSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA-SFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD 564          

HSP 3 Score: 89.3521 bits (220), Expect = 3.845e-17
Identity = 141/594 (23.74%), Postives = 243/594 (40.91%), Query Frame = 1
Query:  922 QIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDT---GSLILKSQLDLSNRIS-VFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRV----SCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGS-------LRENTPPGSPV--LTVRATDRDKSAELIYSIDRKVLKHFSI--DNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKP---VFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVS--PLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +I I + D NDN P F       +I E+  +        A D D   FN  ++  +  G +++       +P+      LI++  LD   + + V K ++      +   T++     + + V D+NDN+P  K   G V        + I EN P    +I L  +D D+  N  +      ++    + L   +   G   +  +   D E+  + K      D    S     T+ I++ DVN+ PP   +  Y+ S       L E  P  + +  +TV   D D + ++I  I+R+V  H     DN+  L ++S +  D E T    F++   D          LV++++ D NDN P+F    ++  V EN +    L   ++ATD D  +             +  ++  + P    F +   TG +    V DRE+   +  TV A D+G+P   + A   + V D NDN P++ +        H   F+ E           K+  +  +   D D  +   V   +  + DN F L+  +G + + VS    +  +Y     A D G PP S+ A +T++V D
Sbjct:  127 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDT-GFNGVQHYELLNG-QSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAI-----LQVTVSDVNDNRPVFK--EGQV-------EVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRS--LDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNI-DLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLL--DYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLT-TISATDEDSGK-------------NADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH-------NHFQFFVSEN--------LPKYSTVGVITVTDADAGENKAVTLSILNDNDN-FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD 667          
BLAST of Protocadherin vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 139.043 bits (349), Expect = 1.072e-32
Identity = 151/574 (26.31%), Postives = 266/574 (46.34%), Query Frame = 1
Query:  592 KNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVK-SYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRVSCELKE-DLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQP 2295
            +++ ++ I + D+NDN P F ++   V+I EN  + ++I    A D+DF    +V  S          TID S  E   + L++ ID  K +  T  ++A + +    S+   + I + D ND+ P         T+ E+  +G+E+ +V AID D       +Y +  +G+ + I     I  D+G LI  ++L      + +  +++A D       S+   T + + ++DINDN PT      NV          I E  P   ++I L   D D  E+ +++  ++E D +   + D+G     L S       ++  ++      D G   L+    + + I+DVN   P F ++ +   + E++P G PV+T++A D D+   A ++YSID    + F ID  +G IS S    DRE  +     V   D  + P   +  +++ + D+NDN P F  SS    + E++ + T    +++A D D    N  V Y          I+    +F++  T+G +     LDRE++    + + A D G+P+  A +  T+ + D+NDN P
Sbjct:  356 ESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGE---VTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM--EGSEDFI-----IDEDSG-LIKTTKLLDRETTARYSLKVTARDM---GTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVT---------ISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAIL-SVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS--QFFRIDPSSGDISVS-SDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFL-QVSAIDADIGP-NGIVDYFLNESSSSPSIQ----LFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAP 890          

HSP 2 Score: 129.413 bits (324), Expect = 1.088e-29
Identity = 174/693 (25.11%), Postives = 284/693 (40.98%), Query Frame = 1
Query:  598 SFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGC---STQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIG-LSVSDRDLKENG--RVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSI---DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDN----MFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            S  + + + D+ DN P F  +     I E++ + + +    A D D      ++    E + K     N+        +Q +   +++ L    L       G     +   + I + D NDN P F+ +SY  TI+E+  +   I  V+A D D     K  Y + S      ++    I   TG + L+ ++D  N  S     I A D  +   +S    T   I+V DIND+ PT+      +  + M   I ++EN    + +G +   D D   NG  + S E  ED     + D   G   + +T   D E           +D G PSL    TI + ++D+N+  P F   EY  ++ E  P GS ++T++A D D+  ++ Y I   DR+V     I ++  ++S S     R+   ++  E++  D          +V + I DVN + P F        + E+  I   +   L A D D    N  + Y   +             F+I P++G+I     LDRE    +++ V A D  SP         + + D+NDN P+               F   + A  IS+        L++ AID D    G V Y+L  +  +    +F L+ T+G L  + S L   +    VL   ARD G P LS  + IT+ + D
Sbjct:  253 STTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAK----SGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLT----IDYSTGEVTLRERIDAKN--SPITAVIRAKDGAQPALSSTVPLT---INVIDINDHAPTL------IAAQKM---ITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDF----IIDEDSGL--IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSG-ELKRQDHKVR-VEISATDQ--GGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVI-TLKAEDHDRGD-NARIVYSIDS----------SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQ---------------FTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTL-RVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSD 884          

HSP 3 Score: 122.865 bits (307), Expect = 9.376e-28
Identity = 169/681 (24.82%), Postives = 280/681 (41.12%), Query Frame = 1
Query:  637 NKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKF-----EDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACE--DSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIG-LSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDL----IKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVK--AYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            N  +F+  K +  +PE++ + +II    A  K   A ++   Y         S   FT+D  + E   + L KS+D E  + +   + A E  D T  S    +V+ + D  DN P F K+SY   I E  P+G  +L V A D+D  +  + EY +     +NL++    I+  +G +   + LD    +S+ +  + ASDK   K    E    V I V D+NDN P     + NV          I EN     +I  +  +D D   NG+V   +           +GG   D  +      E+ D     I  +   +D  +P+L     + I++ D+N++ P     + + +L EN   G  V  V A D D     I     +  + F ID  +GLI T+ +  DRE T+    +V  +D  T     +  + + + D+NDN P F        + E +   +++   L A D D DQ   +           ++    + VF I     +   L V    K  +  + V+  A D G        N  +++ D+N       +P  +    H SP  Y                ++ LKA D D  D  R+ Y + ++    F ++ ++G+ I++ S L      T+ +  TA D+  PPL+    I V + D
Sbjct:  161 NAVHFQQEKYVKELPEDTPIETII----ASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGE---IRLAKSMDREVLDKHILKVTAYERVDPT-ISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLA----INAKSGVIQTAAPLD-RETLSLIRLDVIASDKGTPK---RESTAMVEITVVDVNDNAPVFASDSYNVT---------ILENITIPAVIATVKATDEDFGTNGKVHYSMASS------SGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKL-LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQII-TLKAVDNDEDQKITY-----------RIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVN--VFIDDVNSAPYFNDHPFSVKIPEH-SPIGYP---------------VITLKAEDHDRGDNARIVYSIDSS--QFFRIDPSSGD-ISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDD 776          

HSP 4 Score: 120.553 bits (301), Expect = 5.534e-27
Identity = 146/581 (25.13%), Postives = 251/581 (43.20%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLF-LQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDIN-----DNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIY------SIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNF-VKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAY---DSGSPTRFAFANATIYVRDLNDNQP 2295
            ++I + DIND+ P     ++++++ EN  +   +    AID+D S  N +  Y  E S + F ID    ED  L    K +D E    Y+  + A +  T   +T   I + + D NDN P F K+ Y  TI E  P G +I+ ++A+D D  +  K  Y+I  + +R + S    I  D G+ IL    +L  +    + +ISA+D+       ++ R  V + ++D+N     ++ P                ++KI E+ P    +I L   D D  +N R+   + +  Q   +    G   D+  +   D E       +    DH  P L     IE+ ++D+N+  P F ++ Y  ++ E+ P G+  L V A D D     I       S     ++ F +D  +G +  S    DRE  ++    +  +D  T   +A   + + + DVNDN P F   S   ++ EN  + + + G + A  RD D+ +N  + +      D KL       F I     +   + +L R ++       K +    + S    +     I+V D+NDN+P
Sbjct:  465 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDED-SGPNGIIKYSMEGS-EDFIID----EDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRI-EEADREVFS-ILDIG-DQGA-ILSVSGELKRQDHKVRVEISATDQ-----GGLQGRCVVNVFIDDVNSAPYFNDHP---------------FSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-DSSQFFRIDPSSG---DISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVS-SKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTV-GTIVA--RDADEGDNADISFRIFGGADAKL-------FDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKP 998          

HSP 5 Score: 94.7449 bits (234), Expect = 3.659e-19
Identity = 104/394 (26.40%), Postives = 184/394 (46.70%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTG-CSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDID-GPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVS-DRDLKENGRVSCEL----KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSID 1764
            ++++ I D+N + PYF  +   V IPE+S +   +    A D D     R+  Y   DS++ F ID S+ +   + +   +D E +  ++  + A + ++   +T  QI + +DD NDN P+F+  SY  TI E  PVG   L+V AID D GP  N      +++ + +   + F++   +G+L + S+LD   + +V    I A D+     ++  +   + + + D+NDN PT + L+ +         + I EN P    +G  V+ D D  +N  +S  +       L  +E      G   + +   +DYE +   K  FE Q      L     + IH+ DVN+  P  ++   L +  +N      +  + A D D++A L Y ++
Sbjct:  668 VVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARI-VYSI-DSSQFFRIDPSSGD---ISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGP--NGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLD-REQFAVIVLPIFARDRGTPSLSAASE---ITLTLSDVNDNAPTFEQLSYD---------LYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAK-ANKFFFELQ-ASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQNATLEYFLE 1038          
BLAST of Protocadherin vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 138.658 bits (348), Expect = 1.418e-32
Identity = 151/570 (26.49%), Postives = 263/570 (46.14%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVK-SYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRVSCELKE-DLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQP 2295
            ++ I + D+NDN P F ++   V+I EN  + ++I    A D+DF    +V  S          TID S  E   + L++ ID  K +  T  ++A + +    S+   + I + D ND+ P         T+ E+  +G+E+ +V AID D       +Y +  +G+ + I     I  D+G LI  ++L      + +  +++A D       S+   T + + ++DINDN PT      NV          I E  P   ++I L   D D  E+ +++  ++E D +   + D+G     L S       ++  ++      D G   L+    + + I+DVN   P F ++ +   + E++P G PV+T++A D D+   A ++YSID    + F ID  +G IS S    DRE  +     V   D  + P   +  +++ + D+NDN P F  SS    + E++ + T    +++A D D    N  V Y          I+    +F++  T+G +     LDRE++    + + A D G+P+  A +  T+ + D+NDN P
Sbjct:    1 MVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGE---VTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM--EGSEDFI-----IDEDSG-LIKTTKLLDRETTARYSLKVTARDM---GTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVT---------ISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAIL-SVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS--QFFRIDPSSGDISVS-SDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFL-QVSAIDADIGP-NGIVDYFLNESSSSPSIQ----LFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAP 531          

HSP 2 Score: 125.176 bits (313), Expect = 2.009e-28
Identity = 156/581 (26.85%), Postives = 246/581 (42.34%), Query Frame = 1
Query:  925 IVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIG-LSVSDRDLKENG--RVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSI---DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDN----MFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            + I + D NDN P F+ +SY  TI+E+  +   I  V+A D D     K  Y + S      ++    I   TG + L+ ++D  N  S     I A D  +   +S    T   I+V DIND+ PT+      +  + M   I ++EN    + +G +   D D   NG  + S E  ED     + D   G   + +T   D E           +D G PSL    TI + ++D+N+  P F   EY  ++ E  P GS ++T++A D D+  ++ Y I   DR+V     I ++  ++S S     R+   ++  E++  D          +V + I DVN + P F        + E+  I   +   L A D D    N  + Y   +             F+I P++G+I     LDRE    +++ V A D  SP         + + D+NDN P+               F   + A  IS+        L++ AID D    G V Y+L  +  +    +F L+ T+G L  + S L   +    VL   ARD G P LS  + IT+ + D
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLT----IDYSTGEVTLRERIDAKN--SPITAVIRAKDGAQPALSSTVPLT---INVIDINDHAPTL------IAAQKM---ITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDF----IIDEDSGL--IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSG-ELKRQDHKVR-VEISATDQ--GGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVI-TLKAEDHD-RGDNARIVYSIDS----------SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQ---------------FTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTL-RVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSD 525          

HSP 3 Score: 120.553 bits (301), Expect = 5.262e-27
Identity = 146/581 (25.13%), Postives = 251/581 (43.20%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLF-LQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDIN-----DNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIY------SIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNF-VKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAY---DSGSPTRFAFANATIYVRDLNDNQP 2295
            ++I + DIND+ P     ++++++ EN  +   +    AID+D S  N +  Y  E S + F ID    ED  L    K +D E    Y+  + A +  T   +T   I + + D NDN P F K+ Y  TI E  P G +I+ ++A+D D  +  K  Y+I  + +R + S    I  D G+ IL    +L  +    + +ISA+D+       ++ R  V + ++D+N     ++ P                ++KI E+ P    +I L   D D  +N R+   + +  Q   +    G   D+  +   D E       +    DH  P L     IE+ ++D+N+  P F ++ Y  ++ E+ P G+  L V A D D     I       S     ++ F +D  +G +  S    DRE  ++    +  +D  T   +A   + + + DVNDN P F   S   ++ EN  + + + G + A  RD D+ +N  + +      D KL       F I     +   + +L R ++       K +    + S    +     I+V D+NDN+P
Sbjct:  106 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDED-SGPNGIIKYSMEGS-EDFIID----EDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRI-EEADREVFS-ILDIG-DQGA-ILSVSGELKRQDHKVRVEISATDQ-----GGLQGRCVVNVFIDDVNSAPYFNDHP---------------FSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-DSSQFFRIDPSSG---DISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVS-SKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTV-GTIVA--RDADEGDNADISFRIFGGADAKL-------FDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKP 639          

HSP 4 Score: 108.227 bits (269), Expect = 2.558e-23
Identity = 129/477 (27.04%), Postives = 212/477 (44.44%), Query Frame = 1
Query:  577 LGSYSKN-SFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTK-TFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRVSCELKE-----DLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI----DRKVLKHFSIDNKTGLIST-SFVPFDREMTSIK-QFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVF 1959
            +G+ S N S  I++ +KDINDN P F   +  V+I E     S I    A+D D   +++  +Y+ E++ +  F+I   ++ D    L  S + ++Q+       +  D  G   +C + + IDD N + P F+   +   I E  P+G  ++ ++A D D     +  Y I S       S++F+I P +G + + S LD  +R + F   ++ASD       +    T + + ++DINDN P            S      I E+ P     + +S  D D+  NG V   L E      +Q   L    G    L  +   D E+  +I      +D G PSL     I + + DVN+  P F+   Y   + EN+P GS V T+ A D D+   A++ + I    D K+        + G++   +   FD E  + K  FE+     +    ++ V V+I + DVNDN P  
Sbjct:  197 MGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND---EDQKITYRIEEADREVFSI--LDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS-------SQFFRIDPSSGDISVSSDLDREDR-ATFSVIVTASDHASPPLNT---STQIEVILDDINDNSPQFT---------SSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSG---TLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQL---SSTVPVRIHVSDVNDNKPAL 641          

HSP 5 Score: 94.7449 bits (234), Expect = 3.702e-19
Identity = 104/394 (26.40%), Postives = 184/394 (46.70%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTG-CSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDID-GPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVS-DRDLKENGRVSCEL----KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSID 1764
            ++++ I D+N + PYF  +   V IPE+S +   +    A D D     R+  Y   DS++ F ID S+ +   + +   +D E +  ++  + A + ++   +T  QI + +DD NDN P+F+  SY  TI E  PVG   L+V AID D GP  N      +++ + +   + F++   +G+L + S+LD   + +V    I A D+     ++  +   + + + D+NDN PT + L+ +         + I EN P    +G  V+ D D  +N  +S  +       L  +E      G   + +   +DYE +   K  FE Q      L     + IH+ DVN+  P  ++   L +  +N      +  + A D D++A L Y ++
Sbjct:  309 VVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARI-VYSI-DSSQFFRIDPSSGD---ISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGP--NGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLD-REQFAVIVLPIFARDRGTPSLSAASE---ITLTLSDVNDNAPTFEQLSYD---------LYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAK-ANKFFFELQ-ASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQNATLEYFLE 679          

HSP 6 Score: 63.929 bits (154), Expect = 9.945e-10
Identity = 69/241 (28.63%), Postives = 108/241 (44.81%), Query Frame = 1
Query: 1912 LVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELIT--LVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +V+I ++DVNDN PVF   S    + EN+ I   +   + ATD D    N  V Y   +               I  +TGE+     +D +  P  T  ++A D   P   +    TI V D+ND+ P  I       Q+ I+  + E  AI         + + ++ AID+D    G + Y ++ + D  F ++E +G + T  L+       Y LK TARD G P L+   +I V ++D
Sbjct:    1 MVEITVVDVNDNAPVFASDSYNVTILENITIPAVI-ATVKATDEDFG-TNGKVHYSMAS-------SSGIGGLTIDYSTGEVTLRERIDAKNSP-ITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAA-----QKMIT--LEENVAIG--------EEVGRVYAIDEDSGPNGIIKYSMEGSED--FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKD 214          
BLAST of Protocadherin vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 126.716 bits (317), Expect = 6.270e-29
Identity = 176/710 (24.79%), Postives = 317/710 (44.65%), Query Frame = 1
Query:  613 IEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACED--STGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVI-IHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLI-STSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVS-PLKLGTYV-LKFTARDNGVPPLSNDASITVHVQD--NGRFANINLTIIIGMIAITVSISVFLIVAI 2718
            + I DINDN P + +++  +S+         +    A D D      ++ Y   D T+  +ID    E  ++F+  +ID    +     ++A ED  S   ST  Q+V  + D     P+F K  ++  I E  P+G  ++KV A +       +  Y + ++        +  +   +G++ ++   D       F+ Q S    + +   + E  T++I I ++D+NDN P               LT++ +  +P + L+ +S SD D    G VS  +  +  S  +  V G   ++++  P    +  L+      +D G  S +    I I + D +   P F  ++Y     E+  PG  + +V A  + K +  IYS D+    +FSID  TG I  T ++  D   T +   +  +   ++N     V++ IE  D NDN P F  S ++  ++E++K+       + A+D+D  + N  V+Y  ++        H     +I   TG++ T  +LD E   N+ + VKA D G P R +     I+V D+NDN PE               F      + + + +    ++ K+ A D+D  + G++ Y + TNG   FG++E  G + T  S   ++ ++V +   A D GVPP S+ AS  + V D  +   + +++T I+      +S ++  IVA+
Sbjct:  429 LTIGDINDNAPQWHSSQIHISLNRTQGGSRTLT---AKDPDLGQNGWIR-YSVLD-TELVSIDK---ETGRIFVPNTIDCNIGSEIKFRVRA-EDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQ------DEHLTVDTMSGTVCIQKTFD-------FEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIF-------YPNEYHLTVR-EGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTG---EVFAQKPLARGRFHLV---VSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYS--IYSGDQD--HNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESN--QTQVVIFIE--DHNDNPPQFSSSLVEISIREDLKLHEPFY-VVQASDKD-KKKNGEVRYSIIS-------SHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPE---------------FEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRI-TNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAM 1069          

HSP 2 Score: 120.553 bits (301), Expect = 5.532e-27
Identity = 129/460 (28.04%), Postives = 210/460 (45.65%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQ--CQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVE-DRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCEL--KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFL 1962
            +ISI +KD+NDN P F  N+  +++ E       + +  A D D      V SY     + +F+I+    E   +F QK +   + +L      + +D  G S++    I I + D++   P+FS+  YE    E    G  I  V A+       +K +Y I S G+++     F I  DTG + +   LD     +V          +++   S E ++T V+I +ED NDN P     + ++VE S+   +K+ E         +  SD+D K+NG V   +       S+E+    G    L +    DYE     K   +  D G P      T+ IH+ DVN+  P F+ + Y   + EN+PP + V  V A D+D  ++ +++Y I     ++F ID K G + T     DRE+ S     +  +D    P+++    +I +LDVNDN P  L
Sbjct:  626 LISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEV-SYHILSESSSFSINPVTGE---VFAQKPLARGRFHLVV----SAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAM-------SKVKYSIYS-GDQD---HNFSIDEDTGKIYVTRYLDADVHDTVLL-------NIQATLPSGESNQTQVVIFIEDHNDNPPQ---FSSSLVEISIREDLKLHE-----PFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTG---QLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGS-EYFGIDEKLGNVYTKR-SIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCL 1046          

HSP 3 Score: 97.4413 bits (241), Expect = 5.835e-20
Identity = 125/517 (24.18%), Postives = 224/517 (43.33%), Query Frame = 1
Query:  796 IDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFT--SVEDRTNVIIHVEDINDNKPTI-KVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSL-ELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEY-PPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSI-DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDRE--KYPN--WTITVKAYDSGSPTRFAFANATIYVR--DLNDNQPEWIYP 2310
            ID++   D +  ++ +++ +++ L   +L+     +G     ++ +++++ NDN+P F   S  + + E+  VG  +  V A D+D        Y +VS  +    + +F I   TG++ L + LD         F++     L  K T  S +  TN+ I V DINDN PT  K L    V  + F         P Q    +   D D +  G ++  L +   S+  +    G  +      P   E+  +  T     D+G PS      + + I +      PGF+  E+   + EN+  G   L +     ++S E  Y I D +  K FSID    L      P DRE  +  +F+V + ++    +       + +LD NDN PVF   +    +++++    K+ G++ A+D+D  + N  V Y  ++  D  ++        + P TG I+     D +  ++PN  W I V+A D G P R A     + ++    + + P ++ P
Sbjct: 1870 IDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQQIGTRVDVRVNNLNDNVPSFPM-SKPRRVPENLRVGSYVATVGAKDVD--NLAPLRYFLVSDSSGQTPT-HFNIDQFTGTIHLTAPLD---------FEVLPEHTLTIKATDGSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATF--------SPGQPFAKIEAHDLDAR--GALTYSLGQGSSSIFRVAPESGALF--MKVLPPAGERYLVTVT---ATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIG---LQIGNLSGEESREFHYRIQDPEASKIFSIDKFGRLFVAG--PIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKI-GQIMASDQDSGE-NGRVSYRILSGNDLNIV-------TLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLP 2344          

HSP 4 Score: 85.1149 bits (209), Expect = 3.524e-16
Identity = 117/460 (25.43%), Postives = 206/460 (44.78%), Query Frame = 1
Query:  637 NKPYFRTNKQIVSIPENSDL-VSIIKIEGAIDKDFSAKNRVKSYKFED--STKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQA-CEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILK----SQLD-LSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKP--TIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQD-HGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELI--YSI-DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSS 1971
            +KP F   +    + ENS + + I  + G   ++F        Y+ +D  ++K F+ID       +LF+   ID E++  +   ++   E  T    QC+  + + DENDN+P F+  +Y  ++ +S   G++I ++ A D D  +  +  Y+I+S  + N+++    ++PDTGS+ L     +QLD   N  + ++  + A D       +V  +  V + +   + + P   + V   +V+E +   T+          L  +  S+R    N  +   LKE    L + DV  G   L  TH  D+E E +I       D +G+ ++     ++I +E V+E+ P F  + Y   +  +TP G  V  ++A D D     +  YSI DR+      I+  TG+I        R   +I+Q  V      T      V ++I   DV  + P  LL S
Sbjct: 2127 DKPGFEKAEFRFEVMENSKIGLQIGNLSGEESREFH-------YRIQDPEASKIFSIDKFG----RLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVT----LNPDTGSIQLNEWNDAQLDEFPN--ATWQILVEARDHGHPARAAV-GKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTV----------LQKIRASNRLGMRNDGLLYSLKEHQGKLGI-DVKTGELTL-KTH-LDWESEPIISMYLSVSDGNGRSAVVP---LKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQ--STVKIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSSPTKQSKTTVYLEIGPFDVQPSLPKLLLHS 2550          

HSP 5 Score: 84.3445 bits (207), Expect = 5.995e-16
Identity = 111/393 (28.24%), Postives = 174/393 (44.27%), Query Frame = 1
Query:  580 GSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVK-SYKFEDSTKTFTIDNSNLEDL-KLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVS-DRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSP----VLTVRATDRDK 1737
            G  S+NS  I I + D +   P F  +K  +   E  D++  I I G++     A ++VK S    D    F+ID    ED  K+++ + +D +  +     +QA   S G S Q Q+VI I+D NDN P+FS    E +I E   + +    V+A D D  K  +  Y I+S    + I    +I   TG L   S LD     + +K ++ A+D      +S      + IHV D+NDN P          E+S + T+++ EN P + ++G  V+ D+D  ENG++   +    +   + +  G  Y   +    D E    +      +D G P      +  I + DVN+ PP       L       P GSP    + T+ A D DK
Sbjct:  718 GQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTE--DILPGIAI-GSV----GAMSKVKYSIYSGDQDHNFSID----EDTGKIYVTRYLDADVHDTVLLNIQATLPS-GESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSI----EIDQFTGQLSTGSLLDYEATRN-YKLRVKATDLGIPPRSS---NMTLFIHVLDVNDNAPEF--------EKSWY-TMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVY---TKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPP-----SCLSITPIVVPAGSPLSTAIGTIVAMDPDK 1073          

HSP 6 Score: 70.4774 bits (171), Expect = 9.901e-12
Identity = 161/670 (24.03%), Postives = 284/670 (42.39%), Query Frame = 1
Query:  562 FEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDST-KTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIV-ESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGG--GFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSI-DRKVLKHFSIDNKTGLISTSF---VPFDREMTSIKQFEVNVKDDKTNPKTA--NVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPL 2535
             +VI  GS  +    + + + ++NDN P F  +K    +PEN  + S +   GA D D  A  R   +   DS+ +T T  N +     + L   +D+E    +T T++A + S    T   + I + D NDN P FSK  Y+ T+   +F  G+   K+EA D+D        Y +  +G+    S  F+++P++G+L +K       R   +   ++A+D     F+     T+V + V  I + +PT K       E++ F   ++ EN      IGL + +     +G  S E    +Q  E   +     F  L+   P D E+    +   E  +    S K      + + D N+  P F +  Y  SL+++   G  +  + A+D+D  ++  + Y I     L   +++  TG I  +       D    +  Q  V  +D     + A   V V +++   + + P F+L   +  V E+  + T L+ K+ A++R     N+ + Y   +L +H      +    I   TGE+     LD E  P  ++ +   D     R A     I V  +++  P +            S +  + P   IS  A +   + +++AID+D    G V Y + ++  +   + E TG +I L  PL
Sbjct: 1898 LKVIGTGSGQQIGTRVDVRVNNLNDNVPSFPMSKP-RRVPENLRVGSYVATVGAKDVDNLAPLRY--FLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGS--FDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSL-GQGS----SSIFRVAPESGALFMKVLPPAGER---YLVTVTATDNGVPSFS-----TSVPVSV-IIGEAEPTDK----PGFEKAEF-RFEVMENSK----IGLQIGNL----SGEESREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQ-KIRASNR-LGMRNDGLLY---SLKEH------QGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNG--RSAVVPLKIVVEPVDEFAPVFTK----------SSYTLQIP---ISTPAGES--VGQMQAIDEDGGVHGVVKYSI-SDRQSTVKIEEHTG-IIRLQKPL 2503          

HSP 7 Score: 63.1586 bits (152), Expect = 1.779e-9
Identity = 145/636 (22.80%), Postives = 244/636 (38.36%), Query Frame = 1
Query:  673 SIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPD------TGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKEN-EPAQKLIGLSVSDRDLKENGRVSCELKEDLQ------SLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGS----LRENTPPGSPVLTVRATD--RDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVK----IEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGK-LNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTG 2508
            ++PE++ + + I       ++ +A      +  E ++K   +D  + E   +     +DYEK++ +       E+S        I++++DDENDN P F+ +  +  I E   +G         D DGPKF+   + I+ +GN N +   FK++           L++  QLD   R   ++  I A D  K        +    I + D NDN P        V  RS + T  +  N      LI +  +D D+ EN R+S ++K+         ++    V      L     +D         +    DHG PSL     + I +       P       + S    L EN+  GS V  V      RD    LI S     L     D     +       DRE  S    +  ++ D        ++++    + I D+NDN P +   S Q  +  N   +T+   + L A D D  Q N +++Y  +   D +L+        I   TG I     +D          V+A D GSP   A +     V DL D +      +P  F++ +         + I +       ++K+ A +    ++ R+ Y LQ N D    ++  +G
Sbjct:   30 TVPESAQIGTRIGWISGKREESAAPKYFVVFPDEQTSKFLKVDERSGE---ISTIAHLDYEKRSKFDIVAVKVEES---GETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVIL-QGNVNNV---FKLASRKVNEQLQADLVVNGQLDREFR-DKYELLIEAQDGGKPAKIG---QLRCSIEIIDANDNAP--------VFSRSRY-TASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHD--------VIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGS---SALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKD------GQIIIEHPQLLTIGDINDNAPQW--HSSQIHISLN---RTQGGSRTLTAKDPDLGQ-NGWIRYSVL---DTELV-------SIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSP---ALSTDLQVVADLLDTE-----SKPPQFEKALW-------QVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQ-NQDEHLTVDTMSG 593          

HSP 8 Score: 57.3806 bits (137), Expect = 8.430e-8
Identity = 77/310 (24.84%), Postives = 144/310 (46.45%), Query Frame = 1
Query: 1729 RDKSAELIYSI---DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQI--RPTTGEIET-LVV---LDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTN---GDNMFGLNETTGELITLVSPLKLGTYVLKFTARDNGVPPLSNDASITVHV 2622
            R++SA   Y +   D +  K   +D ++G IST     D E  S  +F++     + + +T ++LV+++  D NDN P F    ++  + E  ++ T        TD D  +   F  + F+ L  +     +  VF++  R    +++  LVV   LDRE    + + ++A D G P +      +I + D NDN P  ++ R     R+ +       + NIS  +     ++ ++A D D  +  R+ Y ++      ++ F +++ +G + T  S L   T+ +   A D+G P LS+ A +T+ V
Sbjct:   48 REESAAPKYFVVFPDEQTSKFLKVDERSGEIST-IAHLDYEKRS--KFDIVAVKVEESGETIDILVEVD--DENDNAPSFADQVVKLEISEFAQLGTSF-ALPTVTDGDGPK---FDVHRFVILQGN-----VNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAP--VFSR----SRYTASV-----SANISIGSH----LITVQATDADIGENSRISYDIKKTSAPSNSNFAISQ-SGVITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITV 327          
BLAST of Protocadherin vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 121.324 bits (303), Expect = 3.575e-27
Identity = 162/642 (25.23%), Postives = 285/642 (44.39%), Query Frame = 1
Query:  850 YEKQNLYTGTLQACEDSTGCSTQCQI----VIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDI----DGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRI--SVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPA-QKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKP-SLKEYRTIEIHIEDVNEYPPGF-QNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYS-IDR-----KVLKHFSIDNKTGLISTSFVPFDREMTSIK---QFEVNVKDD--------KTNPKTANVLVKIEILDVNDNDPVF----LLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEI--ETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQ---TNGD------NMFGL-NETTGELITLVSPLKLGT--YVLKFTARDNGVP-PLSNDASITVHVQD 2628
            YE+ + Y  + QA + S   +T  Q+    +++I   ++  P+F+K+ YE T+ E   V   ++ V+A       DG       Y +      +  +++F+I P TG + L   LD  +     + K +++A +  +      E   ++ I ++D+NDN PT          R ++ T +++E+ P  Q ++ ++  D+D  +N R++  +  D  +  +   G     +        E+  + +     +DHG+P SL     I I  E+ N+    F   ++Y   + E+   G+PV+ ++A D D+  E+ YS +D+     + +  FSID  TGL+         ++   +      V V+DD        KT+   A +L+ IE  DVN+N P F      S +   ++   K       K+ ATD D     + V   + T  +       +  F I   TG +     VV DRE  P   +TVKA D G      F   ++ V D+NDN P++  P   +++  +S F     A+  S        ++ + A D D      + Y L+   T G+      + F L N  +GE ITL+ P+ + T  ++    A DNG+P  L + A +T++V D
Sbjct:  488 YERGDTYRISAQAMDLSPSDNTTSQLSEVAILEIL-ADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDE-TKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNR------ESHVDLTIRIDDVNDNVPTFT--------RPLY-TAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV--DNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRD-EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIE--DVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSES------RKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERP---SYETSVSRF----EAVGTS--------VITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGE-ITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLD 1085          

HSP 2 Score: 117.087 bits (292), Expect = 6.268e-26
Identity = 150/609 (24.63%), Postives = 254/609 (41.71%), Query Frame = 1
Query:  592 KNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVES-FPVGKEILKVEAIDID-GPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISV--FKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKEN-EP--AQKLIGLSVSDRDLK---------ENGRVSCELKEDLQSLELKDVGGGFYDLWST-HPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAE---LIYSIDRKVLKHFSIDNKTGLISTSFV-----PFDREMTSIK---QFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIR-PTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPE-WIYPRPINFQ 2328
            K++  + I I D+NDN P F   K I  + E+      +    A D D  +  R            F +     +   +F+++ +D+E  + Y   L A +     +T   + I I+D NDN P+F ++ Y  T++E    + K +  V A D D   K ++  Y++  +G   +    F+I   +G++ L   LD      V  + F + A D   +      D   V ++V DINDN P          ER   L   I+EN EP  +  +  + V  RD           E G V  +L        +    G  + + S       E+E +I+      D G PS + +  + I + D+N+  P F+   Y GS+ E  P G+ V++  A D D+ A+     Y +  +    +   +K    S+  V     P D E  + +      + V D + + + A   V + ++D ND+ P  +  + +  V+E+V   T + G+  ATDRD      F           ++ R   P  Q      G +     LDRE    + + ++AYD+ +          +Y++D+NDN PE +  PRP  F+
Sbjct: 1316 KDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGV---RTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTN--VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEV----FRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYAD---VQVNVRDINDNSPIFP-------ER---LFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEV--RANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAA---VHVALVDRNDHAP-HIHGATEHRVREDVPRGTSI-GRYTATDRDAGDTARF-----------RINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSN--NIGRQMVAVYLQDVNDNGPEPYTVPRPCIFR 1882          

HSP 3 Score: 115.931 bits (289), Expect = 1.243e-25
Identity = 176/736 (23.91%), Postives = 311/736 (42.26%), Query Frame = 1
Query:  610 SIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLF-----------LQKSIDYEKQNLYTGTLQACEDSTG----CSTQCQIVIQIDDENDNIPKFSKESYEK---TIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGN--RNLISRY-----FKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKP--TIKVLAGNVVERSMFLTIKIKENEPAQKLIG---LSVSDRDLKENG-------RVSCELK-EDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSL-------KEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKH--FSIDNKTGLISTSFV--PFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFV-QENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDRE---KYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDE--NDAGRVCYYL----QTNGDNMFGLNETTGELITLVSPLKLGT----YVLKFTARDNGVPPLSNDASITVHVQD 2628
            S+E+ DINDN P F       S+     + + +    A D D +A N   +Y  E  T   T    +  DL  F           L K I  + Q           D  G      +  Q+ + + D+    PK+      K   T+ E+  + K IL+  A+     + +   YK+ + G       S++     F+   +   +++   LD   +++ +   ++A+D + S+  S +     ++ V D+ND  P  T+ +  G + E       ++  NE  +K  G   ++V   D   +G       R+  E   E+ +   + ++ G   +++    +D EK D+     E  D    +L       K+   ++I I DVN+  P F+  +Y+G ++E+   G  V+T++A D DK + L Y +         F +   +G I   FV  P D E +      +   D + N  T NV + IE  DVNDN P F        V +E+V I  K+   ++ATD D D+ ++ + Y           +    VF+I   +G IE +  LDR+     P+W   V+A D        +A+  + VRD+NDN P  I+P        +  +I E    N   I       + ++A D D+   +   + Y +      NG+++F +++ TG++  + S  +  +    ++++  A D GVP     A++T+ V D
Sbjct:  966 SVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDND-AAHNAEITYSLEIDT---TAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKF---IFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYE-QVNNYTLTLTATD-MTSRVASTK---TFVVEVRDVNDVVPQFTVDLFTGTIDE-------EMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTG---EIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTI---FVKEPLDFEASDQYHLVLIASDGRHN-ATTNVYIHIE--DVNDNAPQFEQQKYATTVIEEDVDIP-KVLFNVHATDADQDEKSSRIVYRLEG-------QGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSP--IFP------ERLFGYIEE----NREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTD 1653          

HSP 4 Score: 102.064 bits (253), Expect = 2.363e-21
Identity = 157/607 (25.86%), Postives = 252/607 (41.52%), Query Frame = 1
Query:  772 EDSTKTFTIDNSNLEDLKLFLQKSIDYEKQ---NLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLD---LSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKE--------NGRVSCELK-----EDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSL------KEYRTIEIHIEDVNEYPPGFQNNEY---LGSLRENTPPGSP--VLTVRATDRDKSA--ELIYSI---DRKVLKHFSIDNKTGLISTS-FVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKY--EFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRF-AFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNG 2475
            ED TK F ID S      + L + +D++      L+   + A ED+    +   + I+IDD NDN+P F++  Y   + E  P+ + ILKV A+D D    ++  Y +    N N     F I+ + G +  K +LD   L+ R  V++F ++A D  +     V   ++ +IH+   N N  +   L       S +     ++ +    +I +   D D  E        NGR + ++      E    ++L+  G    DL        E E+ I      QD G   +        Y T+ I IEDVN   P F +      +  + E T    P  ++ V ATD D SA  +++YS+     +  K F ID +TG+++ S  V FDRE    +   V   D    P        +E++D+NDN P F   S +  V     + T +   + A D D    N  + Y  E  T    +    +     +   +GEI TL+     K   +   V A D+G P    + A  T+ V D     P+W            SP     P I + +  E +K+IL+ +A+   ++    V Y L  +G
Sbjct:  579 EDETKWFRIDPSTG---IIHLTRLLDFDDPALPKLHKLKVTAREDNR--ESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV---DNHN-----FSINSN-GEISAKVRLDADQLNERHFVYRFNVTARDHGE----PVSLSSSAMIHIRTENTNDESAVFLP-----TSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRH-GVSAADL-------AEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVI-TVFAFDNDAAH-NAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEI-TLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKW----------QTSPDC--KPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASG 1139          

HSP 5 Score: 65.0846 bits (157), Expect = 4.377e-10
Identity = 157/708 (22.18%), Postives = 280/708 (39.55%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPK---FSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLIS-RYFKISPDTGSLILK---SQLDLSNRISVFKFQISASDKLKSKFTSVEDRTN---VIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCEL---KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSID---------RKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNV-KDDKTNPKT--ANVLVKIEILDVNDNDPVFLLS---SLQFFVQENVKI-KTKLEGKLNATDRDCDQMNNFVKYEFMTLY--DHKLIRHMKPVFQIRPTTGEIETLVV--LDREKYPNWTITVKAYDSGSPTRFAFANA-TIYVRDLNDNQPEW---IYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL---QTNGDNM--FGLNETTGELI--TLVSPLKLGTYVLKFTARDNGVPPL 2592
            ++I I D+NDN P F        + E+  L   I    A+DKD    +R+ +Y  ++    F+I+++     K+ L      E+  +Y   + A +     S     +I I  EN N           Y   + E    G  +++++A D D    ++  Y  + K  R+      F I   TG + L+   S  DL+   +     +   D         +  T+   ++I +ED+N+NKP     A    + +  +    K + P   ++ +  +D D   NG +   L   + + +   + D   G         +D E         +  D G   L  +    + + D+N+  P F+   Y  S+      G+ V+TV A D D +  AE+ YS++         +  L  F + N+     T   P   +    ++F  NV  DD   P+   ++  V + +LD     P +  S        V ENV++ K  L  +  ++    D  N+ V Y+        +K     +   +       +E +++  LD E+  N+T+T+ A D  S  R A      + VRD+ND  P++   ++   I+ +   +  + +T            K I+ +KAID D +      +Y    + NG+    F ++E TGE+         K+  Y+L   A D  V  L
Sbjct:  628 LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRI-TYSVDN--HNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCA-KYSDIAKIMEGTYKTDPPT--IVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKT---QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSG---DSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTS--RVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKT----------NGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSAL 1308          
BLAST of Protocadherin vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 121.324 bits (303), Expect = 3.575e-27
Identity = 162/642 (25.23%), Postives = 285/642 (44.39%), Query Frame = 1
Query:  850 YEKQNLYTGTLQACEDSTGCSTQCQI----VIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDI----DGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRI--SVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPA-QKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKP-SLKEYRTIEIHIEDVNEYPPGF-QNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYS-IDR-----KVLKHFSIDNKTGLISTSFVPFDREMTSIK---QFEVNVKDD--------KTNPKTANVLVKIEILDVNDNDPVF----LLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEI--ETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQ---TNGD------NMFGL-NETTGELITLVSPLKLGT--YVLKFTARDNGVP-PLSNDASITVHVQD 2628
            YE+ + Y  + QA + S   +T  Q+    +++I   ++  P+F+K+ YE T+ E   V   ++ V+A       DG       Y +      +  +++F+I P TG + L   LD  +     + K +++A +  +      E   ++ I ++D+NDN PT          R ++ T +++E+ P  Q ++ ++  D+D  +N R++  +  D  +  +   G     +        E+  + +     +DHG+P SL     I I  E+ N+    F   ++Y   + E+   G+PV+ ++A D D+  E+ YS +D+     + +  FSID  TGL+         ++   +      V V+DD        KT+   A +L+ IE  DVN+N P F      S +   ++   K       K+ ATD D     + V   + T  +       +  F I   TG +     VV DRE  P   +TVKA D G      F   ++ V D+NDN P++  P   +++  +S F     A+  S        ++ + A D D      + Y L+   T G+      + F L N  +GE ITL+ P+ + T  ++    A DNG+P  L + A +T++V D
Sbjct:  488 YERGDTYRISAQAMDLSPSDNTTSQLSEVAILEIL-ADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDE-TKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNR------ESHVDLTIRIDDVNDNVPTFT--------RPLY-TAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV--DNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRD-EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIE--DVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSES------RKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERP---SYETSVSRF----EAVGTS--------VITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGE-ITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLD 1085          

HSP 2 Score: 117.087 bits (292), Expect = 6.268e-26
Identity = 150/609 (24.63%), Postives = 254/609 (41.71%), Query Frame = 1
Query:  592 KNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVES-FPVGKEILKVEAIDID-GPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISV--FKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKEN-EP--AQKLIGLSVSDRDLK---------ENGRVSCELKEDLQSLELKDVGGGFYDLWST-HPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAE---LIYSIDRKVLKHFSIDNKTGLISTSFV-----PFDREMTSIK---QFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIR-PTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPE-WIYPRPINFQ 2328
            K++  + I I D+NDN P F   K I  + E+      +    A D D  +  R            F +     +   +F+++ +D+E  + Y   L A +     +T   + I I+D NDN P+F ++ Y  T++E    + K +  V A D D   K ++  Y++  +G   +    F+I   +G++ L   LD      V  + F + A D   +      D   V ++V DINDN P          ER   L   I+EN EP  +  +  + V  RD           E G V  +L        +    G  + + S       E+E +I+      D G PS + +  + I + D+N+  P F+   Y GS+ E  P G+ V++  A D D+ A+     Y +  +    +   +K    S+  V     P D E  + +      + V D + + + A   V + ++D ND+ P  +  + +  V+E+V   T + G+  ATDRD      F           ++ R   P  Q      G +     LDRE    + + ++AYD+ +          +Y++D+NDN PE +  PRP  F+
Sbjct: 1316 KDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGV---RTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTN--VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEV----FRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYAD---VQVNVRDINDNSPIFP-------ER---LFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEV--RANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAA---VHVALVDRNDHAP-HIHGATEHRVREDVPRGTSI-GRYTATDRDAGDTARF-----------RINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSN--NIGRQMVAVYLQDVNDNGPEPYTVPRPCIFR 1882          

HSP 3 Score: 115.931 bits (289), Expect = 1.243e-25
Identity = 176/736 (23.91%), Postives = 311/736 (42.26%), Query Frame = 1
Query:  610 SIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLF-----------LQKSIDYEKQNLYTGTLQACEDSTG----CSTQCQIVIQIDDENDNIPKFSKESYEK---TIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGN--RNLISRY-----FKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKP--TIKVLAGNVVERSMFLTIKIKENEPAQKLIG---LSVSDRDLKENG-------RVSCELK-EDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSL-------KEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKH--FSIDNKTGLISTSFV--PFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFV-QENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDRE---KYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDE--NDAGRVCYYL----QTNGDNMFGLNETTGELITLVSPLKLGT----YVLKFTARDNGVPPLSNDASITVHVQD 2628
            S+E+ DINDN P F       S+     + + +    A D D +A N   +Y  E  T   T    +  DL  F           L K I  + Q           D  G      +  Q+ + + D+    PK+      K   T+ E+  + K IL+  A+     + +   YK+ + G       S++     F+   +   +++   LD   +++ +   ++A+D + S+  S +     ++ V D+ND  P  T+ +  G + E       ++  NE  +K  G   ++V   D   +G       R+  E   E+ +   + ++ G   +++    +D EK D+     E  D    +L       K+   ++I I DVN+  P F+  +Y+G ++E+   G  V+T++A D DK + L Y +         F +   +G I   FV  P D E +      +   D + N  T NV + IE  DVNDN P F        V +E+V I  K+   ++ATD D D+ ++ + Y           +    VF+I   +G IE +  LDR+     P+W   V+A D        +A+  + VRD+NDN P  I+P        +  +I E    N   I       + ++A D D+   +   + Y +      NG+++F +++ TG++  + S  +  +    ++++  A D GVP     A++T+ V D
Sbjct:  966 SVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDND-AAHNAEITYSLEIDT---TAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKF---IFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYE-QVNNYTLTLTATD-MTSRVASTK---TFVVEVRDVNDVVPQFTVDLFTGTIDE-------EMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTG---EIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTI---FVKEPLDFEASDQYHLVLIASDGRHN-ATTNVYIHIE--DVNDNAPQFEQQKYATTVIEEDVDIP-KVLFNVHATDADQDEKSSRIVYRLEG-------QGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSP--IFP------ERLFGYIEE----NREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTD 1653          

HSP 4 Score: 102.064 bits (253), Expect = 2.363e-21
Identity = 157/607 (25.86%), Postives = 252/607 (41.52%), Query Frame = 1
Query:  772 EDSTKTFTIDNSNLEDLKLFLQKSIDYEKQ---NLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLD---LSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKE--------NGRVSCELK-----EDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSL------KEYRTIEIHIEDVNEYPPGFQNNEY---LGSLRENTPPGSP--VLTVRATDRDKSA--ELIYSI---DRKVLKHFSIDNKTGLISTS-FVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKY--EFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRF-AFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNG 2475
            ED TK F ID S      + L + +D++      L+   + A ED+    +   + I+IDD NDN+P F++  Y   + E  P+ + ILKV A+D D    ++  Y +    N N     F I+ + G +  K +LD   L+ R  V++F ++A D  +     V   ++ +IH+   N N  +   L       S +     ++ +    +I +   D D  E        NGR + ++      E    ++L+  G    DL        E E+ I      QD G   +        Y T+ I IEDVN   P F +      +  + E T    P  ++ V ATD D SA  +++YS+     +  K F ID +TG+++ S  V FDRE    +   V   D    P        +E++D+NDN P F   S +  V     + T +   + A D D    N  + Y  E  T    +    +     +   +GEI TL+     K   +   V A D+G P    + A  T+ V D     P+W            SP     P I + +  E +K+IL+ +A+   ++    V Y L  +G
Sbjct:  579 EDETKWFRIDPSTG---IIHLTRLLDFDDPALPKLHKLKVTAREDNR--ESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV---DNHN-----FSINSN-GEISAKVRLDADQLNERHFVYRFNVTARDHGE----PVSLSSSAMIHIRTENTNDESAVFLP-----TSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRH-GVSAADL-------AEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVI-TVFAFDNDAAH-NAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEI-TLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKW----------QTSPDC--KPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASG 1139          

HSP 5 Score: 65.0846 bits (157), Expect = 4.377e-10
Identity = 157/708 (22.18%), Postives = 280/708 (39.55%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPK---FSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLIS-RYFKISPDTGSLILK---SQLDLSNRISVFKFQISASDKLKSKFTSVEDRTN---VIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCEL---KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSID---------RKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNV-KDDKTNPKT--ANVLVKIEILDVNDNDPVFLLS---SLQFFVQENVKI-KTKLEGKLNATDRDCDQMNNFVKYEFMTLY--DHKLIRHMKPVFQIRPTTGEIETLVV--LDREKYPNWTITVKAYDSGSPTRFAFANA-TIYVRDLNDNQPEW---IYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL---QTNGDNM--FGLNETTGELI--TLVSPLKLGTYVLKFTARDNGVPPL 2592
            ++I I D+NDN P F        + E+  L   I    A+DKD    +R+ +Y  ++    F+I+++     K+ L      E+  +Y   + A +     S     +I I  EN N           Y   + E    G  +++++A D D    ++  Y  + K  R+      F I   TG + L+   S  DL+   +     +   D         +  T+   ++I +ED+N+NKP     A    + +  +    K + P   ++ +  +D D   NG +   L   + + +   + D   G         +D E         +  D G   L  +    + + D+N+  P F+   Y  S+      G+ V+TV A D D +  AE+ YS++         +  L  F + N+     T   P   +    ++F  NV  DD   P+   ++  V + +LD     P +  S        V ENV++ K  L  +  ++    D  N+ V Y+        +K     +   +       +E +++  LD E+  N+T+T+ A D  S  R A      + VRD+ND  P++   ++   I+ +   +  + +T            K I+ +KAID D +      +Y    + NG+    F ++E TGE+         K+  Y+L   A D  V  L
Sbjct:  628 LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRI-TYSVDN--HNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCA-KYSDIAKIMEGTYKTDPPT--IVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKT---QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSG---DSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTS--RVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKT----------NGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSAL 1308          
BLAST of Protocadherin vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 232.646 bits (592), Expect = 2.864e-61
Identity = 199/680 (29.26%), Postives = 324/680 (47.65%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKT-FTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNL--------ISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQN-NEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSI--DRKVLKH--FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEF----MTLYDHKLIRHM-KPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYD---SGSPTRFAFANATIYVRDLNDNQPEWIYPR-PINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL----------QTNGDNMFGLNETTGELITLVSPL 2535
            ++IE++D+NDN P F  +   +S+PE+++L + +    A DKD  +  +V     ++S K  F ID        L L + +DYE    +T  + A +      ST   I++ + D NDN P F K+ Y   + ES  +  +I++V A D+D     +  Y+IV  G  N+        +S++F I P++G + L++ LD   R   ++  + A+D   +   +   +T VI+ V D NDN P          ++S +   +I+EN     ++G+ + SD DL EN  +   L     S ++  V G   ++ +  P D E  +L   + E +D G P       + IH+ DVN+  P   +  E + S+RE  PPG+ V+ VRA DRD  ++A + YSI   R    H  FSID  +G+I T  V  D E  SI +  V   D    P+    ++++E+LD+NDN P F  SSL F V+E+  +   + G ++  +R  D + N V+  F    +T   + L + + +  F I   +G +    +LDRE    + + ++A D   S +P   A     I V D+NDN PEW  P+ PI+ Q              +S+      +I    A D D    G + Y L          Q    ++F ++  TG L +L +PL
Sbjct:  917 VNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAID---ARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETR-DRYQLTVLATD---NGTPAAHAKTRVIVRVLDANDNDPKF--------QKSKY-EFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTG---EISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV-LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALG-HVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAI-TVKIEVADVNDNAPEW--PQDPIDLQ--------------VSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGAL-SLQAPL 1557          

HSP 2 Score: 178.333 bits (451), Expect = 1.597e-44
Identity = 192/708 (27.12%), Postives = 296/708 (41.81%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRTNKQIVSI---PENSDLVSIIKIEG--AIDKDFSAKNRVKSYKF--EDSTKTFTIDNSNLEDLKLFLQKS--IDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVF-KFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCEL-KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI-------------DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL----QTNGDNMFGLNETTGELITLV--SPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +I +++ D+NDN+P F   +  VS+   P+ S   S   I    A D D+    +V SY+    +    F ID S  E   +F+ +   +    Q ++   + A +     S    +V + I D     P F K  Y   + E  P G  +  V A   D    +   Y I S G+ +    YF I  ++G++ +   LD   +  V    Q +  +        V   T V I VED+NDN P          E SM      +  E    L      D+D   +G+V+  L KE  + L   D   G   + S H  DYE       +    D G PSL    TI + ++DVN+ PP F+ +EY  ++ E+    + ++ V A+D D    A + Y I                V +HF I   +G I     P DRE     Q  V   D+ T    A   V + +LD NDNDP F  S  +F ++EN++ +  + G + A+D D  + N  ++Y  + +            FQ+ P TGEI T   LDRE    + + V+A D G+P R A     I+V D+NDN PE   P     Q  +     E P             +++++A+D+D      + Y +     ++G  +F ++ T+G + T V     +   Y L   A D G PP      + V V D
Sbjct:  700 MIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQV-SYRIVAGNEAGIFRIDRSTGE---IFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYS-GDPD---GYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEP------PVYGHTQVNIEVEDVNDNAPEF--------EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHL-ILSQH-LDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLR-APLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLR-RGSVVGVVTASDLDLGE-NAAIRYSLLPI---------NSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP-----QEDVVSVREEQP---------PGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLD 1357          

HSP 3 Score: 175.637 bits (444), Expect = 1.127e-43
Identity = 195/676 (28.85%), Postives = 292/676 (43.20%), Query Frame = 1
Query:  613 IEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKF--EDSTKTFTIDNSNLEDLKLFLQKSI----DYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKEN-EPAQKLIGLSVSDRDLK-ENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKH---FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELITLVSPLKLGT-----YVLKFTARDNG 2580
            + +KD NDN P F      +  PEN+       +  A D D    N  + Y     +    F + +    D  L+L   I    D E    Y+  ++A +  T        V I I D NDN P F++  Y  T+ E+  VG  +L+V A D D  +    EY I  + +     + F+I P TG++ +   LD   +  + +  + A D  +      E    V I V D+NDN+PTI     NV+  S   + KI E+ +P + +  +SV D D K E   V+  L        L       Y +    P D E            D G P L   ++I + I DVN+ PP F+ + Y  ++ E   PG+ VL V A DRD+   + L YS+      H   F ID +TGLI+T     D E   + Q  V  +D    P ++   V + I DVNDN+P+F  S     V EN  +   +  K++A+D DC  +N  V Y     + H         F++R  +GEI     LD E+  ++   V A D G  +  A     + + D+NDN+P + YPR        SP          S  A     I+ + A D D  + G+V Y +   N   +F ++ +TGE I +V P  L       ++L  +A D G
Sbjct:  162 VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYN-TQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDK--EQMFRIDPRTGAIYINKALDFETK-ELHELVVVAKDHGEQPL---ETTAFVSIRVTDVNDNQPTI-----NVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTR-SHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCIL-KVSASDPDCG-VNAMVNYTIGEGFKHLT------EFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIK--MQLTDVNDNRPVF-YPREYKVSLRESP--------KASSQASSTP-IVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGE-IFVVRPDMLSVRTQPMHMLNISATDGG 803          

HSP 4 Score: 162.925 bits (411), Expect = 9.238e-40
Identity = 169/715 (23.64%), Postives = 320/715 (44.76%), Query Frame = 1
Query:  601 FIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLK-----------LFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHP----------YDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDR---------DKSAE---LIYSID----RKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKT--NPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDH--KLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYD-SGSPTRFAFANATIYVR--DLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQ-TNGDNMFGLNETTG--ELITLVSPL-----KLGTYVLKFTARDNGVP 2586
              I ++++D+NDN P F  ++  V++ E+  + + I    A D D     R+ +Y+  D+      ++ +  D+            ++L+  +D E ++ Y  T+ A ++ T     + ++++++ D NDN PKF K  YE  I E+   G  +  V A D+D  +     Y ++       I+  F++ P TG +  +  LD   R  ++   + A D+     ++   R  V IHV D+NDN P I     +VV      +++ +E  P  +++ +   DRD  +N  ++  +      ++ +D  G  + L+S  P           D+E+  + +      D G P  +  R + + + D+N+  P F ++  +  +RE+   G  V ++   +R         ++S E   + Y+++      +   F ID  +G +  + +  DRE+ S  + E+   D     NP+++ + VKIE+ DVNDN P +    +   V E   + T +     ATD D    N  ++Y  +  +    +       +F++   TG +     LD E    + + V+A D S + T     + T+ +R  D ND+ P ++ P     +         T ++ ISD     +++  + A+D+D  D G++ Y +   NG+  F +N  TG  EL+  + P      K G + L   A+D+G P
Sbjct: 1020 LTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARI-TYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP------INSSFQVHPVTGEISTREPLDRELR-ELYDLVVEARDQGTPVRSA---RVPVRIHVSDVNDNAPEIADPQEDVV------SVR-EEQPPGTEVVRVRAVDRDHGQNASITYSI------VKGRDSDG--HGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARL-LDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIH-NFTATDADTG-TNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGK---------TASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP 1696          

HSP 5 Score: 147.132 bits (370), Expect = 5.736e-35
Identity = 152/563 (27.00%), Postives = 252/563 (44.76%), Query Frame = 1
Query:  676 IPENSDLVSIIKIEGAIDKDFSAKNRVK-SYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDL--SNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPA-QKLIGLSVSDRDLKENGRVSCELKED-----LQSLELKDVGGGFYD------LWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFF-VQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYD---HKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEW 2301
            IP  + + S+I   G    D + ++ V+ S    D    F+I+ +N  ++++   K +D+E ++     +QA           Q+ I+++D NDN P+F       ++ ES  +G  +    A D D     +  Y +V +  + L    F I   +G LIL   LD   S R ++    ++A+D       S+     +++ V+D+NDN P        V E+  + ++ + E+     ++I ++ SD D   N R++  + +        S+   DV   F        ++   P D E  D  +      D+G P+      + + + D N+  P FQ ++Y   + EN   GS V  V A+D D  ++A + YS+   +   F +   TG IST   P DRE+  +    V  +D  T  ++A V V+I + DVNDN P           V+E     T++  ++ A DRD  Q N  + Y  +   D   H L       F I PT+G I T VVLD E+   + + V A D G+P R       + V DLNDN+P +
Sbjct:  840 IPRGTVVGSVIAASG----DVAHRSPVRYSIYSGDPDGYFSIE-TNSGNIRI--AKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL----FAIDARSGHLILSQHLDYESSQRHTLI---VTATD---GGVPSLSTNLTILVDVQDVNDNPP--------VFEKDEY-SVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSL-LPINSSFQVHPVTGEISTR-EPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVV-RVRAVDRDHGQ-NASITYSIVKGRDSDGHGL-------FSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTF 1365          

HSP 6 Score: 125.561 bits (314), Expect = 2.199e-28
Identity = 165/720 (22.92%), Postives = 302/720 (41.94%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDL------------KLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV---IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVS-----KGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPT-IKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELK-DVGGGFYDLWSTHP---YDYEKEDLIKTLFECQDHGKPSLKEYRTIEIH--IEDVNEYPPGFQNNEYLGSLRENTPPGSPVL--TVRATDRDKSAELIYSIDRKVLKH-FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKD----------------------DKTNPKTANVL-VKIEILDVNDNDPVFLLSSL-QFFVQENVK---IKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSP-TRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKL---GTYVLKFTARDNG 2580
            ++ +E+ D+NDN+P F ++  +  + E++ L  ++     I++            FED   T+T+ N   +DL             L + + +D E Q+ +   ++A + +   + Q   +   I++ D NDN P++ ++  +  + E+ PVG  I    A D D       +Y+++        ++      F++   TG+L L++ LD    +  +   + A D+  +    ++    V + + D ND+ P  +   +      S+F++   +  E    ++ +   D D  +NG+++ E+         + +   G  +L  + P    D EK      +   +DHG+P  K+  ++ +H  ++  +  PP F    Y  ++ EN P GS VL  T ++    ++A L Y I   V    F +D + G+I+T    FDRE  +     V V+D                      D +N +  +V  + I + DVNDN P F   S     V EN +   I T +     A+D D +  N  + Y            ++   F I  ++GE+     LDRE++  +T+ ++A D G P +R    N TI+V D NDN P +   +     +  +P                   ++++ A+D D     R+ Y L       F ++  +G LIT V  L      +Y     A D G
Sbjct: 1350 MLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTL-NPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDF-EAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAV---DEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKK-SSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRG-QFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVV-----ASDLD-EGPNADLIYSITG-------GNLGNKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPL---------------GTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSG-LITTVGKLDRELQASYNFMVLATDGG 2032          

HSP 7 Score: 120.939 bits (302), Expect = 5.090e-27
Identity = 147/530 (27.74%), Postives = 227/530 (42.83%), Query Frame = 1
Query: 1123 FKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQ-KLIGLSVSDRDLKE---------NGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRA--TDRDKSAELIYSIDRKVL---KHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDP----VFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVV---LDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD---NMFGLNETTGELITLVSPLKLGTY---VLKFTARDNGVPPLSNDASITVHVQD 2628
              I   TG +  K +LD   R S     I  S +             V++ V+D NDN PT         + SM   I+  EN P + K   L   D DL+          +G V+   +  L S   +D G  + DL  +   D E       L E  D G P L+ + T+ I I+DVN+  P F  + Y  ++ EN   G+ VL V A  TD D++  + Y+I+R+     + F ID +TG I  +    D E   + +  V  KD    P      V I + DVNDN P    +FL       + E+ +   +   +++  D D        K E+  +  +  +      F +      I  ++V   LDRE   N+T++V A D G+P   A  +  + + D+NDN PE        F++     +Y     N+ ++A+    +L++ A D+DE     + Y L    +     F ++  TG LIT  S +   T     L   ARD GVPPLS+ A++ V + D
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSLVAIPLSGR----------NIRVLVTVKDENDNAPTFP-------QTSMH--IEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFR--LSSHRERD-GVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKA-LDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQ-PGEFVARISVHDPDS-------KTEYANV--NVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPE--------FEQD----LYHA---NVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTG-LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHD 603          

HSP 8 Score: 120.939 bits (302), Expect = 5.221e-27
Identity = 192/749 (25.63%), Postives = 314/749 (41.92%), Query Frame = 1
Query:  559 KFEVIILGSYSKN-----SFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKF-----------EDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQ----IVIQIDDENDNIPKF--SKESYEKT----IVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSN----RISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDL--KENGRVSCEL----KEDLQSLELKD---VGGGFYDLWSTHPY-------DYEKEDLIKTLFECQDHGKPSLKE--------YRTIEIHIEDVNEYPPGFQNNEYLG-SLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKH-FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEIL--DVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVR----DLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNM---FGLNETTGELITLVSPLKLGTYVLKF--TARDNGVPPLSN 2598
            + E+  L + + N     +  + IE+ D+NDN P +  +   + + E + + +II    A D D +  N    Y+            E +   F +D+       L LQ  +D+E    Y   +QA + S+  + + Q    + ++I D ND+ P F     S  KT    I ++  +G+ +  + A+D D     +  Y+I            F+I+  TG + L   L  +     +   F   I A D  + +    +   N+ + V+  ++N P         V R+  L     EN P+   + L V+ + L   EN  +S E+      DL  ++ +       G +D  S   Y       D  ++  + +    +     S+ +          TI I + DVN+  P F+     G S+ EN+ PG  + TV A+D D+   A+LIYSI    L + FSID+ +G +S    P DRE  S    ++   D +  PK+      I I   D NDN P F LS     VQE+  + T +  +++A D D       V         + L    +  F I   +G I T+  LDRE   ++   V A D G   R+   +AT+ V+    D+NDN       RPI F+R+  P+I + PA     + +  + +LK++A+D D      + Y L      +   F +N +TG L    S       +L     ARD G PP S+
Sbjct: 1450 RLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDAD-TGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTG---ALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEG----RFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPE--PKKSSLNLHLIVQGSHNNPPRFL----QAVYRATIL-----ENVPSGSFV-LQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSAR--PLDREQHSRYTLQIQASD-RGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVV-QISAVDADLGVNARLV---------YSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGG---RYEVRSATVPVQINVLDINDN-------RPI-FERY--PYIGQVPA-----LIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSS 2146          

HSP 9 Score: 108.997 bits (271), Expect = 2.589e-23
Identity = 106/409 (25.92%), Postives = 177/409 (43.28%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQI-VSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQ--CQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELK-DVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPP--GFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLIS 1815
            I I + D+NDN P FR      +S+PENS+   I  +  +   +    + + S    +    F+ID+S+ E       + +D E+ + YT  +QA +     S Q  C I I ++D+NDN P+F    Y  ++ E  P+G  ++++ A+D D     +  Y +      N     F I   +G +    +LD   + S + F + A+D  + +  S      V I+V DINDN+P        + ER  ++       +P Q L+ +   D DL  N  +   L  +  ++  K  +      L ++     E   L+      +D G P       IE+ I +  +  P   FQN  Y   L+EN+P G+ +L V A   D   +       KV   F   N+ G++S
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGE----LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLA-----NETQWQFAIDGQSGLITTVGKLDRELQAS-YNFMVLATDGGRYEVRSAT--VPVQINVLDINDNRP--------IFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQ-------KVQFSFGAGNEDGILS 2214          

HSP 10 Score: 106.686 bits (265), Expect = 1.050e-22
Identity = 156/596 (26.17%), Postives = 242/596 (40.60%), Query Frame = 1
Query:  922 QIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLD-LSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSV-----SDRDLKENGRVSCEL---KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPG----FQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLK----HFSIDNKTGLISTSFV--PFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKH---KLILKLKAIDQDENDAGRVCYYLQTNGDNM--FGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            ++++ + DENDN P F + S      E+ P   +   + A D+D   +N   Y IVS GN N   R        G L L  Q+    +R +   + +   + L      +     V I ++D+NDN+P          +   F T+      P    +G SV     SD D  ENG V   +   + D + +   D   G   ++     D+E ++L + +   +DHG+  L+    + I + DVN+  P     F +++    + E+  PG  V  +   D D   E  Y+     L     HF++  +   I    V  P DRE+ S     V   D  T P  A+  + + I DVNDN P F        V E     T +   L A DRD + +N+ + Y      +     H +  FQI P TG I T   +D E  P   +TV A D G P   + A   + + D+NDN+P                 I++    N+S +AE     + ILK+ A D D      V Y +     ++  F +   +GE I +   L   +  +Y     A D G   LS  A I + + D
Sbjct:  159 RVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVS-GNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLI-EALDGGTPPLRGFMTVNITIQDVNDNQPIFN-------QSRYFATV------PENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGA--IYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTE--YANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVL-AHDRD-EGLNSALTYSLAETPE----THAQ-WFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEP-----------------IFDQSFYNVS-VAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGE-ICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTD 707          

HSP 11 Score: 83.1889 bits (204), Expect = 1.764e-15
Identity = 122/546 (22.34%), Postives = 225/546 (41.21%), Query Frame = 1
Query:  559 KFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQ------IVSIPENSDLVSI---IKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSN------LEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKL---KSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIG-LSVSDRDLKENGRVSCELKEDLQS-----LELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI-----DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKI-KTKLEGKLNATDRDCDQMNNFVKYEFMTLYDH 2100
            + +VI   +  +   ++++ + D NDN P F   +       + +I E S+ +S+   +    A D D    N    Y  E + + F++  SN      +  L+  +  S DY     +   +          +   + +Q +D      +F +  Y   I E+ P+G  +L++    +D       +   +  GN        +    + +++L   LD   R  ++K ++  S           +     +VII + D NDN P        + +RS     +I E  P +  I  L   D D +EN   + E+  D+ S     +   D+  G   + +   YD   +     +  C  H +  L   +   + + D N+  P F   EY+  L EN P GS V    A+D DK    +L YSI     D    K F +D+++GL++++FV FD E    +++++ +       K A+V V++EI   ++  P F   + +F +   V + +  + G++ ATD D    +  V Y+    + H
Sbjct: 2502 ELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDY-----FVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALD-------QSLAIIAGNEESAFELLQ----SKAIVLVKPLD-RERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP--------IFDRSAKYEAEISELAPLRYSIAQLQAIDAD-QEN-TPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFV-FDYEQR--QRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGP-DGRVVYQLSAPHSH 3016          

HSP 12 Score: 80.8777 bits (198), Expect = 7.513e-15
Identity = 90/376 (23.94%), Postives = 161/376 (42.82%), Query Frame = 1
Query: 1546 IKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI-DRKVLKHFSIDNK-TGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKL---ILKLKAIDQD-ENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLK-----LGTYVLKFTARDNGVPPLSNDASITVHVQDNG 2634
            I+ +   +    P L  Y  + I +ED N+  P F   +++ ++ E    G+ V  V A D D    A L Y I D      F I+   +G++ T+ V  DRE+  I + ++   D+     T    ++++I+DVNDN P F  ++L       V +    E     T    + ++ +    +    +  +      +F +   +G++     LD E    + + V A D+    R      T+ V D NDN P ++  +P         +    PAI  S+I+E   +   +L + A D D E +  +V Y ++   +  F ++ + G +   +S L+      G Y ++  A+D G P L +   + V   DNG
Sbjct: 2288 IRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIV-LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-------VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVL---TVRVNDENDNAPVFLAQQP-------PAYFAILPAI--SEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG-FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNG 2642          

HSP 13 Score: 73.9442 bits (180), Expect = 1.038e-12
Identity = 138/606 (22.77%), Postives = 250/606 (41.25%), Query Frame = 1
Query:  577 LGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTK--TFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDS----TGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLIS-RYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQ-KLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGF--YDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNP------KTANVLVKIEILDVNDNDPVFLLSS-LQFFVQENVKIKTKLEGKLNATDRDCDQM-NNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKY----PNWTITVKAYDSGSPTRF-AFANATIYVRDLNDNQPEWIYPRPINF 2325
            L SY++    + IE++D NDN P F   + + ++ E ++  + +    A D D  +  R++ Y   D      F I+ +    ++  +   +D E +++Y   + A ++     TG +T   I +QI D NDN P F   +   T+ E+  +G  I  + A D+D   +    Y++ ++   ++ +   F +   +G L+LK +LD   +   ++  + ASD         E RT + + V D NDN P             +    +I E+      L+ ++ +D D + N      + E  Q         G    ++    P      D    +   +D GKP+LK    + +   D       F  N+Y   + E  P GS VL +     D+S  +I   +      F +     ++     P DRE   + +  + +      P       ++ + V I ILD NDN P+F  S+  +  + E   ++  +  +L A D D +   N+ V Y+  +  D     HM   F I   TG    L V +R  Y     ++ + ++A DS       +     + + D NDN+P++     ++F
Sbjct: 2302 LASYAE----LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLR-YHIVDGNHDNAFVIEPAFSGIVRTNI--VLDREIRDIYKLKIIATDEGVPQMTGTAT---IRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQ-QEYELDVIASDAAH------EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRII-AKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESA---FELLQSKAIVLVK--PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSI-AQLQAIDADQENTPNSEVVYDITSGNDE----HM---FTIDLVTG---VLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHF 2870          

HSP 14 Score: 71.2478 bits (173), Expect = 7.709e-12
Identity = 128/568 (22.54%), Postives = 240/568 (42.25%), Query Frame = 1
Query:  895 DSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRI-SVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDL--KENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTI-EIHIEDVNEYPPGFQNNE---------YLGSLRENTPPGSPVLTVRATDRDK---SAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNV--KDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKT-KLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTIT-VKAYDSGSPTRFAFANAT-----IYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDA--GRVCYYLQT-NGDNMFGLNETTGEL 2514
            D+   ++  ++VI+++DENDN PKFS++ +  T+ E    G  + +V A D D     +  Y IV   + N     F I P   S I+++ + L   I  ++K +I A+D+   + T       + + + D+NDN+PT      N+V  S       +  E    +  +S +D D       R+  E   D++++ +  +      L      DYE    ++  +E       +  E RT+  + + D N+  P F   +          +  + E+      +LTV ATD D    ++++IY I+    + FS+    G++S +       ++S   + V +  KD       ++ L++++  D       FL +  +  + E   + +  L+   +A D+    +    +  F  L   K I  +KP                LDRE+   + +  V ++  G P   +  +++     I + D NDN P  I+ R   ++              IS++A     I +L+AID D+ +     V Y + + N ++MF ++  TG L
Sbjct: 2298 DAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNA----FVIEP-AFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGT---ATIRVQIVDVNDNQPTFP--PNNLVTVS-------EATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYE----LQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIE-PAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAF-ELLQSKAIVLVKP----------------LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP--IFDRSAKYE------------AEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVL 2812          
BLAST of Protocadherin vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 232.646 bits (592), Expect = 2.864e-61
Identity = 199/680 (29.26%), Postives = 324/680 (47.65%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKT-FTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNL--------ISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQN-NEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSI--DRKVLKH--FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEF----MTLYDHKLIRHM-KPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYD---SGSPTRFAFANATIYVRDLNDNQPEWIYPR-PINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL----------QTNGDNMFGLNETTGELITLVSPL 2535
            ++IE++D+NDN P F  +   +S+PE+++L + +    A DKD  +  +V     ++S K  F ID        L L + +DYE    +T  + A +      ST   I++ + D NDN P F K+ Y   + ES  +  +I++V A D+D     +  Y+IV  G  N+        +S++F I P++G + L++ LD   R   ++  + A+D   +   +   +T VI+ V D NDN P          ++S +   +I+EN     ++G+ + SD DL EN  +   L     S ++  V G   ++ +  P D E  +L   + E +D G P       + IH+ DVN+  P   +  E + S+RE  PPG+ V+ VRA DRD  ++A + YSI   R    H  FSID  +G+I T  V  D E  SI +  V   D    P+    ++++E+LD+NDN P F  SSL F V+E+  +   + G ++  +R  D + N V+  F    +T   + L + + +  F I   +G +    +LDRE    + + ++A D   S +P   A     I V D+NDN PEW  P+ PI+ Q              +S+      +I    A D D    G + Y L          Q    ++F ++  TG L +L +PL
Sbjct:  917 VNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAID---ARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETR-DRYQLTVLATD---NGTPAAHAKTRVIVRVLDANDNDPKF--------QKSKY-EFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTG---EISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV-LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALG-HVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAI-TVKIEVADVNDNAPEW--PQDPIDLQ--------------VSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGAL-SLQAPL 1557          

HSP 2 Score: 178.333 bits (451), Expect = 1.597e-44
Identity = 192/708 (27.12%), Postives = 296/708 (41.81%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRTNKQIVSI---PENSDLVSIIKIEG--AIDKDFSAKNRVKSYKF--EDSTKTFTIDNSNLEDLKLFLQKS--IDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVF-KFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCEL-KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI-------------DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL----QTNGDNMFGLNETTGELITLV--SPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +I +++ D+NDN+P F   +  VS+   P+ S   S   I    A D D+    +V SY+    +    F ID S  E   +F+ +   +    Q ++   + A +     S    +V + I D     P F K  Y   + E  P G  +  V A   D    +   Y I S G+ +    YF I  ++G++ +   LD   +  V    Q +  +        V   T V I VED+NDN P          E SM      +  E    L      D+D   +G+V+  L KE  + L   D   G   + S H  DYE       +    D G PSL    TI + ++DVN+ PP F+ +EY  ++ E+    + ++ V A+D D    A + Y I                V +HF I   +G I     P DRE     Q  V   D+ T    A   V + +LD NDNDP F  S  +F ++EN++ +  + G + A+D D  + N  ++Y  + +            FQ+ P TGEI T   LDRE    + + V+A D G+P R A     I+V D+NDN PE   P     Q  +     E P             +++++A+D+D      + Y +     ++G  +F ++ T+G + T V     +   Y L   A D G PP      + V V D
Sbjct:  700 MIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQV-SYRIVAGNEAGIFRIDRSTGE---IFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYS-GDPD---GYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEP------PVYGHTQVNIEVEDVNDNAPEF--------EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHL-ILSQH-LDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLR-APLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLR-RGSVVGVVTASDLDLGE-NAAIRYSLLPI---------NSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP-----QEDVVSVREEQP---------PGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLD 1357          

HSP 3 Score: 175.637 bits (444), Expect = 1.127e-43
Identity = 195/676 (28.85%), Postives = 292/676 (43.20%), Query Frame = 1
Query:  613 IEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKF--EDSTKTFTIDNSNLEDLKLFLQKSI----DYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKEN-EPAQKLIGLSVSDRDLK-ENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKH---FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELITLVSPLKLGT-----YVLKFTARDNG 2580
            + +KD NDN P F      +  PEN+       +  A D D    N  + Y     +    F + +    D  L+L   I    D E    Y+  ++A +  T        V I I D NDN P F++  Y  T+ E+  VG  +L+V A D D  +    EY I  + +     + F+I P TG++ +   LD   +  + +  + A D  +      E    V I V D+NDN+PTI     NV+  S   + KI E+ +P + +  +SV D D K E   V+  L        L       Y +    P D E            D G P L   ++I + I DVN+ PP F+ + Y  ++ E   PG+ VL V A DRD+   + L YS+      H   F ID +TGLI+T     D E   + Q  V  +D    P ++   V + I DVNDN+P+F  S     V EN  +   +  K++A+D DC  +N  V Y     + H         F++R  +GEI     LD E+  ++   V A D G  +  A     + + D+NDN+P + YPR        SP          S  A     I+ + A D D  + G+V Y +   N   +F ++ +TGE I +V P  L       ++L  +A D G
Sbjct:  162 VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYN-TQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDK--EQMFRIDPRTGAIYINKALDFETK-ELHELVVVAKDHGEQPL---ETTAFVSIRVTDVNDNQPTI-----NVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTR-SHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCIL-KVSASDPDCG-VNAMVNYTIGEGFKHLT------EFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIK--MQLTDVNDNRPVF-YPREYKVSLRESP--------KASSQASSTP-IVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGE-IFVVRPDMLSVRTQPMHMLNISATDGG 803          

HSP 4 Score: 162.925 bits (411), Expect = 9.238e-40
Identity = 169/715 (23.64%), Postives = 320/715 (44.76%), Query Frame = 1
Query:  601 FIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLK-----------LFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHP----------YDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDR---------DKSAE---LIYSID----RKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKT--NPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDH--KLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYD-SGSPTRFAFANATIYVR--DLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQ-TNGDNMFGLNETTG--ELITLVSPL-----KLGTYVLKFTARDNGVP 2586
              I ++++D+NDN P F  ++  V++ E+  + + I    A D D     R+ +Y+  D+      ++ +  D+            ++L+  +D E ++ Y  T+ A ++ T     + ++++++ D NDN PKF K  YE  I E+   G  +  V A D+D  +     Y ++       I+  F++ P TG +  +  LD   R  ++   + A D+     ++   R  V IHV D+NDN P I     +VV      +++ +E  P  +++ +   DRD  +N  ++  +      ++ +D  G  + L+S  P           D+E+  + +      D G P  +  R + + + D+N+  P F ++  +  +RE+   G  V ++   +R         ++S E   + Y+++      +   F ID  +G +  + +  DRE+ S  + E+   D     NP+++ + VKIE+ DVNDN P +    +   V E   + T +     ATD D    N  ++Y  +  +    +       +F++   TG +     LD E    + + V+A D S + T     + T+ +R  D ND+ P ++ P     +         T ++ ISD     +++  + A+D+D  D G++ Y +   NG+  F +N  TG  EL+  + P      K G + L   A+D+G P
Sbjct: 1020 LTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARI-TYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP------INSSFQVHPVTGEISTREPLDRELR-ELYDLVVEARDQGTPVRSA---RVPVRIHVSDVNDNAPEIADPQEDVV------SVR-EEQPPGTEVVRVRAVDRDHGQNASITYSI------VKGRDSDG--HGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARL-LDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIH-NFTATDADTG-TNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGK---------TASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP 1696          

HSP 5 Score: 147.132 bits (370), Expect = 5.736e-35
Identity = 152/563 (27.00%), Postives = 252/563 (44.76%), Query Frame = 1
Query:  676 IPENSDLVSIIKIEGAIDKDFSAKNRVK-SYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDL--SNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPA-QKLIGLSVSDRDLKENGRVSCELKED-----LQSLELKDVGGGFYD------LWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFF-VQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYD---HKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEW 2301
            IP  + + S+I   G    D + ++ V+ S    D    F+I+ +N  ++++   K +D+E ++     +QA           Q+ I+++D NDN P+F       ++ ES  +G  +    A D D     +  Y +V +  + L    F I   +G LIL   LD   S R ++    ++A+D       S+     +++ V+D+NDN P        V E+  + ++ + E+     ++I ++ SD D   N R++  + +        S+   DV   F        ++   P D E  D  +      D+G P+      + + + D N+  P FQ ++Y   + EN   GS V  V A+D D  ++A + YS+   +   F +   TG IST   P DRE+  +    V  +D  T  ++A V V+I + DVNDN P           V+E     T++  ++ A DRD  Q N  + Y  +   D   H L       F I PT+G I T VVLD E+   + + V A D G+P R       + V DLNDN+P +
Sbjct:  840 IPRGTVVGSVIAASG----DVAHRSPVRYSIYSGDPDGYFSIE-TNSGNIRI--AKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL----FAIDARSGHLILSQHLDYESSQRHTLI---VTATD---GGVPSLSTNLTILVDVQDVNDNPP--------VFEKDEY-SVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSL-LPINSSFQVHPVTGEISTR-EPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVV-RVRAVDRDHGQ-NASITYSIVKGRDSDGHGL-------FSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTF 1365          

HSP 6 Score: 125.561 bits (314), Expect = 2.199e-28
Identity = 165/720 (22.92%), Postives = 302/720 (41.94%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDL------------KLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV---IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVS-----KGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPT-IKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELK-DVGGGFYDLWSTHP---YDYEKEDLIKTLFECQDHGKPSLKEYRTIEIH--IEDVNEYPPGFQNNEYLGSLRENTPPGSPVL--TVRATDRDKSAELIYSIDRKVLKH-FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKD----------------------DKTNPKTANVL-VKIEILDVNDNDPVFLLSSL-QFFVQENVK---IKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSP-TRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKL---GTYVLKFTARDNG 2580
            ++ +E+ D+NDN+P F ++  +  + E++ L  ++     I++            FED   T+T+ N   +DL             L + + +D E Q+ +   ++A + +   + Q   +   I++ D NDN P++ ++  +  + E+ PVG  I    A D D       +Y+++        ++      F++   TG+L L++ LD    +  +   + A D+  +    ++    V + + D ND+ P  +   +      S+F++   +  E    ++ +   D D  +NG+++ E+         + +   G  +L  + P    D EK      +   +DHG+P  K+  ++ +H  ++  +  PP F    Y  ++ EN P GS VL  T ++    ++A L Y I   V    F +D + G+I+T    FDRE  +     V V+D                      D +N +  +V  + I + DVNDN P F   S     V EN +   I T +     A+D D +  N  + Y            ++   F I  ++GE+     LDRE++  +T+ ++A D G P +R    N TI+V D NDN P +   +     +  +P                   ++++ A+D D     R+ Y L       F ++  +G LIT V  L      +Y     A D G
Sbjct: 1350 MLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTL-NPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDF-EAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAV---DEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKK-SSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRG-QFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVV-----ASDLD-EGPNADLIYSITG-------GNLGNKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPL---------------GTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSG-LITTVGKLDRELQASYNFMVLATDGG 2032          

HSP 7 Score: 120.939 bits (302), Expect = 5.090e-27
Identity = 147/530 (27.74%), Postives = 227/530 (42.83%), Query Frame = 1
Query: 1123 FKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQ-KLIGLSVSDRDLKE---------NGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRA--TDRDKSAELIYSIDRKVL---KHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDP----VFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVV---LDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD---NMFGLNETTGELITLVSPLKLGTY---VLKFTARDNGVPPLSNDASITVHVQD 2628
              I   TG +  K +LD   R S     I  S +             V++ V+D NDN PT         + SM   I+  EN P + K   L   D DL+          +G V+   +  L S   +D G  + DL  +   D E       L E  D G P L+ + T+ I I+DVN+  P F  + Y  ++ EN   G+ VL V A  TD D++  + Y+I+R+     + F ID +TG I  +    D E   + +  V  KD    P      V I + DVNDN P    +FL       + E+ +   +   +++  D D        K E+  +  +  +      F +      I  ++V   LDRE   N+T++V A D G+P   A  +  + + D+NDN PE        F++     +Y     N+ ++A+    +L++ A D+DE     + Y L    +     F ++  TG LIT  S +   T     L   ARD GVPPLS+ A++ V + D
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSLVAIPLSGR----------NIRVLVTVKDENDNAPTFP-------QTSMH--IEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFR--LSSHRERD-GVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKA-LDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQ-PGEFVARISVHDPDS-------KTEYANV--NVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPE--------FEQD----LYHA---NVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTG-LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHD 603          

HSP 8 Score: 120.939 bits (302), Expect = 5.221e-27
Identity = 192/749 (25.63%), Postives = 314/749 (41.92%), Query Frame = 1
Query:  559 KFEVIILGSYSKN-----SFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKF-----------EDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQ----IVIQIDDENDNIPKF--SKESYEKT----IVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSN----RISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDL--KENGRVSCEL----KEDLQSLELKD---VGGGFYDLWSTHPY-------DYEKEDLIKTLFECQDHGKPSLKE--------YRTIEIHIEDVNEYPPGFQNNEYLG-SLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKH-FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEIL--DVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVR----DLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNM---FGLNETTGELITLVSPLKLGTYVLKF--TARDNGVPPLSN 2598
            + E+  L + + N     +  + IE+ D+NDN P +  +   + + E + + +II    A D D +  N    Y+            E +   F +D+       L LQ  +D+E    Y   +QA + S+  + + Q    + ++I D ND+ P F     S  KT    I ++  +G+ +  + A+D D     +  Y+I            F+I+  TG + L   L  +     +   F   I A D  + +    +   N+ + V+  ++N P         V R+  L     EN P+   + L V+ + L   EN  +S E+      DL  ++ +       G +D  S   Y       D  ++  + +    +     S+ +          TI I + DVN+  P F+     G S+ EN+ PG  + TV A+D D+   A+LIYSI    L + FSID+ +G +S    P DRE  S    ++   D +  PK+      I I   D NDN P F LS     VQE+  + T +  +++A D D       V         + L    +  F I   +G I T+  LDRE   ++   V A D G   R+   +AT+ V+    D+NDN       RPI F+R+  P+I + PA     + +  + +LK++A+D D      + Y L      +   F +N +TG L    S       +L     ARD G PP S+
Sbjct: 1450 RLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDAD-TGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTG---ALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEG----RFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPE--PKKSSLNLHLIVQGSHNNPPRFL----QAVYRATIL-----ENVPSGSFV-LQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSAR--PLDREQHSRYTLQIQASD-RGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVV-QISAVDADLGVNARLV---------YSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGG---RYEVRSATVPVQINVLDINDN-------RPI-FERY--PYIGQVPA-----LIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSS 2146          

HSP 9 Score: 108.997 bits (271), Expect = 2.589e-23
Identity = 106/409 (25.92%), Postives = 177/409 (43.28%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQI-VSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQ--CQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELK-DVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPP--GFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLIS 1815
            I I + D+NDN P FR      +S+PENS+   I  +  +   +    + + S    +    F+ID+S+ E       + +D E+ + YT  +QA +     S Q  C I I ++D+NDN P+F    Y  ++ E  P+G  ++++ A+D D     +  Y +      N     F I   +G +    +LD   + S + F + A+D  + +  S      V I+V DINDN+P        + ER  ++       +P Q L+ +   D DL  N  +   L  +  ++  K  +      L ++     E   L+      +D G P       IE+ I +  +  P   FQN  Y   L+EN+P G+ +L V A   D   +       KV   F   N+ G++S
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGE----LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLA-----NETQWQFAIDGQSGLITTVGKLDRELQAS-YNFMVLATDGGRYEVRSAT--VPVQINVLDINDNRP--------IFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQ-------KVQFSFGAGNEDGILS 2214          

HSP 10 Score: 106.686 bits (265), Expect = 1.050e-22
Identity = 156/596 (26.17%), Postives = 242/596 (40.60%), Query Frame = 1
Query:  922 QIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLD-LSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSV-----SDRDLKENGRVSCEL---KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPG----FQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLK----HFSIDNKTGLISTSFV--PFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKH---KLILKLKAIDQDENDAGRVCYYLQTNGDNM--FGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            ++++ + DENDN P F + S      E+ P   +   + A D+D   +N   Y IVS GN N   R        G L L  Q+    +R +   + +   + L      +     V I ++D+NDN+P          +   F T+      P    +G SV     SD D  ENG V   +   + D + +   D   G   ++     D+E ++L + +   +DHG+  L+    + I + DVN+  P     F +++    + E+  PG  V  +   D D   E  Y+     L     HF++  +   I    V  P DRE+ S     V   D  T P  A+  + + I DVNDN P F        V E     T +   L A DRD + +N+ + Y      +     H +  FQI P TG I T   +D E  P   +TV A D G P   + A   + + D+NDN+P                 I++    N+S +AE     + ILK+ A D D      V Y +     ++  F +   +GE I +   L   +  +Y     A D G   LS  A I + + D
Sbjct:  159 RVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVS-GNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLI-EALDGGTPPLRGFMTVNITIQDVNDNQPIFN-------QSRYFATV------PENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGA--IYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTE--YANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVL-AHDRD-EGLNSALTYSLAETPE----THAQ-WFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEP-----------------IFDQSFYNVS-VAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGE-ICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTD 707          

HSP 11 Score: 83.1889 bits (204), Expect = 1.764e-15
Identity = 122/546 (22.34%), Postives = 225/546 (41.21%), Query Frame = 1
Query:  559 KFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQ------IVSIPENSDLVSI---IKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSN------LEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKL---KSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIG-LSVSDRDLKENGRVSCELKEDLQS-----LELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI-----DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKI-KTKLEGKLNATDRDCDQMNNFVKYEFMTLYDH 2100
            + +VI   +  +   ++++ + D NDN P F   +       + +I E S+ +S+   +    A D D    N    Y  E + + F++  SN      +  L+  +  S DY     +   +          +   + +Q +D      +F +  Y   I E+ P+G  +L++    +D       +   +  GN        +    + +++L   LD   R  ++K ++  S           +     +VII + D NDN P        + +RS     +I E  P +  I  L   D D +EN   + E+  D+ S     +   D+  G   + +   YD   +     +  C  H +  L   +   + + D N+  P F   EY+  L EN P GS V    A+D DK    +L YSI     D    K F +D+++GL++++FV FD E    +++++ +       K A+V V++EI   ++  P F   + +F +   V + +  + G++ ATD D    +  V Y+    + H
Sbjct: 2502 ELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDY-----FVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALD-------QSLAIIAGNEESAFELLQ----SKAIVLVKPLD-RERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP--------IFDRSAKYEAEISELAPLRYSIAQLQAIDAD-QEN-TPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFV-FDYEQR--QRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGP-DGRVVYQLSAPHSH 3016          

HSP 12 Score: 80.8777 bits (198), Expect = 7.513e-15
Identity = 90/376 (23.94%), Postives = 161/376 (42.82%), Query Frame = 1
Query: 1546 IKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI-DRKVLKHFSIDNK-TGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKL---ILKLKAIDQD-ENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLK-----LGTYVLKFTARDNGVPPLSNDASITVHVQDNG 2634
            I+ +   +    P L  Y  + I +ED N+  P F   +++ ++ E    G+ V  V A D D    A L Y I D      F I+   +G++ T+ V  DRE+  I + ++   D+     T    ++++I+DVNDN P F  ++L       V +    E     T    + ++ +    +    +  +      +F +   +G++     LD E    + + V A D+    R      T+ V D NDN P ++  +P         +    PAI  S+I+E   +   +L + A D D E +  +V Y ++   +  F ++ + G +   +S L+      G Y ++  A+D G P L +   + V   DNG
Sbjct: 2288 IRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIV-LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-------VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVL---TVRVNDENDNAPVFLAQQP-------PAYFAILPAI--SEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG-FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNG 2642          

HSP 13 Score: 73.9442 bits (180), Expect = 1.038e-12
Identity = 138/606 (22.77%), Postives = 250/606 (41.25%), Query Frame = 1
Query:  577 LGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTK--TFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDS----TGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLIS-RYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQ-KLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGF--YDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNP------KTANVLVKIEILDVNDNDPVFLLSS-LQFFVQENVKIKTKLEGKLNATDRDCDQM-NNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKY----PNWTITVKAYDSGSPTRF-AFANATIYVRDLNDNQPEWIYPRPINF 2325
            L SY++    + IE++D NDN P F   + + ++ E ++  + +    A D D  +  R++ Y   D      F I+ +    ++  +   +D E +++Y   + A ++     TG +T   I +QI D NDN P F   +   T+ E+  +G  I  + A D+D   +    Y++ ++   ++ +   F +   +G L+LK +LD   +   ++  + ASD         E RT + + V D NDN P             +    +I E+      L+ ++ +D D + N      + E  Q         G    ++    P      D    +   +D GKP+LK    + +   D       F  N+Y   + E  P GS VL +     D+S  +I   +      F +     ++     P DRE   + +  + +      P       ++ + V I ILD NDN P+F  S+  +  + E   ++  +  +L A D D +   N+ V Y+  +  D     HM   F I   TG    L V +R  Y     ++ + ++A DS       +     + + D NDN+P++     ++F
Sbjct: 2302 LASYAE----LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLR-YHIVDGNHDNAFVIEPAFSGIVRTNI--VLDREIRDIYKLKIIATDEGVPQMTGTAT---IRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQ-QEYELDVIASDAAH------EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRII-AKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESA---FELLQSKAIVLVK--PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSI-AQLQAIDADQENTPNSEVVYDITSGNDE----HM---FTIDLVTG---VLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHF 2870          

HSP 14 Score: 71.2478 bits (173), Expect = 7.709e-12
Identity = 128/568 (22.54%), Postives = 240/568 (42.25%), Query Frame = 1
Query:  895 DSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRI-SVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDL--KENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTI-EIHIEDVNEYPPGFQNNE---------YLGSLRENTPPGSPVLTVRATDRDK---SAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNV--KDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKT-KLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTIT-VKAYDSGSPTRFAFANAT-----IYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDA--GRVCYYLQT-NGDNMFGLNETTGEL 2514
            D+   ++  ++VI+++DENDN PKFS++ +  T+ E    G  + +V A D D     +  Y IV   + N     F I P   S I+++ + L   I  ++K +I A+D+   + T       + + + D+NDN+PT      N+V  S       +  E    +  +S +D D       R+  E   D++++ +  +      L      DYE    ++  +E       +  E RT+  + + D N+  P F   +          +  + E+      +LTV ATD D    ++++IY I+    + FS+    G++S +       ++S   + V +  KD       ++ L++++  D       FL +  +  + E   + +  L+   +A D+    +    +  F  L   K I  +KP                LDRE+   + +  V ++  G P   +  +++     I + D NDN P  I+ R   ++              IS++A     I +L+AID D+ +     V Y + + N ++MF ++  TG L
Sbjct: 2298 DAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNA----FVIEP-AFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGT---ATIRVQIVDVNDNQPTFP--PNNLVTVS-------EATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYE----LQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIE-PAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAF-ELLQSKAIVLVKP----------------LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP--IFDRSAKYE------------AEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVL 2812          
BLAST of Protocadherin vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 172.555 bits (436), Expect = 1.140e-42
Identity = 180/717 (25.10%), Postives = 313/717 (43.65%), Query Frame = 1
Query:  562 FEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKF-----EDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQ---CQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFK--------FQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVL----AGNVVERSMFLTIKIKENEPAQKLIG-LSVSDRDLKENGRVSCEL--KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI-DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPV-FQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPT-RFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGEL-ITLVSPLKLG---TYVLKFTARDNGVPPLSNDASITV 2616
            +++++L S       + I++ D+NDN P F      +S  E++   + + ++ A D D         Y+      ++  +  T  N + +   L L+ + + ++++  +  L       G   +    Q+ + I D NDN P F    Y  ++ E+   G  ++ V A D D    +K  Y +    ++      F ++P+TG +    +++   + +V          F + A D    +    + RT V +++ D ND+ P I        G V          + EN     ++  ++V D D   NGR S  +    +L    L++     + +      D E+           D G P+      + I + DVN++ P F+ +EY   L E  P GS V ++ ATD D    A++ Y I     LK FS+D  TGLI T+  P DRE+    +  ++ +D   NPK A   +K+ ILD ND  P F        + E+   +T +   + ATD D    N  V +          +  + P+ F +   TG++ T   LDREK   + I+V A D G+PT + A A   + V D+NDN P++ YPR      +I     +   I +    EK +++L + A D+D+ D   + Y L++ G+ +F L+  +G + +   +P  +     Y L  +ARD G      DA + +
Sbjct:  127 YDLVVLSSQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQ------FTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPR---QDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVA--------TVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAAD-LHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTG-PLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQT-IVALMTATDHD-QGTNGSVTFALA-----PSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQF-YPR-----HYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEI 811          

HSP 2 Score: 162.925 bits (411), Expect = 7.859e-40
Identity = 189/712 (26.54%), Postives = 317/712 (44.52%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRV----KSYKFEDSTKTFTIDNS-NLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTG-CSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKE---NGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDK-TNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPN----WTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPA-INISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTN--GDNMFGLNETTGELITLVSPLK---LGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTIIIGMI 2676
            ++I IKD+ND  P F +  +  +I EN  + +++    A+D D      +    K  + ED  ++  +  S N  D +L +  ++D E ++ Y   + A +      ST+ Q++I+I DENDN P F  + Y  ++ E+  +G  +L+V A D+D     +  Y IV  G++N     F IS DTG + +   L+   R+S +   + A D          D   + I++ DINDN+PT           S +L   ++   P      L+V+  D      N +V   LKE    L   +   G  D+    P D E++          D G P L     + + ++D+N+  P F+   Y  ++REN P G+ VLT RATD+D+   A+L +++  + +  F ID++TG IST+    DRE TS+    +  +D   T P+ ++V + I + DVNDN P F  ++    V E +   +K E    A   D D   N V +  ++  D          F I   TG + T + L  +   +    +TI + A D G  +  + A  T+ +R      P  ++P           F Y   +   +S+     K+I K+ A    +   G++ Y +     GD++  ++  +G L      L       Y +   A D   P L +   IT++V D    AN N  ++  +I
Sbjct: 2153 VTILIKDVNDEVPVFISANE-TAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIV-LGDQN---HDFSISEDTGVVRVAKNLNY-ERLSRYSLTVRAEDCALEN--PAGDTAELTINILDINDNRPTFL--------DSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSG--DIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTA-TTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERI---SKGEFVFGARALDLDDGENAVVHYTISGRDQHY-------FDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILR------PPELFPT----------FAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLR-VDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTD----ANDNAPVMEQLI 2814          

HSP 3 Score: 160.999 bits (406), Expect = 3.126e-39
Identity = 198/735 (26.94%), Postives = 309/735 (42.04%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYF---RTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQ-IDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIG-LSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKT----------------------LFEC--QDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRK-VLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDK-TNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-----QTNGDNMFGLNETTGELITL--VSPLKLGTYVLKFTARDNGVPP---LSNDASITVHVQDNGRFANINLTIIIGMIA 2679
            I++I I D+NDN P F   R ++  +S+PEN+ +   I +    D+D    +R+      +  + F I         L+LQ+ I  E  +L    L A +  +   +    +   I D ND+ P F   SYE ++ E+  V      + A DID     +  Y+I+ +GN     R F + PD G L +++ LD   R   +   +S  D  +   +SV     V+IHV D NDN P            S F T  I EN PA   +G L+  DRD+  N  +S  L    Q   + D   GF  + +  P+D  +E L+K                       L E    D+G P L++   +++ + DVN+  P F    Y  ++ E    G+ +  V   D D+    ++ YS+ +      F++D+ TG +S      DRE   I    V  KD    +P ++N  + I +LD NDN P F  SS +  V E     T+L  +  A+D D   +N+ V +            + +  F I   TG +     LD E   ++T+ + A D G+P+        + V D NDN P  I+P     ++       +TP             I+ + A D D    G+V Y +     Q      FG+N  TG + TL  +    + T+ L   A D   P    LS +  +TV V+D     N N  + + M A
Sbjct:  927 IVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTG---VLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEII-EGN---TERMFGVFPD-GYLFVRAPLDREER-DYYALTVSCRDAGQPSRSSV---VPVVIHVIDENDNAPQFT--------NSTF-TFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTI-DTRNGF--IKTLRPFD--REALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRR-LDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELM-RFRASDAD-QGVNSQVVFSISA-------GNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPP--IFPSTAIVRQIKEGIPLKTP-------------IVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVED----INDNAPVFVSMNA 1606          

HSP 4 Score: 149.443 bits (376), Expect = 1.130e-35
Identity = 186/698 (26.65%), Postives = 308/698 (44.13%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVK-SYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDV--------NEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDR--------KVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDK--TNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTN-GDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            I+I + D NDN P F  +   VS+ E S   + +    A D D    ++V  S    +   TF ID+       L+L K +DYE    YT  + A +  T   ST     + + D+NDN P F   +  + I E  P+   I+ V A D D     K  Y I  +  +    R+F I+ +TG +    ++D  + I  F+  + A+D+ +     +     V + VEDINDN P    +   ++    F T K      +  ++ +   D D   NG V+ E+    Q L       G      T    +++E   +   +  D    S  E R+ E++I  +        +  P   Q ++  GS+ EN P G+ +LTV A     SAE+ Y +          +V + F ID K G++ST+    DRE    +++EV V        P+T+   V++ +LD ND+ P FL +   + V E+++I   +   L A D D       V +  M  +D K        F + P+TG++     LDRE    + + ++  D     ++  A ATI V D NDN P         F+  +  F       +I + A++   + ++ A D D     ++ Y + ++  +++F LN  TG ++TL + L   ++  Y+L   A+DNG P LS   ++  +V D
Sbjct: 1370 ITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITG---SLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRES-IDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILP-PKFSTSKGS----STAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITF--TPGPQFKQEVRYQLTLKSTDEAVQS--ERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTA--HLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTA-AELDRE-AGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTIS-TLRAHDPDT---LGSVTFLLMDGHDGK--------FLLEPSTGKLILNDTLDRETKSKYELRIRVSDG---VQYTEAYATIQVSDTNDNPPL--------FEDTVYSF-------DIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTG-MLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLD 2019          

HSP 5 Score: 145.976 bits (367), Expect = 1.291e-34
Identity = 185/698 (26.50%), Postives = 303/698 (43.41%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEK-------QNLYTGTLQACEDSTG-CSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENG--RVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTL---FECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYS-IDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKD-DKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGS--PTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD--NMFGLNETTGELITL--VSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            I+I I+D NDN P F  +    S PE    ++++    A D+D    N V SY  +  +  F+ID +  E   +F +K++ ++        +N+Y  T+ A ++      ++C + I I D ++N PKF +  Y   + +    G+ I++V A D      N+ +Y +++      +S  F +    G + L   + +    + ++  + A+D+         D T V+I V   N + P   V +  V+         + ENEP    ++ +  +D D   NG  R S     + Q   + +  GG   +      DY   DLI+        QD G   L     + I + DVN+ PP F + EY   + EN P G+ V    A D+D  K+A + Y+ +     +HF I N++    +S V FD E   I   ++  K+ D +    AN+ V   +L VN+  P FL     F V E   + T++ G + ATD+D  + +  V Y  +   + K        F+I   TG I     LDRE      +TV A + GS        A   I ++D ND         P  F +H     Y T  I  S+ A     +  +KAID+D         Y   NG+    F ++  TGE+ T   +   +  TY L   A D G+PP +  A++ + ++D
Sbjct: 2999 ITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGE---VFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFN----LSSIFSVGRHDGWITLVKPIQVPPN-TRYELVVRATDR---GVPPQSDETRVVIVVTGENMDTPRFSVNSYQVI---------VPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGG---IVIQQQLDY---DLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYV--HVLGVNEFYPQFLQPVFHFDVSETSAVGTRV-GAVQATDKDSGE-DGRVYYLLVGSSNDK-------GFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND---------PPEFIKH-----YYTSTI--SEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELED 3643          

HSP 6 Score: 144.821 bits (364), Expect = 2.648e-34
Identity = 188/738 (25.47%), Postives = 303/738 (41.06%), Query Frame = 1
Query:  610 SIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFED-STKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASD--------------KLKSKFTS-------------------VEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE---KEDLIKTL-------FECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSA--ELIYSIDRKVLKH-FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKT---NPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQEN-VKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTIII 2667
            +I++ D NDN P F        IPEN+     +    A D D     ++      D +   F++   N +   L L   +DYE+   Y   +QA ++     ST   +   + D NDN P F   SY   + E+ P+  E++ V A DID       EY I +      +   F I  + G++  +  LD  +R S +   ++A D              +LK K+ S                   +     V I ++D+ND  P    ++ N  E ++   + I        +I +   D D   NG +   +KE       +D+G      +S +P D +    + L + L          +D G+P       + I I D N+  P F   +Y  S+ EN   G+ VL V ATD D+ A   + YSI      H FSI   TG++    V  +     + ++ + V+ +     NP      + I ILD+NDN P FL S     V EN V         +NA D D   +N+ V+Y F+   D  L       F+I  ++G+I  L  LDRE+   +T+T+ A D+GSP         + V+D+NDN P                F  ++    + +       +L  +A D+DE    ++ + L     + F ++  TGE+ T  +  +  T V   T        ++ D+SIT       R +++NLTI +
Sbjct: 1909 TIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSL---NPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGD----VDSEFGIDSN-GTIRTRRNLDREHR-STYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVF--ISAN--ETAIMENVAIN-----TVVIAVKAVDNDEGRNGYIDYLMKEARD----EDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVR---VAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRY-FLKEGDSDL-------FRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPV---------------FELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTL-------MAQDSSIT-----EPRASSVNLTISV 2586          

HSP 7 Score: 140.969 bits (354), Expect = 4.420e-33
Identity = 176/702 (25.07%), Postives = 283/702 (40.31%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTG--CSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRIS-----VFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVE-----RSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFL-LSSLQFFVQENVKIKTKLEGKLNATDRDCD-QMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELIT-----------LVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            I+ +E++DINDN P F       ++ EN    + +    A DKD     +++     +    F ID+   E  ++    ++D E+ ++Y  TL A + S     ++   + I + D NDNIPKF   +Y   + E    G+ +    A+D+D  +     Y I  +        YF I+  TG  ++ ++L+L  +        +   ISA D+ +   +S  + T VI+   ++    PT   +A +        R   +  K+    P + L+G     R     G +   L+ D  S  L     G          DYE   L +   E  D   PSL+    I +++ D N+  P  +   Y   + E   P   +  V+A+DRD      +IY +       F I  ++G I T  +  DRE      F V   D      T    V + +LD NDN P F  L SL   V EN +I + +   +  T  D D   N    Y F      K        F+I P +G I     LDRE+   + + V A D       A    TI ++D NDN PE        F+     F +        ++ +   L+ ++ A D+D+     V  Y       MF ++  TGE+ +           + SP  +  Y L   A DNG PPL ++  + +++ D
Sbjct: 2476 IVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDS---ETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQH-----YFDINTKTG--VVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELT-VILRPPEL---FPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVG---KIRYAIAGGIMGDSLRVDPNSGLLSVGQDGL---------DYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEI-TESGEIYTR-MRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLN--VTENAEIGSFV---IRVTSSDLDLGANANASYSFSENPGEK--------FRIEPQSGNITVAGHLDREQQDEYILKVVASDGA---WRAETPITITIQDQNDNAPE--------FEHSFYSFSF-------PELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENM--YALTVLATDNGKPPLYSECLVNINIVD 3116          

HSP 8 Score: 137.117 bits (344), Expect = 7.185e-32
Identity = 163/608 (26.81%), Postives = 261/608 (42.93%), Query Frame = 1
Query:  916 QCQIVIQIDDENDNIPKFS--KESYEKTIV--ESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYD--LWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREM--------------TSIKQ--------FEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQ-MNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAF-ANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQT-NGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQDN 2631
            QC + I I D NDN P F+  +ES E TI   E+  VG+EI      D D    ++  Y + +  N+      F+I P TG L L+  +  +   S+   ++ A+D   +    +  + ++ + + D+ND+ P   V      E S+  T K+       +   L+ +D DL +NGR+S E+ E       + + G F D  L+   P D E+ D       C+D G+PS      + IH+ D N+  P F N+ +  S+ EN P  + V  + A DRD  ++AEL +++  +  + F+ID + G I T   PFDRE                S++          E  V D+        V VK+ + DVNDN P FL +     + E     T +    +   +D D+ +N  V Y            +    F +   TG++     LDRE      + V A D+      +  A+ TI V D NDN PE               F   +  +++ + +     +++ +A D D+    +V + +   N  + F ++  TG L  L  PL    + +Y L  TA D G P LS      V V D+
Sbjct:  925 QCIVNIAIIDLNDNAPVFALDRES-EPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQ-----FRIGPVTGVLYLQRPI-RAEPGSLIHVELMATD---AGSPPLSSKLSLSVLIADVNDHTP---VFDHTSYETSLPETTKVN-----TRFFALAATDIDLGDNGRISYEIIEG----NTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQT-QDFTIDTRNGFIKT-LRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHI---THVFTQDADEGLNGDVYYSLAK-------GNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPE---------------FTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLY-LHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDD 1482          

HSP 9 Score: 134.42 bits (337), Expect = 3.958e-31
Identity = 155/576 (26.91%), Postives = 245/576 (42.53%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVK-SYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTG---CSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTI--KVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELK-DVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIE----IHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD---KSAELIYSIDRKVLKH-FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDN 2289
            + I +   N + P F  N   V +PEN  + S I   GA D D      ++ S    +  + F++D        + +Q+ +DY+    Y   L       G    S+   + I + D NDN P F+ + Y   I E+ PVG  + +  A D D PK     Y  +  G       +F ++   G++      D   R  ++  QI    K K+  +S+E   N+ +HV  +N+  P     V   +V E S   T          ++  +  +D+D  E+GRV   L         + D   G   ++     D E ++ +      +++G  S++   T E    I I+D N+ PP F  + Y  ++ E  P G+ V TV+A D+D   ++ +  YSI    LK  F ID +TG IST+    DRE TS     +   D    P+T +  V IE+ DVNDN P F    L  ++ EN    T +   L A+D D  +      Y+ +        +H K    +   +G + +    DRE  P     ++  DSG P + +    TI V D NDN
Sbjct: 3215 VVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTG---GIVIQQQLDYDLIQEYH--LNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDR---HFFIMNQSNGTISSAVSFDYEER-RIYTLQI----KAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGT----------RVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGL--IYVARHLDRETQNRVVLTVMAKNYG--SIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTA-SRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIM-TLIASDPDLPRNGGPFTYQLIGG------KH-KSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDN 3753          

HSP 10 Score: 128.642 bits (322), Expect = 2.523e-29
Identity = 177/721 (24.55%), Postives = 305/721 (42.30%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKD--------FSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDS-TGCSTQCQIVIQIDDENDNIPKFSKESYEK-TIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRIS-VFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQ-SLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEI--ETLVVLDREKYPN-----WTITVKAYDSGSPTRFAFANATIYVRDLNDNQP-----EWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQT-NGDNMFGLNETTGELITLVSPLKL---GTYVLKFTARDNGVPPLSNDASITVHV----QDNGRFANINLTIII 2667
            ++I + D+NDN P F +    V++PE       +    A+D D        ++   R + Y F+ +TKT  +        KL L+          YT  + A +      S++ ++ + I    +  P F+  +     + E    GK I KV A         K  Y I       ++    ++ P++G L+   Q  L   ++ +++  I A+D       SV   T + ++V D NDN P        V+E+ ++    ++E  P Q +  +  SDRD  +NG V   L+ D   + E+ + G    ++++    D E+      + E  D G P +    ++ +H+ D N+ PP F     L ++ EN   GS V+ V ++D D   +A   YS      + F I+ ++G I+ +    DRE       +V   D     +T    + I I D NDN P F  S   F   E ++    L G++ ATDRD    N+ + Y          ++   P+F I P TGE+  +  V     +Y       + +TV A D+G P  ++     I + D ++N P     E++ P P +                    A + + I+++ A D+ +     + Y L T N  ++F +    G  ITLV P+++     Y L   A D GVPP S++  + + V     D  RF+  +  +I+
Sbjct: 2582 LTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHY-FDINTKTGVVST------KLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAG----GIMGDSLRVDPNSG-LLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSV---TLITLNVTDANDNAP--------VMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITESG----EIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSL-NVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAG-HLDREQQDEYILKVVASDGAWRAETP---ITITIQDQNDNAPEFEHSFYSFSFPE-LQQSIALVGQIIATDRDKQGPNSVISYS---------LQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQD--------------------AVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDG-WITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIV 3238          

HSP 11 Score: 118.627 bits (296), Expect = 2.805e-26
Identity = 149/577 (25.82%), Postives = 243/577 (42.11%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRTNKQIVSIPENS-DLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTG-CSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLI-GLSVSDRDLKENGRVSCEL---KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAE-LIYS--IDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKT--NPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEW 2301
            +++I I D ++N P F   + +  +P+++     I+++     +D        S    + +  F++      D  + L K I       Y   ++A +      S + ++VI +  EN + P+FS  SY+  + E+ PVG  IL V A D D        Y I S GN     + F +   TG ++++ QLD  + I  +   I+  D      +SV     + I + D+NDN P       N  E   +    I EN+P    +     +D+D  +N  +         D     +    G    + S   +DYE E  I TL     +   S++ Y  + +H+  VNE+ P F    +   + E +  G+ V  V+ATD+D   +  +Y   +     K F ID  TGLI  +    DRE  +     V  K+  +     T    V I I D ND  P F+       + E   + TK+   + A D+D    NN   Y  +         ++K  F+I   TGEI T   LDRE+   + + + A D+G P +   A   I + D+NDN P +
Sbjct: 3109 LVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGR---HDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSI-SGGNER---QDFSVDERTGGIVIQQQLDY-DLIQEYHLNITVQDLGYHPLSSV---AMLTIILTDVNDNPPVF-----NHKEYHCY----IPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNG---TISSAVSFDYE-ERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVAR-HLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVT-TVKAIDKDVRTQNNQFSYSIIN-------GNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTF 3651          

HSP 12 Score: 115.161 bits (287), Expect = 3.645e-25
Identity = 138/540 (25.56%), Postives = 221/540 (40.93%), Query Frame = 1
Query:  580 GSYSKNSFI-ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSN--LEDLKLFLQKSI------------DYEKQNLYTGT---LQACEDSTG---CSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRV--SCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRK-----VLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVN-VKDDKTNPKTANV----LVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNN-FVKYEFMT 2088
            G  S++S + + I + D NDN P F  +    SIPEN+   + +    A+D+D   +N   S+     T+ FTID  N  ++ L+ F ++++            D   +    G    L+A     G      + ++ + + D NDN P+F +  Y  TI E    G  I  V   D D    N   Y  ++KGN    +  F +   TG L L  +LD  ++       ++    LK   +S     ++ I V D NDN P     +  V          + E  P   +L+    SD D   N +V  S        +  +  + G  Y      P DYE            D G PSL       + + D N+ PP F +   +  ++E  P  +P++TV A D D     ++ Y+I ++       +HF I+ +TG+I T     DRE  SI  F +  V  D+  P    +    LV + + D+NDN PVF+  +      +    K      +    +D D  +N  V YE ++
Sbjct: 1129 GQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDI-GRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDAD-EGLNGDVYYSLAKGNE---AGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSS---NASITIVVLDENDNAPEFTQSSSEV---------SVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLY---LHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHT-LREIDRE--SIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVS 1645          

HSP 13 Score: 98.9821 bits (245), Expect = 2.724e-20
Identity = 133/579 (22.97%), Postives = 242/579 (41.80%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRT---NKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFE-DSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCST-QCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDID-GPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIG-LSVSDRDLK-ENGRVSCELKEDLQSLELKDVGGGFYD----LWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKH-FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQP 2295
            +I++ + D NDN P       N +++       L++++K   A D+D S  N    Y+ + D   TF I  S     +++ +  +D E+   Y   ++A +      T    +++ + D+NDN PKF++  +   + E+  +G  +++V + D+D G   N +     + G +      F+I P +G++ +   LD   +   +  ++ ASD       +    T + I ++D NDN P  +           F +    E + +  L+G +  +DRD +  N  +S  L++      +    G  +      +    Y    E++        D+GKP L     + I+I D +  PP F+  EYL  L ++   G  ++ V A D+    + E+ YS+    L   FS+    G I T   P      +  +  V   D    P++    V I +   N + P F ++S Q  V EN  + + +   + ATD D    N  ++Y      + +        F +   TG I     LD +    + + +   D G     + A  TI + D+NDN P
Sbjct: 2795 LITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVK---ASDRD-SGDNGNVIYRLQNDFDGTFEITESG----EIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTR-LFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEK------FRIEPQSGNITVAGHLDREQQ-DEYILKVVASDG------AWRAETPITITIQDQNDNAPEFE---------HSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWI-TLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTIL-TVGATDDDTGP-NGMLRYSISGGNERQ-------DFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPP 3332          

HSP 14 Score: 77.7962 bits (190), Expect = 6.587e-14
Identity = 157/690 (22.75%), Postives = 277/690 (40.14%), Query Frame = 1
Query:  598 SFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDS------TKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDST----GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGK----EILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVE-DRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRV-SCELK----------EDLQSLELKDVGGGFYDLWSTHPYDYEK--EDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNG-DNMFGLNETTGELITL--VSPLKLGTYVLKFTARD 2574
            + + ++ + D NDN P F +   +  I E   L + I    A D D     +V SY            + F I   N E   +   + ID E  + +  T+ A + +       ST+  + + ++D NDN P F   +    +   F   K     +++V A D D        Y+IVS G + L    FK+  +TG +           +   ++Q++    LKS   +V+ +R +  +++  I       +       +RS  L+  + ENEP    IG S+    L     + S E++             Q   L D+      L +    D E   E+    ++     G+P     + + + + D N+ PP F +  ++ ++ E+   G  + T+RA D D    + + +       F ++  TG +  +    DRE  S  +  + V D     +       I++ D NDN P+F  +   F + EN +   ++ G++ A D D  Q N  + Y  ++ + +        VF + P TG +     LD E+  ++ + V+A D+G P+          V DLNDN P +             P  Y +       IA +   ++ + A D D  + G + Y +     D+ FG+ ++ G + T   +      TY L  TARD
Sbjct: 1472 TVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKV-SYAISKQEPQLPQGRHFGI---NTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMN-AAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVS-GPQEL----FKLQRNTGIITFTPGPQFKQEV---RYQLT----LKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSK-LSGSVYENEP----IGTSI----LTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTK-VRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKFLLEPSTGKLILNDT-LDRETKSKYELRIRVSD---GVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQV-GQIVARDADLGQ-NAQLSYGVVSDWAND-------VFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIF------------DPMSYSSEVFENVPIATE---VVTVSAKDIDSGNNGLIEYSITAGDVDSEFGI-DSNGTIRTRRNLDREHRSTYTLTVTARD 2105          

HSP 15 Score: 62.3882 bits (150), Expect = 3.914e-9
Identity = 90/371 (24.26%), Postives = 146/371 (39.35%), Query Frame = 1
Query: 1606 IEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLIST-------SFVPF------DREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWT------------ITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD-NMFGLNETTGELITLVSPL----KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            + I + DVN+  P F       S  E+   G+ +L   ATD D     +   D+  +   ++DNK  L++T       S++        DRE     Q  ++ +D  + P+   + V + ILDVNDN P+F  S     + E     T +   + A+D D    N+ + Y ++   +H+        F + P TG I T    +R   P  T             TV A D GSP +      T+ + D ND+ P       I+F+     F        + + A    ++  +   D D    GR    + +  +   F L E     I  V+ +    ++G Y L   A D G P  +  A + + V D
Sbjct:  142 VRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGV--TDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVM-ASDNDLGD-NSKITY-YLAETEHQ--------FTVNPETGVISTT---ERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDP------IISFRF----FPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVND 486          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0330601)

HSP 1 Score: 162.54 bits (410), Expect = 1.029e-39
Identity = 194/708 (27.40%), Postives = 314/708 (44.35%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENS------DLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKT-FTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACED-STGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDK-LKSKFTSVEDRTNVIIHVEDINDNKPTI--KVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDV---GGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKH------FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVL-VKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD--NMFGLNETTG----ELITLV-----SPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            + +++ D NDN P F      V +PE+       + V+ I+   A D D      ++      +T++ F+ID+ + +   + L K +DYE    Y   ++A +  S   S   Q+++ + D NDN P+F    ++++++E+ PVG  I++V+A D D     +  Y I  + +   ++    + P TG +     LD   +   F FQ+ A D  +  K  S    ++V+I V+D+NDN P    K    NV E          +  P   +  ++ +D D  E+ R+  E+               G G   +      DY++E          D G  S  +  T+ I+I D N + P F+N  Y  S+ E+ P G+ VL V ATD D    A++ YS++ + +        FSI+ +TG I T+  P DRE TS     V  KD   NP  ++   V+I + DVNDN P F     Q  + E+  + T +  ++ A+D D   +N  +KY    L D  +       F I PT+G I T   LDRE    + +T  A D GSP   +     I + D+ND+ P +   +       I+ ++ E   +          ++ ++ A D DE     V +Y    GD  N F L    G    +L+T+      S  K    V++  +     PPL NDA I + V D
Sbjct:  567 VQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIR---ATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD---VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA----VDPRTGWVQTIKPLDREEQ-GRFAFQVVAKDGGVPPKSAS----SSVVITVQDVNDNDPAFNPKYYEANVGE----------DQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITI--AQSLDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTN-APLDRETTSGYLLTVTAKDGG-NPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVI-QVAASDPDVG-LNGRIKY---LLSDRDI---EDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDK-------ITLYVPENSPVG--------SVVGEIHAHDPDEG-VNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS-----PPLRNDAHIEILVTD 1212          

HSP 2 Score: 144.05 bits (362), Expect = 5.118e-34
Identity = 173/704 (24.57%), Postives = 298/704 (42.33%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNL---EDLKLF----------LQKSIDYEKQNLY----TGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKE---ILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELK-DVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLK-HFSI--DNKTGLISTS-FVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKP-VFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNG--DNMFGLNETTGELIT--LVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            + + + D ND+ P F   +   SI E + + S +    A D+D   KN    Y  E  T     D + L   +++ +F           + S+D E  + Y    T    A   S   +    + +++ D+NDN P+FS+ +Y   + E    G E   +  + A D D        Y I+    ++     F I   +G + L   LD  + +  ++  I A D       S  + T ++++V D NDN P       +  + S+   + +  N     +I +   D D   N  ++  + E   +  L  D   G+  + +  P D E++         +D G P      ++ I ++DVN+  P F    Y  ++ E+ PPG+PV TV ATD D+ + L Y I     +  F+I   N  GLI+ +  + + +E    K+F + V    +  ++    V I I D N+  P+F  +     V E+  + T +   ++ATD D   +N  + Y   +L +  +     P  F I P TG I T   LDRE    + +TV A D G+P+     +  I V D+NDN P +  P            +Y+   +  + +      ++++ A D D    GR+ Y L      D  F ++ T+G + T   +    +  + L   A D G PPLS+   + + ++D
Sbjct:  450 LQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDI-GKNAEIEYGIEAVT-----DGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS----QFSIDSMSGDVSLVKPLDYES-VRSYRLVIRAQD---GGSPSRSNTTQLLVNVIDANDNAPRFYT---SQFQESVLENVPVGYN-----IIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGW--VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQE----KRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVL-VVSATDSDVG-VNAQITY---SLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSP------------LYQASILEDALVGTS---VIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED 1105          

HSP 3 Score: 120.939 bits (302), Expect = 5.113e-27
Identity = 174/694 (25.07%), Postives = 300/694 (43.23%), Query Frame = 1
Query:  580 GSYSK-NSFIISIEIKDINDNKPYFRTNKQIVSIPENSDL-VSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQ--KSIDYEKQNLYTGTLQACEDSTGC---STQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKED----LQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLK--HFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTT--GEIETLVVLDREK-YPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYY-LQTNGDNMFGLNETTGELITLVSPLKLGTYVLKFTARDNGVPPLSNDA 2604
            GS S+ N+  + + + D NDN P F T++   S+ EN  +  +II+++ A D D  A   + +Y   +    F +    ++    ++Q  K +D E+Q  +    Q      G    S    +VI + D NDN P F+ + YE  + E  P G  +  V A D D  + ++  Y+I +   R    R+   S +   LI  +Q     +   F   ++A+D          D   V I++ D N+  P        + E + +     ++      ++ +S +D D+  N +++  L E+    L S +   +      + +  P D E           +D G PSL +   +EI + DVN+  P F++  Y  S+ E+   G+ V+ V A+D D      + Y +  + ++   F ID  +G I T+    DRE  ++        D  + P ++ V V+I + DVND+ P F    +  +V EN  + + + G+++A D D + +N  V Y  +   D             RP +   ++ T+  LD E     + + V+A    SP     A+  I V D+NDN P        +FQ   + F    P+  I           ++ A D D +D  ++ Y  L  N  N+  LN ++G L+  +SP +L T V KF   +  V    N+A
Sbjct:  665 GSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQ-AYDSDEGANAEI-TYSISERDDNFPL---AVDPRTGWVQTIKPLDREEQGRFA--FQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRG---RFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS-----GGRSDTATVHINITDANNFAP--------IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTN-KGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVV-GEIHAHDPD-EGVNAVVHYSIIGGDDSNAFS-----LVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVL-----RDFQVIFNNFRDHFPSGEIG----------RIPAFDADVSD--KLHYRILSGNNANLLRLNSSSGGLV--LSP-QLNTNVPKFATMEVSVSDGINEA 1302          

HSP 4 Score: 119.013 bits (297), Expect = 2.298e-26
Identity = 97/362 (26.80%), Postives = 170/362 (46.96%), Query Frame = 1
Query: 1603 TIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDR----------KVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKD---DKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNN-FVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNM-FGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            T+++++ D N++ P F+  ++  S+RE    GS V+T+RATD+D  K+AE+ Y I+           + +  F ID+++G+IST     DRE +      V   D    ++  +TA   V++++LD NDN P F   +    V E+    T+     +    D DQ NN  ++Y  +         + +  F I   +G++  +  LD E   ++ + ++A D GSP+R       + V D NDN P +       +       + E   +  +        I++++A D DE     + Y +    DN    ++  TG + T + PL   + G +  +  A+D GVPP S  +S+ + VQD
Sbjct:  449 TLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTR-SSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG-------GNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF-------YTSQFQESVLENVPVGYN--------IIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQT-IKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQD 786          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 162.54 bits (410), Expect = 1.053e-39
Identity = 194/708 (27.40%), Postives = 314/708 (44.35%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENS------DLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKT-FTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACED-STGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDK-LKSKFTSVEDRTNVIIHVEDINDNKPTI--KVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDV---GGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKH------FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVL-VKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD--NMFGLNETTG----ELITLV-----SPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            + +++ D NDN P F      V +PE+       + V+ I+   A D D      ++      +T++ F+ID+ + +   + L K +DYE    Y   ++A +  S   S   Q+++ + D NDN P+F    ++++++E+ PVG  I++V+A D D     +  Y I  + +   ++    + P TG +     LD   +   F FQ+ A D  +  K  S    ++V+I V+D+NDN P    K    NV E          +  P   +  ++ +D D  E+ R+  E+               G G   +      DY++E          D G  S  +  T+ I+I D N + P F+N  Y  S+ E+ P G+ VL V ATD D    A++ YS++ + +        FSI+ +TG I T+  P DRE TS     V  KD   NP  ++   V+I + DVNDN P F     Q  + E+  + T +  ++ A+D D   +N  +KY    L D  +       F I PT+G I T   LDRE    + +T  A D GSP   +     I + D+ND+ P +   +       I+ ++ E   +          ++ ++ A D DE     V +Y    GD  N F L    G    +L+T+      S  K    V++  +     PPL NDA I + V D
Sbjct:  567 VQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIR---ATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD---VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA----VDPRTGWVQTIKPLDREEQ-GRFAFQVVAKDGGVPPKSAS----SSVVITVQDVNDNDPAFNPKYYEANVGE----------DQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITI--AQSLDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTN-APLDRETTSGYLLTVTAKDGG-NPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVI-QVAASDPDVG-LNGRIKY---LLSDRDI---EDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDK-------ITLYVPENSPVG--------SVVGEIHAHDPDEG-VNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS-----PPLRNDAHIEILVTD 1212          

HSP 2 Score: 144.05 bits (362), Expect = 4.811e-34
Identity = 173/704 (24.57%), Postives = 298/704 (42.33%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNL---EDLKLF----------LQKSIDYEKQNLY----TGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKE---ILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELK-DVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLK-HFSI--DNKTGLISTS-FVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKP-VFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNG--DNMFGLNETTGELIT--LVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            + + + D ND+ P F   +   SI E + + S +    A D+D   KN    Y  E  T     D + L   +++ +F           + S+D E  + Y    T    A   S   +    + +++ D+NDN P+FS+ +Y   + E    G E   +  + A D D        Y I+    ++     F I   +G + L   LD  + +  ++  I A D       S  + T ++++V D NDN P       +  + S+   + +  N     +I +   D D   N  ++  + E   +  L  D   G+  + +  P D E++         +D G P      ++ I ++DVN+  P F    Y  ++ E+ PPG+PV TV ATD D+ + L Y I     +  F+I   N  GLI+ +  + + +E    K+F + V    +  ++    V I I D N+  P+F  +     V E+  + T +   ++ATD D   +N  + Y   +L +  +     P  F I P TG I T   LDRE    + +TV A D G+P+     +  I V D+NDN P +  P            +Y+   +  + +      ++++ A D D    GR+ Y L      D  F ++ T+G + T   +    +  + L   A D G PPLS+   + + ++D
Sbjct:  450 LQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDI-GKNAEIEYGIEAVT-----DGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS----QFSIDSMSGDVSLVKPLDYES-VRSYRLVIRAQD---GGSPSRSNTTQLLVNVIDANDNAPRFYT---SQFQESVLENVPVGYN-----IIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGW--VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQE----KRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVL-VVSATDSDVG-VNAQITY---SLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSP------------LYQASILEDALVGTS---VIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED 1105          

HSP 3 Score: 121.324 bits (303), Expect = 4.689e-27
Identity = 174/694 (25.07%), Postives = 300/694 (43.23%), Query Frame = 1
Query:  580 GSYSK-NSFIISIEIKDINDNKPYFRTNKQIVSIPENSDL-VSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQ--KSIDYEKQNLYTGTLQACEDSTGC---STQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKED----LQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLK--HFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTT--GEIETLVVLDREK-YPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYY-LQTNGDNMFGLNETTGELITLVSPLKLGTYVLKFTARDNGVPPLSNDA 2604
            GS S+ N+  + + + D NDN P F T++   S+ EN  +  +II+++ A D D  A   + +Y   +    F +    ++    ++Q  K +D E+Q  +    Q      G    S    +VI + D NDN P F+ + YE  + E  P G  +  V A D D  + ++  Y+I +   R    R+   S +   LI  +Q     +   F   ++A+D          D   V I++ D N+  P        + E + +     ++      ++ +S +D D+  N +++  L E+    L S +   +      + +  P D E           +D G PSL +   +EI + DVN+  P F++  Y  S+ E+   G+ V+ V A+D D      + Y +  + ++   F ID  +G I T+    DRE  ++        D  + P ++ V V+I + DVND+ P F    +  +V EN  + + + G+++A D D + +N  V Y  +   D             RP +   ++ T+  LD E     + + V+A    SP     A+  I V D+NDN P        +FQ   + F    P+  I           ++ A D D +D  ++ Y  L  N  N+  LN ++G L+  +SP +L T V KF   +  V    N+A
Sbjct:  665 GSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQ-AYDSDEGANAEI-TYSISERDDNFPL---AVDPRTGWVQTIKPLDREEQGRFA--FQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRG---RFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS-----GGRSDTATVHINITDANNFAP--------IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTN-KGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVV-GEIHAHDPD-EGVNAVVHYSIIGGDDSNAFS-----LVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVL-----RDFQVIFNNFRDHFPSGEIG----------RIPAFDADVSD--KLHYRILSGNNANLLRLNSSSGGLV--LSP-QLNTNVPKFATMEVSVSDGINEA 1302          

HSP 4 Score: 119.013 bits (297), Expect = 2.217e-26
Identity = 97/362 (26.80%), Postives = 170/362 (46.96%), Query Frame = 1
Query: 1603 TIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDR----------KVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKD---DKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNN-FVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNM-FGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            T+++++ D N++ P F+  ++  S+RE    GS V+T+RATD+D  K+AE+ Y I+           + +  F ID+++G+IST     DRE +      V   D    ++  +TA   V++++LD NDN P F   +    V E+    T+     +    D DQ NN  ++Y  +         + +  F I   +G++  +  LD E   ++ + ++A D GSP+R       + V D NDN P +       +       + E   +  +        I++++A D DE     + Y +    DN    ++  TG + T + PL   + G +  +  A+D GVPP S  +S+ + VQD
Sbjct:  449 TLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTR-SSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG-------GNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF-------YTSQFQESVLENVPVGYN--------IIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQT-IKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQD 786          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 218.009 bits (554), Expect = 1.628e-57
Identity = 235/876 (26.83%), Postives = 378/876 (43.15%), Query Frame = 1
Query:  286 LFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPNVDYSVT------YDNKYFSIIXXXXXXKEVID----LEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQI--DDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKV-LAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNG-DNMFGLNETTGELITL---VSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANIN------------------------------LTIIIGMIAITVS-ISVFLIVAIICVRRQPRFQ 2748
            +  +  +     C A Q  + ++ EE P N  +GN++  L+ N  P++  S        Y      ++       E++     +++         E  C  + EV +L         I   I+DINDN P F++    +SIPEN+ + S   +  A D D    N ++ Y+   S   F +D     +     +L +Q+S+D E ++ +   ++  ED          ++Q+   D NDN P F     E  + E+ P+G  +  + A D D     +  +   ++ + +   R+F I   TG + +K  LD      V K  + ASD      +S   R  VI++V DINDN P+I      N+V  ++ L+    EN P    I L +V+DRD   NG+V+C    D+    LK V    + L +  P DYE            D GKP L     + I I+D N+  P F   E   S+ EN  PG+ ++ + ATD D    A +IYS+       F+ID+++G++S      DRE      F V  +D+ T P  +NV VK+ + D NDN P F      F+V EN+ +   + G +  TD D    N  V    +   D+         F I P TG I+  +  DRE+  ++T  VKA D+G     ++A  TI V D+NDN+P ++ P         S + Y+    N S       ++ ++ AID D      + Y +       +F +++TTG  ITL   +     G + L    +D G P  S  A   VH+  N   +N                                + ++I +IA T++ I V  + A++  R+ PR +
Sbjct:    9 VLVVLFTCLFLMCRA-QEKDYTVKEEQPENVRIGNLRKDLNLNLDPDIKLSSALQFKPVYKTGDVPLVKVEASTGEILTTANRIDREKLCSGVFNEKRCYYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGI-NGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIK-VEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPS-TKRHFAIDSTTGLITVKQPLDREVN-PVHKLIVLASDG-----SSTPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLS----ENAPLNTKIALITVTDRDSDLNGKVTCYTDHDV-PFRLKPVFNDQFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSV-VKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTV-GLITVTDADAGD-NAVVTLSIINGKDN---------FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFVIPS--------SNYSYDLVPSNTS----PGSVVTRVFAIDNDTGMNAELQYSIIGGSLRGLFTIDKTTGN-ITLQEKIVAADQGLHRLVVKVKDLGQPE-SLHAIALVHLFVNDTVSNATFIQEQLRKSLETPLERNIGDNDVTPQTNGYVIVVIAIIAGTMTVILVIFVTALVRCRQTPRHK 843          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 218.394 bits (555), Expect = 1.789e-57
Identity = 236/881 (26.79%), Postives = 379/881 (43.02%), Query Frame = 1
Query:  271 VSLKKLFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPNVDYSVT------YDNKYFSIIXXXXXXKEVID----LEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQI--DDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKV-LAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNG-DNMFGLNETTGELITL---VSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANIN------------------------------LTIIIGMIAITVS-ISVFLIVAIICVRRQPRFQ 2748
             S   +  +  +     C A Q  + ++ EE P N  +GN++  L+ N  P++  S        Y      ++       E++     +++         E  C  + EV +L         I   I+DINDN P F++    +SIPEN+ + S   +  A D D    N ++ Y+   S   F +D     +     +L +Q+S+D E ++ +   ++  ED          ++Q+   D NDN P F     E  + E+ P+G  +  + A D D     +  +   ++ + +   R+F I   TG + +K  LD      V K  + ASD      +S   R  VI++V DINDN P+I      N+V  ++ L+    EN P    I L +V+DRD   NG+V+C    D+    LK V    + L +  P DYE            D GKP L     + I I+D N+  P F   E   S+ EN  PG+ ++ + ATD D    A +IYS+       F+ID+++G++S      DRE      F V  +D+ T P  +NV VK+ + D NDN P F      F+V EN+ +   + G +  TD D    N  V    +   D+         F I P TG I+  +  DRE+  ++T  VKA D+G     ++A  TI V D+NDN+P ++ P         S + Y+    N S       ++ ++ AID D      + Y +       +F +++TTG  ITL   +     G + L    +D G P  S  A   VH+  N   +N                                + ++I +IA T++ I V  + A++  R+ PR +
Sbjct:    4 ASEAHVLVVLFTCLFLMCRA-QEKDYTVKEEQPENVRIGNLRKDLNLNLDPDIKLSSALQFKPVYKTGDVPLVKVEASTGEILTTANRIDREKLCSGVFNEKRCYYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGI-NGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIK-VEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPS-TKRHFAIDSTTGLITVKQPLDREVN-PVHKLIVLASDG-----SSTPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLS----ENAPLNTKIALITVTDRDSDLNGKVTCYTDHDV-PFRLKPVFNDQFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSV-VKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTV-GLITVTDADAGD-NAVVTLSIINGKDN---------FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFVIPS--------SNYSYDLVPSNTS----PGSVVTRVFAIDNDTGMNAELQYSIIGGSLRGLFTIDKTTGN-ITLQEKIVAADQGLHRLVVKVKDLGQPE-SLHAIALVHLFVNDTVSNATFIQEQLRKSLETPLERNIGDNDVTPQTNGYVIVVIAIIAGTMTVILVIFVTALVRCRQTPRHK 843          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 218.779 bits (556), Expect = 1.863e-57
Identity = 204/702 (29.06%), Postives = 315/702 (44.87%), Query Frame = 1
Query:  613 IEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTI------DNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYD------LWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI--DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQ-TNGDNMFGLNETTGELITLVSPLKL---GTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANIN 2652
            IE++DINDN P F +    +S+PEN+ + ++  I  A DKD + +N V  Y      +   +      ++   +  +L +  S+D E ++ Y  T++A +          ++ + I D NDN PKF K SYE  + E+ P+G  +L+V+A D D     + EY +      + + +  +I   +G + +K  LD    I+  KF + A DK  S  +S   +T V I V D NDN P +++    +V  S  +   I E+ P    + L  VSD+D  EN  V+C +  D+   +L+       D      L +T P DYE+    +      D G P+L    ++++ + D N+  P F    +     E   PG  V+ V A+D D    AEL+YSI  D      F ID  +G +  +  P DRE     +F V   D           V I++LD NDNDP F+LS   F V EN+     L      T +D D+  N  + +     D          F I+  TG I + +  DREK  ++T  +KA D G P R ++   TI V D NDN P    P   +F             I +S +A    ++  ++A D D      + Y +   N  ++F ++ + GE ITL   L     G + L     D G P  S  A   VH+  N   AN++
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKD-TERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQA--IDPVPKLLRIDRSSGIIYVKGPLD-REEINNLKFYVVARDKGPSPKSS---KTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVA-NISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDV-PFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVR-ARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMP---PLSPVGMVTVQDMDEGEN-AQVQLSVEPDVGK-------FVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSF-------------IRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGE-ITLTKELTRKHSGLHRLVIKVSDRGKP--SRHAIALVHIYVNETIANVS 783          

HSP 2 Score: 129.413 bits (324), Expect = 1.311e-29
Identity = 150/584 (25.68%), Postives = 251/584 (42.98%), Query Frame = 1
Query:  595 NSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLV-SIIKIEGAIDKDFSAKNRVKSYKFEDS----TKTFTIDNSNLEDLKLFLQKSIDYEK-QNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKF--------SKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLI-------LKSQLDLS-NRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPV--LTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQ-ENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYV 2271
            +S ++ + I D NDN P F  +     + ENS +  S+++++ A D D      ++ Y    +     K   ID S+     ++++  +D E+  NL    +   +  +  S++  + I + D+NDN P          +       I E  PVG  +  V+  D D     + E  +V+      +   F++ P + S +       L++   L   R+  ++ +I A D      +S     ++ + V D NDN P        +   ++F     +EN+P +K++ +  SD D   N  +   +  D  +  L ++     ++ +  P D E +D  +      D G PS +   T+ I + D N+  P F  + Y  S+ EN PP SPV  +TV+  D  ++A++  S++  V K F I N TG I +S + FDRE  S   F +   D    P+++ V V I +LD NDN PV    S   F++   +     +   + A D D       V Y       H L       F I P+ GEI     L R+      + +K  D G P+R A A   IYV
Sbjct:  225 SSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVK-ANDSDLGPNGEIE-YTLHQAIDPVPKLLRIDRSSG---IIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKD-----EGENAVVTCVVAGDVP--FQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSST---NSLKVQVTDTNDNSP--------IFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGK-FVIQNGTGTILSS-ISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELV-YSIAGGNPHDL-------FYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYV 775          

HSP 3 Score: 89.3521 bits (220), Expect = 1.994e-17
Identity = 115/460 (25.00%), Postives = 198/460 (43.04%), Query Frame = 1
Query: 1357 KIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTH-PYDYEKEDLIKTLFECQDHGKPSLKEY-------------RTIE--IHIEDVNEYPPGFQNNEYLGSLRENTPPGS----PVLTVRATDRDKSAELIYSIDRKVLKHFSI---DNKTGLISTSFV--PFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDEND--------AGRVCYYLQTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            ++ E +P   LIG   +D+ L + G +    K ++ +  L+ V G   D+++T  P D E      TL +C++ GKP   E+             R IE  I ++D+N+  P F +     S+ ENT  G+    P+ T + T+R+  A+   +   + +  F +   +++   +    V    DRE+       +   D    P+ ++ L+++ I D NDN P F  SS +  V EN  I   +  ++ A D D    N  ++Y       H+ I  +  + +I  ++G I     LDRE+  N    V A D G   + +    +I V D NDN P           R I    +     NIS+       +  ++  D+DE +        AG V + L+   D+   ++      +   +PL   ++  Y ++  A D+G P LS+  S+ V V D
Sbjct:   28 RVHEEQPPSTLIGSLAADQGLPDTGHL---YKLEVGAPYLR-VDGKTGDIFTTEIPIDRE------TLKDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVL-QVKANDSDLGP-NGEIEYTL-----HQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEI-------RGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDS--SVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTD 461          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 218.009 bits (554), Expect = 1.918e-57
Identity = 206/705 (29.22%), Postives = 315/705 (44.68%), Query Frame = 1
Query:  613 IEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKT-----FTIDNSNLEDL-KLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYD------LWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI--DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKP---VFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQ-TNGDNMFGLNETTGELITLVSPLKL---GTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANIN 2652
            IE++DINDN P F +    +S+PEN+ + ++  I  A DKD + +N V  Y      +        +     E L +L +  S+D E ++ Y  T++A +          ++ + I D NDN PKF K SYE  + E+ P+G  +L+V+A D D     + EY +      + + +  +I   +G + +K  LD    I+  KF + A DK  S  +S   +T V I V D NDN P +++    +V  S  +   I E+ P    + L  VSD+D  EN  V+C +  D+   +L+       D      L +T P DYE+    +      D G P+L    ++++ + D N+  P F    +     E   PG  V+ V A+D D    AEL+YSI  D      F ID  +G +     P DRE     +F V   D           V I++LD NDNDP F+LS   F V EN+     L      T +D D+  N            ++   ++P    F I+  TG I + +  DREK  ++T  +KA D G P R ++   TI V D NDN P    P   +F             I +S +A    ++  ++A D D      + Y +   N  ++F ++ + GE ITL   L     G + L     D G P  S  A   VH+  N   AN++
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKD-TERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQA--IDPVPKLLRIDRSSGIIYVKGPLD-REEINNLKFYVVARDKGPSPKSS---KTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVA-NISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDV-PFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRAR-SPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMP---PLSPVGMVTVQDMDEGEN-----------AQVQLSVEPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSF-------------IRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGE-ITLTKELTRKHSGLHRLVIKVSDRGKP--SRHAIALVHIYVNETIANVS 783          

HSP 2 Score: 127.872 bits (320), Expect = 3.041e-29
Identity = 150/584 (25.68%), Postives = 251/584 (42.98%), Query Frame = 1
Query:  595 NSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLV-SIIKIEGAIDKDFSAKNRVKSYKFEDST----KTFTIDNSNLEDLKLFLQKSIDYEK-QNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKF--------SKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLI-------LKSQLDLS-NRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPV--LTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQ-ENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYV 2271
            +S ++ + I D NDN P F  +     + ENS +  S+++++ A D D      ++ Y    +     K   ID S+     ++++  +D E+  NL    +   +  +  S++  + I + D+NDN P          +       I E  PVG  +  V+  D D     + E  +V+      +   F++ P + S +       L++   L   R+  ++ +I A D      +S     ++ + V D NDN P        +   ++F     +EN+P +K++ +  SD D   N  +   +  D  +  L ++     ++ +  P D E +D  +      D G PS +   T+ I + D N+  P F  + Y  S+ EN PP SPV  +TV+  D  ++A++  S++  V K F I N TG I +S + FDRE  S   F +   D    P+++ V V I +LD NDN PV    S   F++   +     +   + A D D       V Y       H L       F I P+ GEI     L R+      + +K  D G P+R A A   IYV
Sbjct:  225 SSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVK-ANDSDLGPNGEIE-YTLHQAIDPVPKLLRIDRSSG---IIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKD-----EGENAVVTCVVAGDVP--FQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSST---NSLKVQVTDTNDNSP--------IFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGK-FVIQNGTGTILSS-ISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELV-YSIAGGNPHDL-------FYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYV 775          

HSP 3 Score: 89.7373 bits (221), Expect = 1.758e-17
Identity = 115/460 (25.00%), Postives = 198/460 (43.04%), Query Frame = 1
Query: 1357 KIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTH-PYDYEKEDLIKTLFECQDHGKPSLKEY-------------RTIE--IHIEDVNEYPPGFQNNEYLGSLRENTPPGS----PVLTVRATDRDKSAELIYSIDRKVLKHFSI---DNKTGLISTSFV--PFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDEND--------AGRVCYYLQTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            ++ E +P   LIG   +D+ L + G +    K ++ +  L+ V G   D+++T  P D E      TL +C++ GKP   E+             R IE  I ++D+N+  P F +     S+ ENT  G+    P+ T + T+R+  A+   +   + +  F +   +++   +    V    DRE+       +   D    P+ ++ L+++ I D NDN P F  SS +  V EN  I   +  ++ A D D    N  ++Y       H+ I  +  + +I  ++G I     LDRE+  N    V A D G   + +    +I V D NDN P           R I    +     NIS+       +  ++  D+DE +        AG V + L+   D+   ++      +   +PL   ++  Y ++  A D+G P LS+  S+ V V D
Sbjct:   28 RVHEEQPPSTLIGSLAADQGLPDTGHL---YKLEVGAPYLR-VDGKTGDIFTTEIPIDRE------TLKDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVL-QVKANDSDLGP-NGEIEYTL-----HQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEI-------RGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDS--SVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTD 461          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: CR847522.1 (pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:4879379:1 gene:ENSDARG00000111493.1 transcript:ENSDART00000185190.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847522.1)

HSP 1 Score: 216.083 bits (549), Expect = 1.101e-56
Identity = 208/693 (30.01%), Postives = 326/693 (47.04%), Query Frame = 1
Query:  559 KFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQID--DENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKI---VSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQT-NGDNMFGLNETTGELITLVSP--LKLGTYVLKFTARDNGVP 2586
            + EV+IL +       I I +KD NDN P F +    +SIPEN+ + S   I  A D D +  N V  Y+  +    F +D     +     +L +Q+++D E+++ Y   ++  ED          ++Q+   D NDN P F +   E  I E+ PVG  +++++A D D     + +Y     VS   R    R F ++  TG + ++  LD     ++ K  + ASD      +S   R  + I+V D+NDN P I +     +      T+ + E +P    I L +VSD+D   NG+V C +++D+    LK V    Y L ++   DYE  KE + K +    D GKPSL +   + + +ED N+ PP F       ++ EN      + T+ ATD D  ++AE++Y +       F +D KTG+++ S V FDRE      F V  +D+ T    +   V + ILD NDN P F  +  QFFV EN+  K    G +  TD D  + N  V+   +   ++         F + P +G I++ V  DRE+  ++T  V+A D+GSP   + A  TI V D+NDN P  IYP P N    + P      AI  S +AE       + A+D D      + Y + + N  ++F ++  TG +     P    +G + L     D G P
Sbjct:  111 EIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPD-TGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKV-EDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATR----RLFALNTTTGLITVQRPLD-REETAIHKLTVLASDG-----SSSPARATITINVTDVNDNAPNIDL---RYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDV-PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIV--ASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNA-SFFDLDRKTGVLTASRV-FDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLP-KYSTVGVITVTDADAGE-NAVVRLSILNDNEN---------FILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYP-PSNTSFKLVPL----SAIPGSVVAE-------VFAVDGDTGMNAELKYTIVSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYP 760          

HSP 2 Score: 83.5741 bits (205), Expect = 1.117e-15
Identity = 136/609 (22.33%), Postives = 248/609 (40.72%), Query Frame = 1
Query:  922 QIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDT---GSLILKSQLDLSNRIS-VFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRV----SCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGS-------LRENTPPGSPV--LTVRATDRDKSAELIYSIDRKVLKHF-SIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKP---VFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHIS---PFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVS--PLKLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTIII 2667
            +I I + D NDN P F       +I E+  +        A D D    +  +Y++++   ++        +P+      LI++  LD   + + V K ++      +   T++     + + V D+NDN+P  K            + + I EN P    ++ L  +D D+  N  +      ++    + L   +   G   +    P D E+  + K      D      +   TI I++ DVN+  P   +  Y+ S       L E  P  + +  +TV   D D + ++I  I++ V  H  ++ +   L+ TS +  D E T    F++   D          LV++ + D NDN P+F    ++  V EN  ++      ++ATD D  +             + +++  + P    F +   TG +    V DRE+   +  TV A D+G+    + A   + + D NDN P++ +    +FQ  +S   P       I ++D       +++L  ++ +EN                F L+  +G + + VS    +  +Y     A DNG PP S+ A +T++V D     N N  I+I
Sbjct:  126 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLN--GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAI-----LQVTVTDVNDNRPVFK---------ESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITV--QRPLDREETAIHKLTVLASDGSSSPARA--TITINVTDVNDNAPNI-DLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSAL-LDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMEN-NLRDMFLTTISATDEDSGR-------------NAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHN---HFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILNDNEN----------------FILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVID----VNDNTPIVI 675          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 224.557 bits (571), Expect = 1.802e-59
Identity = 244/878 (27.79%), Postives = 383/878 (43.62%), Query Frame = 1
Query:  286 LFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPNV----DYSVTYDNKYFSIIXXXXXXKEV------IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNR--NLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY-YLQTNGDNMFGLNETTGELITLVSPLKLG----TYVLKFTARDNGVP-PLSNDASITVHVQD---NGRF-------------------------ANINLTIIIGMIAITVS-ISVFLIVAIICVRRQPRFQ 2748
            L  + I+  +F   A Q  N  + EE P N ++GN+   L+    P++     + + Y      +I       E+      ID EKLC       +     + EV +L         I   I+DINDN P F +    +SIPEN+ + S   +  AID D    N ++ Y+       F +D     +     +L +Q+S+D E+++ Y   ++  +      +   I+ + + D NDN P F ++  E  I E   VG  + ++ A D D     K  +     GN+  NL  R+F I  +TG + +K  LD        K  + ASD      +S   R  V I++ DINDN P+I       +   +  T+++ E  P    I L +V+D+D   NG+V+C    D+    LK V    + L +  P DYE  +E  IK +    D GKP L +   + I I+D N+  P F       S  EN PPG+ +  + ATD D  ++AEL Y +       F++D +TG++ T+    DRE      F V  KD+       N  V + +LD NDN P F  +   F+V EN+ +   + G +  TD D  + N  V    +   D+         F I P TG I   +  DRE+  ++T  VKA D GSP + +    TI+V D+NDN+P ++ P         + + Y+    + S       ++ ++ AID D      + Y  +  N   +F + E +G  ITL   L  G     Y L     D+G P P    A + + V +   NG +                          N  + III +IA T++ I V  + A++  R+ PR +
Sbjct:    9 LLAVLIACIVFESGA-QEKNYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGIFTENKC--FYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGV-NGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYF---GNQITNLAKRHFAIDNNTGLITVKEPLDREES-PYHKLTVLASDG-----SSTPSRATVTINITDINDNIPSIDT---RYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDV-PFRLKPVFDNQFLLETAAPLDYESTREYAIKIV--ASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGIL-TAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTV-GLITVTDADSGE-NAVVTLSLVNARDN---------FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPS--------NNYSYDLVQTSTS----PGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGN-ITLKEKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFVNETITNGSYIQELVRKSKETAVGEDFRDGEITPQTNDYVKIIIAIIAGTMTVILVIFVTALVRCRQTPRHK 842          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 224.557 bits (571), Expect = 1.945e-59
Identity = 244/878 (27.79%), Postives = 383/878 (43.62%), Query Frame = 1
Query:  286 LFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPNV----DYSVTYDNKYFSIIXXXXXXKEV------IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNR--NLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY-YLQTNGDNMFGLNETTGELITLVSPLKLG----TYVLKFTARDNGVP-PLSNDASITVHVQD---NGRF-------------------------ANINLTIIIGMIAITVS-ISVFLIVAIICVRRQPRFQ 2748
            L  + I+  +F   A Q  N  + EE P N ++GN+   L+    P++     + + Y      +I       E+      ID EKLC       +     + EV +L         I   I+DINDN P F +    +SIPEN+ + S   +  AID D    N ++ Y+       F +D     +     +L +Q+S+D E+++ Y   ++  +      +   I+ + + D NDN P F ++  E  I E   VG  + ++ A D D     K  +     GN+  NL  R+F I  +TG + +K  LD        K  + ASD      +S   R  V I++ DINDN P+I       +   +  T+++ E  P    I L +V+D+D   NG+V+C    D+    LK V    + L +  P DYE  +E  IK +    D GKP L +   + I I+D N+  P F       S  EN PPG+ +  + ATD D  ++AEL Y +       F++D +TG++ T+    DRE      F V  KD+       N  V + +LD NDN P F  +   F+V EN+ +   + G +  TD D  + N  V    +   D+         F I P TG I   +  DRE+  ++T  VKA D GSP + +    TI+V D+NDN+P ++ P         + + Y+    + S       ++ ++ AID D      + Y  +  N   +F + E +G  ITL   L  G     Y L     D+G P P    A + + V +   NG +                          N  + III +IA T++ I V  + A++  R+ PR +
Sbjct:   29 LLAVLIACIVFESGA-QEKNYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGIFTENKC--FYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGV-NGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYF---GNQITNLAKRHFAIDNNTGLITVKEPLDREES-PYHKLTVLASDG-----SSTPSRATVTINITDINDNIPSIDT---RYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDV-PFRLKPVFDNQFLLETAAPLDYESTREYAIKIV--ASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGIL-TAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTV-GLITVTDADSGE-NAVVTLSLVNARDN---------FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPS--------NNYSYDLVQTSTS----PGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGN-ITLKEKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFVNETITNGSYIQELVRKSKETAVGEDFRDGEITPQTNDYVKIIIAIIAGTMTVILVIFVTALVRCRQTPRHK 862          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 224.942 bits (572), Expect = 1.956e-59
Identity = 244/878 (27.79%), Postives = 383/878 (43.62%), Query Frame = 1
Query:  286 LFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPNV----DYSVTYDNKYFSIIXXXXXXKEV------IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNR--NLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY-YLQTNGDNMFGLNETTGELITLVSPLKLG----TYVLKFTARDNGVP-PLSNDASITVHVQD---NGRF-------------------------ANINLTIIIGMIAITVS-ISVFLIVAIICVRRQPRFQ 2748
            L  + I+  +F   A Q  N  + EE P N ++GN+   L+    P++     + + Y      +I       E+      ID EKLC       +     + EV +L         I   I+DINDN P F +    +SIPEN+ + S   +  AID D    N ++ Y+       F +D     +     +L +Q+S+D E+++ Y   ++  +      +   I+ + + D NDN P F ++  E  I E   VG  + ++ A D D     K  +     GN+  NL  R+F I  +TG + +K  LD        K  + ASD      +S   R  V I++ DINDN P+I       +   +  T+++ E  P    I L +V+D+D   NG+V+C    D+    LK V    + L +  P DYE  +E  IK +    D GKP L +   + I I+D N+  P F       S  EN PPG+ +  + ATD D  ++AEL Y +       F++D +TG++ T+    DRE      F V  KD+       N  V + +LD NDN P F  +   F+V EN+ +   + G +  TD D  + N  V    +   D+         F I P TG I   +  DRE+  ++T  VKA D GSP + +    TI+V D+NDN+P ++ P         + + Y+    + S       ++ ++ AID D      + Y  +  N   +F + E +G  ITL   L  G     Y L     D+G P P    A + + V +   NG +                          N  + III +IA T++ I V  + A++  R+ PR +
Sbjct:   29 LLAVLIACIVFESGA-QEKNYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGIFTENKC--FYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGV-NGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYF---GNQITNLAKRHFAIDNNTGLITVKEPLDREES-PYHKLTVLASDG-----SSTPSRATVTINITDINDNIPSIDT---RYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDV-PFRLKPVFDNQFLLETAAPLDYESTREYAIKIV--ASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGIL-TAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTV-GLITVTDADSGE-NAVVTLSLVNARDN---------FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPS--------NNYSYDLVQTSTS----PGSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGN-ITLKEKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFVNETITNGSYIQELVRKSKETAVGEDFRDGEITPQTNDYVKIIIAIIAGTMTVILVIFVTALVRCRQTPRHK 862          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 216.468 bits (550), Expect = 7.476e-57
Identity = 212/708 (29.94%), Postives = 330/708 (46.61%), Query Frame = 1
Query:  499 IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQT-NGDNMFGLNETTGELITL---VSPLKLGTYVLKFTARDNGVP 2586
            ID EKLC       E+ C  + EV+IL +       I I +KD NDN P F +    +SIPEN+ + S   I  A+D D +  N V+ Y+  +    F +D     +     +L +Q+++D E+++ Y   ++  +  T   +   I+ + + D NDN P F +   E  I E+ P+G  ++++ A D D     + +Y I      +   R F ++  TG + ++  LD     +V K  + A+D      +S   R  V I+V D+NDN P I +     +   +  T+ + E +P    I L +VSD+D   N +V C ++ ++    LK V    Y L ++   DYE            D GKPSL +   + + +ED N+ PP F       S+ EN   G  + TV A+D D  K+++++Y +       F +D KTG+++ S V FDRE      F V  +D+ T P  +   V + +LD NDN P F  +  QFFV EN+  K    G + ATD D  + N  V    +   ++         F + P +G I++ V  DRE+  ++T  VKA D G P R + A  TI + D NDN P  I P P N    + P      AI  S +AE       + A+D D      + Y + + N   +F ++  TG  ITL    S   +G + L     D G P
Sbjct:   92 IDREKLCAGSSNSDENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKY-IFGAQVTSATKRLFALNNTTGLITVQRPLD-REETAVHKLTVLATDG-----SSTPARATVTINVTDVNDNPPNIDL---RYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVICFIEREV-PFHLKAVYDNQYLLETSSLLDYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPNA-SFFDLDRKTGVLTASRV-FDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLP-KYSTVGVITATDSDAGE-NKAVTLSILNDNEN---------FVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDANDNSPVVISP-PSNTSFKLVPL----SAIPGSVVAE-------VFAVDTDTGMNAELKYTIVSGNNKGLFRIDPVTGN-ITLEEKPSAADVGLHRLVVNISDLGYP 761          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000027070.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:19099783:19110965:-1 gene:ENSXETG00000013163.1 transcript:ENSXETT00000027070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 197.593 bits (501), Expect = 4.011e-51
Identity = 196/747 (26.24%), Postives = 335/747 (44.85%), Query Frame = 1
Query:  601 FIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLK---LFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFV-----PFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYY-LQTNGDNMFGLNETTGEL-----ITLVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQDN-----------------GRFANINLTIIIGMIAITVSISVFLIVAIICVRRQ 2736
            + I++EI+D+NDN P F  +   +SI E + + +   +  A D D    N ++SYK   +     ++  N +  K   L L+K++D EK+N     L A +  T   T   ++ I + D NDN P F+K++Y  T+ E+ P+G  ++ + A D D  + +  E   +           F I+P+ GS+ +  +LD     + ++  + A D        +     ++I V D+NDN P I + + + +         I E+     +I L ++ D D  ENG V  ++ E L    L    G +Y L ++   D EK        + +D G P L   +TI + + DVN+  P F   +Y+  ++EN P G+    V ATD D  ++ +++Y I   +++   I +   + + S V      FD E   +++F +  +D  +   T N  +++ + DVNDN PVF       ++QEN    +    +++ATD D ++    V   +M L D      +     I   +G +      D E    + I V A DSGSP+R A A   I + D NDN P+ +YP     Q   +  ++E     I   + K  L+ K+ A+D D      + Y+ LQ    +   + + TGE+     +     L+    V+    +DNG P LS+  ++ + V +N                    A   L I I +I+I    +V + V   C R+Q
Sbjct:  120 YTINVEIQDVNDNSPSFSKSIFEISISELAVVGTHFALGSAKDPDL-GNNSIQSYKLSANDYFGMLEKVNTDGRKYPELVLEKTLDREKKNSSVLILSAFDGGTPSKTGTSLIRIVVTDINDNYPLFNKDTYRVTVSENVPIGFLVIDLHATDAD--EGSNAEITYLFNDIPENAQEVFAINPENGSVQITGKLDYEVATN-YEMTVEAKDG-----GGLVSYCKLLIQVSDVNDNAPDILITSFSDI---------IPEDSRVGTVIALVNLDDLDSGENGEVVGQISESL-PFHLISSSGNYYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFDKMDYVAYIQENNPSGNSFYRVHATDPDINENGKVVYMILTDIIEDIPISSYVSINTVSGVLYAQRSFDYE--KLREFYIQAEDKGSPQLTNNKTIRLILTDVNDNAPVFEKMDYVAYIQENNPSGSSF-FRVHATDSDINENGKVV---YMILTDIIEDMPLSSYISINTVSGVLYAQRSFDYESLREFYIQVMAKDSGSPSRSANATVKICITDQNDNAPKILYPS----QDSEAASVFEF----IPHFSTKGYLVTKVVAVDADSGHNAWLSYHLLQVPDPSFLIIGQNTGEIRITRDLQETDALRQRIVVM---VKDNGYPMLSSTVTLNLVVAENFQQVLPEITNQHIDTESSSNATFYLVISIALISILFIFTVLVAVISKC-RKQ 829          

HSP 2 Score: 77.411 bits (189), Expect = 1.365e-13
Identity = 92/357 (25.77%), Postives = 151/357 (42.30%), Query Frame = 1
Query: 1597 YRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSF------VPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIA-EKHKLILKLKAIDQDENDAGRVCYYLQTNGDNM-FGLNETTGELITLVSPLKL-----GTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            + TI + I+DVN+  P F  + +  S+ E    G+      A D D     I S       +F +  K       +         DRE  +     ++  D  T  KT   L++I + D+NDN P+F   + +  V ENV I   L   L+ATD D +  N  + Y F     + +  + + VF I P  G ++    LD E   N+ +TV+A D G     ++    I V D+NDN P+ +          I+ F         SDI  E  ++   +  ++ D+ D+G     +    +++ F L  ++G    LV+ + L       Y +   A D G P L+N  +I + + D
Sbjct:  119 FYTINVEIQDVNDNSPSFSKSIFEISISELAVVGTHFALGSAKDPDLGNNSIQSYKLSANDYFGMLEKVNTDGRKYPELVLEKTLDREKKNSSVLILSAFDGGTPSKTGTSLIRIVVTDINDNYPLFNKDTYRVTVSENVPIGF-LVIDLHATDAD-EGSNAEITYLF-----NDIPENAQEVFAINPENGSVQITGKLDYEVATNYEMTVEAKDGGG--LVSYCKLLIQVSDVNDNAPDIL----------ITSF---------SDIIPEDSRVGTVIALVNLDDLDSGENGEVVGQISESLPFHLISSSGNYYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTD 447          

HSP 3 Score: 58.151 bits (139), Expect = 1.168e-7
Identity = 72/244 (29.51%), Postives = 103/244 (42.21%), Query Frame = 1
Query:  595 NSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNS---NLEDLKLFLQKSIDYEKQNLYTGTLQACED--STGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNL-ISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTI 1308
            NS  I + + D+NDN P F     +  I EN+   +      A D D +   +V      D  +   I +    N     L+ Q+S DYEK  L    +QA ED  S   +    I + + D NDN P F K  Y   I E+ P G    +V A D D  +  K  Y I++    ++ +S Y  I+  +G L  +   D  + +  F  Q+ A D   S   S      V I + D NDN P I
Sbjct:  437 NSKTIRLILTDVNDNAPVFDKMDYVAYIQENNPSGNSFYRVHATDPDINENGKVVYMILTDIIEDIPISSYVSINTVSGVLYAQRSFDYEK--LREFYIQA-EDKGSPQLTNNKTIRLILTDVNDNAPVFEKMDYVAYIQENNPSGSSFFRVHATDSDINENGKVVYMILTDIIEDMPLSSYISINTVSGVLYAQRSFDYES-LREFYIQVMAKD---SGSPSRSANATVKICITDQNDNAPKI 673          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 218.009 bits (554), Expect = 4.940e-58
Identity = 214/708 (30.23%), Postives = 329/708 (46.47%), Query Frame = 1
Query:  499 IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDL----KLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQT-NGDNMFGLNETTGELITL---VSPLKLGTYVLKFTARDNGVP 2586
            ID EKLC       E+ C  + EV+IL +       I I +KD NDN P F +    +SIPEN+ + S   I  A D D +  N V+ Y+  +    F +D     +     +L +Q+++D E+++ Y   ++  +  T   +   I+ + + D NDN P F +   E  I E+ PVG  ++++ A D D     +  Y I          R F ++  TG + ++  LD     ++ K  + ASD      +S   R  V I+V D+NDN P I +     +   +  T+ + E +P    I L +VSD+D   NG+V C ++ ++    LK V    Y L ++   DYE            D GKPSL +   + + +ED N+ PP F       S+ EN   G  + T+ ATD D  K+A+++Y +       F +D KTG+++ S V F+RE      F V  +D+ T P  +   V + +LD NDN P F  +  QFFV EN+  K    G +  TD D  + N  V    +   ++         F + P +G I++ V  DRE+  ++T  VKA D G P R + A  TI V D+NDN P  I P P N    + P      AI  S +AE       + A+D D      + Y + + N   +F ++  TG  ITL    +P  +G + L     D G P
Sbjct:   92 IDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRY-IFGAQVAPATKRLFALNNTTGLITVQRSLD-REETAIHKVTVLASDG-----SSTPARATVTINVTDVNDNPPNIDL---RYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA-SFFDLDRKTGVLTASRV-FNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLP-KYSTVGVITVTDEDAGE-NKAVTLSILNDNEN---------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISP-PSNTSFKLVPL----SAIPGSVVAE-------VFAVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGN-ITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 118.627 bits (296), Expect = 2.094e-26
Identity = 147/550 (26.73%), Postives = 237/550 (43.09%), Query Frame = 1
Query: 1078 YKIVSK-GNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSK-FTSVE---------DRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDV----GGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVL----KHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDP----VFLLSSLQ--FFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGR---VCYYLQTNGDNMFGLNETTGELIT--LVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            Y++VSK G+  L+    K+S  TG +        SNRI   K    AS   +++ F  +E             + I V+D NDN P            S  + I I EN        + S +D D   NG    EL        L  V    G  +  L      D E++D      + +D G P       +++ + DVN+  P F+  +    + EN P G+ V+ + ATD D   +AE+ Y    +V     + F+++N TGLI+      DRE T+I +  V   D  + P  A   V I + DVNDN P     +++S +    ++ E   + TK+   +  +D+D D     V  + +   + ++  H+K V+  +     +ET  +LD E    ++  + A DSG P+    A   + + D NDN P                 I+  P I +S ++E ++  L L  I   + D+G+   + Y L  N  + F L+  TG L    + +  +   ++   TARDNG PPL + A++ V V D
Sbjct:   64 YRLVSKAGDAPLV----KVSSSTGEI-----FTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFP---------SPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQR-SLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKI-ALITVSDKDTD-----VNGKVICFIEREVPFHLKAVYDNQYL---LETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPP-----------------IFNQPVIELS-VSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA-SFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD 564          

HSP 3 Score: 85.1149 bits (209), Expect = 4.105e-16
Identity = 139/594 (23.40%), Postives = 243/594 (40.91%), Query Frame = 1
Query:  922 QIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTG---SLILKSQLDLSNRIS-VFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRV----SCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGS-------LRENTPPGSPV--LTVRATDRDKSAELIYSIDRKVLKHFSI--DNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKP---VFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVS--PLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +I I + D NDN P F       +I E+  +        A D D   FN  ++  +  G +++       +P+      LI++  LD   + + V K ++      +   T++     + + V D+NDN+P  K   G V        + I EN P    +I L  +D D+  N  +      ++    + L   +   G   +  +   D E+  + K      D    S     T+ I++ DVN+ PP   +  Y+ S       L E  P  + +  +TV   D D + ++I  I+R+V  H     DN+  L ++S    D E T    F++   D          LV++++ D NDN P+F    ++  V EN +    L   ++ATD D  +             +  ++  + P    F +   TG +    V +RE+   +  TV A D+G+P   + A   + V D NDN P++ +        H   F+ E           K+  +  +   D+D  +   V   +  + +N F L+  +G + + VS    +  +Y     A D G PP S+ A +T++V D
Sbjct:  127 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDT-GFNGVQHYELLNG-QSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAI-----LQVTVSDVNDNRPVFK--EGQV-------EVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRS--LDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNI-DLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSL--LDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLT-TISATDEDSGK-------------NADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH-------NHFQFFVSEN--------LPKYSTVGVITVTDEDAGENKAVTLSILNDNEN-FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD 667          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 219.55 bits (558), Expect = 1.084e-57
Identity = 226/795 (28.43%), Postives = 365/795 (45.91%), Query Frame = 1
Query:  286 LFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPN------VDYSVTYDNKYFSIIXXXXXXKEV------IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQID--DENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELI----TLVSPLKLGTYVLKFTARDNGVP 2586
            +F + ++  +F   A Q  N ++ EE P N ++G++   L+ +  P+      + + + Y      +I       E+      ID EKLC   +         + EV +L         I   I+DINDN P F T    +SIPENS + S   +  AID D    N V++Y+   S   F +D     +     +L +QK +D E+++ Y   ++  ED          ++Q+   D NDN P F ++  E +I E+ P+G  + ++ A D D  +  +  +   S    N+  R F ++  TG + +K  LD     S  K  + A+D       S   R  V+++V DINDN P+I +     +      T+ + EN P    I L +V D+D + NGRV+C    ++    L+ V    + L +    D+E  +E  IK L    D GKP L +   + I ++D N+  P F  +    S+ EN  PG+ +  + ATD D  ++AE+ Y +       F++D +TG++ T+    DRE      F V  +D+   P  +N  V + +LD NDN P+F  +   F+V E++  K    G +  TD D  + N+ V    + + D          F I P +G I   +  DRE+  ++T  VKA D G  +R + A  TI V D+NDN+P +I P P N+      F +  P+ N   +      + K+ AID D      V Y +   N   +F + +T+G +      +VS L L   ++K  A D G P
Sbjct:    9 IFAVLLACVVFQSGA-QEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDARC--FYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGI-NGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVK-VEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYF-SNLVSNIAKRLFHLNTTTGLITVKEPLDREESPS-HKLLVLATDG-----GSTPARATVLVNVTDINDNVPSIDI---RYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEV-PFRLRPVFSNQFLLETAAFLDFESTREYAIKLL--AADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGIL-TAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLP-KHGTVGLITVTDPDYGE-NSAVTLSILDVNDQ---------FTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDP-PSNYS-----FEWVLPSTNPGTV------VFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVK--ANDLGQP 759          

HSP 2 Score: 110.153 bits (274), Expect = 1.051e-23
Identity = 126/474 (26.58%), Postives = 200/474 (42.19%), Query Frame = 1
Query: 1276 VEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVS-DRDLKENGRVSCEL--KEDLQSLELKDV--GGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS---------AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSL------QFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +EDINDN P            +  + I I EN        L  + D D+  NG  + +L   +++  L++ +   G     L      D E++D      + +D G P       +++ + D N+  P F   E   S+ EN P GS V  + ATD D           + L+ +I +++   F ++  TGLI+    P DRE +   +  V   D  + P  A VLV +   D+NDN P   +  +         + EN  + TK+   +   D+D +       +      DH++   ++PVF        +ET   LD E    + I + A D+G P     +   I V+D NDN P +        Q  IS  + E    N S  A+    + K+ A D D      + Y L  +    F L++ TG ++T V  L   K   Y     A+DNG+PPL ++A++ V V D
Sbjct:  129 IEDINDNAPLFP---------TTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRL---FHLNTTTGLITVK-EPLDREESPSHKLLVLATDGGSTPARATVLVNVT--DINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKI-ALITVMDKDSEHNGRVTCFT-----DHEVPFRLRPVFS---NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFT-------QSFISLSVPE----NNSPGAQ----LTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTG-ILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLD 562          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 219.935 bits (559), Expect = 1.369e-57
Identity = 226/795 (28.43%), Postives = 365/795 (45.91%), Query Frame = 1
Query:  286 LFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPN------VDYSVTYDNKYFSIIXXXXXXKEV------IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQID--DENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELI----TLVSPLKLGTYVLKFTARDNGVP 2586
            +F + ++  +F   A Q  N ++ EE P N ++G++   L+ +  P+      + + + Y      +I       E+      ID EKLC   +         + EV +L         I   I+DINDN P F T    +SIPENS + S   +  AID D    N V++Y+   S   F +D     +     +L +QK +D E+++ Y   ++  ED          ++Q+   D NDN P F ++  E +I E+ P+G  + ++ A D D  +  +  +   S    N+  R F ++  TG + +K  LD     S  K  + A+D       S   R  V+++V DINDN P+I +     +      T+ + EN P    I L +V D+D + NGRV+C    ++    L+ V    + L +    D+E  +E  IK L    D GKP L +   + I ++D N+  P F  +    S+ EN  PG+ +  + ATD D  ++AE+ Y +       F++D +TG++ T+    DRE      F V  +D+   P  +N  V + +LD NDN P+F  +   F+V E++  K    G +  TD D  + N+ V    + + D          F I P +G I   +  DRE+  ++T  VKA D G  +R + A  TI V D+NDN+P +I P P N+      F +  P+ N   +      + K+ AID D      V Y +   N   +F + +T+G +      +VS L L   ++K  A D G P
Sbjct:    9 IFAVLLACVVFQSGA-QEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDARC--FYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGI-NGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVK-VEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYF-SNLVSNIAKRLFHLNTTTGLITVKEPLDREESPS-HKLLVLATDG-----GSTPARATVLVNVTDINDNVPSIDI---RYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEV-PFRLRPVFSNQFLLETAAFLDFESTREYAIKLL--AADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGIL-TAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLP-KHGTVGLITVTDPDYGE-NSAVTLSILDVNDQ---------FTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDP-PSNYS-----FEWVLPSTNPGTV------VFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVK--ANDLGQP 759          

HSP 2 Score: 109.383 bits (272), Expect = 2.054e-23
Identity = 126/474 (26.58%), Postives = 200/474 (42.19%), Query Frame = 1
Query: 1276 VEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVS-DRDLKENGRVSCEL--KEDLQSLELKDV--GGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS---------AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSL------QFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +EDINDN P            +  + I I EN        L  + D D+  NG  + +L   +++  L++ +   G     L      D E++D      + +D G P       +++ + D N+  P F   E   S+ EN P GS V  + ATD D           + L+ +I +++   F ++  TGLI+    P DRE +   +  V   D  + P  A VLV +   D+NDN P   +  +         + EN  + TK+   +   D+D +       +      DH++   ++PVF        +ET   LD E    + I + A D+G P     +   I V+D NDN P +        Q  IS  + E    N S  A+    + K+ A D D      + Y L  +    F L++ TG ++T V  L   K   Y     A+DNG+PPL ++A++ V V D
Sbjct:  129 IEDINDNAPLFP---------TTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRL---FHLNTTTGLITVK-EPLDREESPSHKLLVLATDGGSTPARATVLVNV--TDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKI-ALITVMDKDSEHNGRVTCFT-----DHEVPFRLRPVFS---NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFT-------QSFISLSVPE----NNSPGAQ----LTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTG-ILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLD 562          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 219.935 bits (559), Expect = 1.369e-57
Identity = 226/795 (28.43%), Postives = 365/795 (45.91%), Query Frame = 1
Query:  286 LFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPN------VDYSVTYDNKYFSIIXXXXXXKEV------IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQID--DENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELI----TLVSPLKLGTYVLKFTARDNGVP 2586
            +F + ++  +F   A Q  N ++ EE P N ++G++   L+ +  P+      + + + Y      +I       E+      ID EKLC   +         + EV +L         I   I+DINDN P F T    +SIPENS + S   +  AID D    N V++Y+   S   F +D     +     +L +QK +D E+++ Y   ++  ED          ++Q+   D NDN P F ++  E +I E+ P+G  + ++ A D D  +  +  +   S    N+  R F ++  TG + +K  LD     S  K  + A+D       S   R  V+++V DINDN P+I +     +      T+ + EN P    I L +V D+D + NGRV+C    ++    L+ V    + L +    D+E  +E  IK L    D GKP L +   + I ++D N+  P F  +    S+ EN  PG+ +  + ATD D  ++AE+ Y +       F++D +TG++ T+    DRE      F V  +D+   P  +N  V + +LD NDN P+F  +   F+V E++  K    G +  TD D  + N+ V    + + D          F I P +G I   +  DRE+  ++T  VKA D G  +R + A  TI V D+NDN+P +I P P N+      F +  P+ N   +      + K+ AID D      V Y +   N   +F + +T+G +      +VS L L   ++K  A D G P
Sbjct:    9 IFAVLLACVVFQSGA-QEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDARC--FYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGI-NGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVK-VEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYF-SNLVSNIAKRLFHLNTTTGLITVKEPLDREESPS-HKLLVLATDG-----GSTPARATVLVNVTDINDNVPSIDI---RYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEV-PFRLRPVFSNQFLLETAAFLDFESTREYAIKLL--AADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGIL-TAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLP-KHGTVGLITVTDPDYGE-NSAVTLSILDVNDQ---------FTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDP-PSNYS-----FEWVLPSTNPGTV------VFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVK--ANDLGQP 759          

HSP 2 Score: 109.383 bits (272), Expect = 2.054e-23
Identity = 126/474 (26.58%), Postives = 200/474 (42.19%), Query Frame = 1
Query: 1276 VEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVS-DRDLKENGRVSCEL--KEDLQSLELKDV--GGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS---------AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSL------QFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +EDINDN P            +  + I I EN        L  + D D+  NG  + +L   +++  L++ +   G     L      D E++D      + +D G P       +++ + D N+  P F   E   S+ EN P GS V  + ATD D           + L+ +I +++   F ++  TGLI+    P DRE +   +  V   D  + P  A VLV +   D+NDN P   +  +         + EN  + TK+   +   D+D +       +      DH++   ++PVF        +ET   LD E    + I + A D+G P     +   I V+D NDN P +        Q  IS  + E    N S  A+    + K+ A D D      + Y L  +    F L++ TG ++T V  L   K   Y     A+DNG+PPL ++A++ V V D
Sbjct:  129 IEDINDNAPLFP---------TTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRL---FHLNTTTGLITVK-EPLDREESPSHKLLVLATDGGSTPARATVLVNV--TDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKI-ALITVMDKDSEHNGRVTCFT-----DHEVPFRLRPVFS---NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFT-------QSFISLSVPE----NNSPGAQ----LTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTG-ILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLD 562          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 218.394 bits (555), Expect = 1.408e-57
Identity = 226/795 (28.43%), Postives = 365/795 (45.91%), Query Frame = 1
Query:  286 LFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPN------VDYSVTYDNKYFSIIXXXXXXKEV------IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQID--DENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELI----TLVSPLKLGTYVLKFTARDNGVP 2586
            +F + ++  +F   A Q  N ++ EE P N ++G++   L+ +  P+      + + + Y      +I       E+      ID EKLC   +         + EV +L         I   I+DINDN P F T    +SIPENS + S   +  AID D    N V++Y+   S   F +D     +     +L +QK +D E+++ Y   ++  ED          ++Q+   D NDN P F ++  E +I E+ P+G  + ++ A D D  +  +  +   S    N+  R F ++  TG + +K  LD     S  K  + A+D       S   R  V+++V DINDN P+I +     +      T+ + EN P    I L +V D+D + NGRV+C    ++    L+ V    + L +    D+E  +E  IK L    D GKP L +   + I ++D N+  P F  +    S+ EN  PG+ +  + ATD D  ++AE+ Y +       F++D +TG++ T+    DRE      F V  +D+   P  +N  V + +LD NDN P+F  +   F+V E++  K    G +  TD D  + N+ V    + + D          F I P +G I   +  DRE+  ++T  VKA D G  +R + A  TI V D+NDN+P +I P P N+      F +  P+ N         ++ K+ AID D      V Y +   N   +F + +T+G +      +VS L L   ++K  A D G P
Sbjct:    9 IFAVLLACVVFQSGA-QEKNYTVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVLDARC--FYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGI-NGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVK-VEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYF-SNLVSNIAKRLFHLNTTTGLITVKEPLDREESPS-HKLLVLATDG-----GSTPARATVLVNVTDINDNVPSIDI---RYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEV-PFRLRPVFSNQFLLETAAFLDFESTREYAIKLL--AADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGIL-TAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLP-KHGTVGLITVTDPDYGE-NSAVTLSILDVNDQ---------FTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDP-PSNYS-----FEWVLPSTN------PGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVK--ANDLGQP 759          

HSP 2 Score: 110.538 bits (275), Expect = 7.544e-24
Identity = 126/474 (26.58%), Postives = 200/474 (42.19%), Query Frame = 1
Query: 1276 VEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVS-DRDLKENGRVSCEL--KEDLQSLELKDV--GGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS---------AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSL------QFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +EDINDN P            +  + I I EN        L  + D D+  NG  + +L   +++  L++ +   G     L      D E++D      + +D G P       +++ + D N+  P F   E   S+ EN P GS V  + ATD D           + L+ +I +++   F ++  TGLI+    P DRE +   +  V   D  + P  A VLV +   D+NDN P   +  +         + EN  + TK+   +   D+D +       +      DH++   ++PVF        +ET   LD E    + I + A D+G P     +   I V+D NDN P +        Q  IS  + E    N S  A+    + K+ A D D      + Y L  +    F L++ TG ++T V  L   K   Y     A+DNG+PPL ++A++ V V D
Sbjct:  129 IEDINDNAPLFP---------TTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRL---FHLNTTTGLITVK-EPLDREESPSHKLLVLATDGGSTPARATVLVNVT--DINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKI-ALITVMDKDSEHNGRVTCFT-----DHEVPFRLRPVFS---NQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFT-------QSFISLSVPE----NNSPGAQ----LTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTG-ILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLD 562          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q24292|DS_DROME (Protein dachsous OS=Drosophila melanogaster OX=7227 GN=ds PE=1 SV=3)

HSP 1 Score: 232.261 bits (591), Expect = 3.363e-60
Identity = 199/680 (29.26%), Postives = 324/680 (47.65%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKT-FTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNL--------ISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQN-NEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSI--DRKVLKH--FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEF----MTLYDHKLIRHM-KPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYD---SGSPTRFAFANATIYVRDLNDNQPEWIYPR-PINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL----------QTNGDNMFGLNETTGELITLVSPL 2535
            ++IE++D+NDN P F  +   +S+PE+++L + +    A DKD  +  +V     ++S K  F ID        L L + +DYE    +T  + A +      ST   I++ + D NDN P F K+ Y   + ES  +  +I++V A D+D     +  Y+IV  G  N+        +S++F I P++G + L++ LD   R   ++  + A+D   +   +   +T VI+ V D NDN P          ++S +   +I+EN     ++G+ + SD DL EN  +   L     S ++  V G   ++ +  P D E  +L   + E +D G P       + IH+ DVN+  P   +  E + S+RE  PPG+ V+ VRA DRD  ++A + YSI   R    H  FSID  +G+I T  V  D E  SI +  V   D    P+    ++++E+LD+NDN P F  SSL F V+E+  +   + G ++  +R  D + N V+  F    +T   + L + + +  F I   +G +    +LDRE    + + ++A D   S +P   A     I V D+NDN PEW  P+ PI+ Q              +S+      +I    A D D    G + Y L          Q    ++F ++  TG L +L +PL
Sbjct:  864 VNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAID---ARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETR-DRYQLTVLATD---NGTPAAHAKTRVIVRVLDANDNDPKF--------QKSKY-EFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTG---EISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV-LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALG-HVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAI-TVKIEVADVNDNAPEW--PQDPIDLQ--------------VSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGAL-SLQAPL 1504          

HSP 2 Score: 177.948 bits (450), Expect = 2.128e-43
Identity = 192/708 (27.12%), Postives = 296/708 (41.81%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRTNKQIVSI---PENSDLVSIIKIEG--AIDKDFSAKNRVKSYKF--EDSTKTFTIDNSNLEDLKLFLQKS--IDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVF-KFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCEL-KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI-------------DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL----QTNGDNMFGLNETTGELITLV--SPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +I +++ D+NDN+P F   +  VS+   P+ S   S   I    A D D+    +V SY+    +    F ID S  E   +F+ +   +    Q ++   + A +     S    +V + I D     P F K  Y   + E  P G  +  V A   D    +   Y I S G+ +    YF I  ++G++ +   LD   +  V    Q +  +        V   T V I VED+NDN P          E SM      +  E    L      D+D   +G+V+  L KE  + L   D   G   + S H  DYE       +    D G PSL    TI + ++DVN+ PP F+ +EY  ++ E+    + ++ V A+D D    A + Y I                V +HF I   +G I     P DRE     Q  V   D+ T    A   V + +LD NDNDP F  S  +F ++EN++ +  + G + A+D D  + N  ++Y  + +            FQ+ P TGEI T   LDRE    + + V+A D G+P R A     I+V D+NDN PE   P     Q  +     E P             +++++A+D+D      + Y +     ++G  +F ++ T+G + T V     +   Y L   A D G PP      + V V D
Sbjct:  647 MIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQV-SYRIVAGNEAGIFRIDRSTGE---IFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYS-GDPD---GYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEP------PVYGHTQVNIEVEDVNDNAPEF--------EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHL-ILSQH-LDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLR-APLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLR-RGSVVGVVTASDLDLGE-NAAIRYSLLPI---------NSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP-----QEDVVSVREEQP---------PGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLD 1304          

HSP 3 Score: 175.252 bits (443), Expect = 1.489e-42
Identity = 195/676 (28.85%), Postives = 292/676 (43.20%), Query Frame = 1
Query:  613 IEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKF--EDSTKTFTIDNSNLEDLKLFLQKSI----DYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKEN-EPAQKLIGLSVSDRDLK-ENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKH---FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELITLVSPLKLGT-----YVLKFTARDNG 2580
            + +KD NDN P F      +  PEN+       +  A D D    N  + Y     +    F + +    D  L+L   I    D E    Y+  ++A +  T        V I I D NDN P F++  Y  T+ E+  VG  +L+V A D D  +    EY I  + +     + F+I P TG++ +   LD   +  + +  + A D  +      E    V I V D+NDN+PTI     NV+  S   + KI E+ +P + +  +SV D D K E   V+  L        L       Y +    P D E            D G P L   ++I + I DVN+ PP F+ + Y  ++ E   PG+ VL V A DRD+   + L YS+      H   F ID +TGLI+T     D E   + Q  V  +D    P ++   V + I DVNDN+P+F  S     V EN  +   +  K++A+D DC  +N  V Y     + H         F++R  +GEI     LD E+  ++   V A D G  +  A     + + D+NDN+P + YPR        SP          S  A     I+ + A D D  + G+V Y +   N   +F ++ +TGE I +V P  L       ++L  +A D G
Sbjct:  109 VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYN-TQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDK--EQMFRIDPRTGAIYINKALDFETK-ELHELVVVAKDHGEQPL---ETTAFVSIRVTDVNDNQPTI-----NVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTR-SHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCIL-KVSASDPDCG-VNAMVNYTIGEGFKHLT------EFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIK--MQLTDVNDNRPVF-YPREYKVSLRESP--------KASSQASSTP-IVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGE-IFVVRPDMLSVRTQPMHMLNISATDGG 750          

HSP 4 Score: 162.925 bits (411), Expect = 8.993e-39
Identity = 169/715 (23.64%), Postives = 320/715 (44.76%), Query Frame = 1
Query:  601 FIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLK-----------LFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHP----------YDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDR---------DKSAE---LIYSID----RKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKT--NPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDH--KLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYD-SGSPTRFAFANATIYVR--DLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQ-TNGDNMFGLNETTG--ELITLVSPL-----KLGTYVLKFTARDNGVP 2586
              I ++++D+NDN P F  ++  V++ E+  + + I    A D D     R+ +Y+  D+      ++ +  D+            ++L+  +D E ++ Y  T+ A ++ T     + ++++++ D NDN PKF K  YE  I E+   G  +  V A D+D  +     Y ++       I+  F++ P TG +  +  LD   R  ++   + A D+     ++   R  V IHV D+NDN P I     +VV      +++ +E  P  +++ +   DRD  +N  ++  +      ++ +D  G  + L+S  P           D+E+  + +      D G P  +  R + + + D+N+  P F ++  +  +RE+   G  V ++   +R         ++S E   + Y+++      +   F ID  +G +  + +  DRE+ S  + E+   D     NP+++ + VKIE+ DVNDN P +    +   V E   + T +     ATD D    N  ++Y  +  +    +       +F++   TG +     LD E    + + V+A D S + T     + T+ +R  D ND+ P ++ P     +         T ++ ISD     +++  + A+D+D  D G++ Y +   NG+  F +N  TG  EL+  + P      K G + L   A+D+G P
Sbjct:  967 LTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARI-TYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP------INSSFQVHPVTGEISTREPLDRELR-ELYDLVVEARDQGTPVRSA---RVPVRIHVSDVNDNAPEIADPQEDVV------SVR-EEQPPGTEVVRVRAVDRDHGQNASITYSI------VKGRDSDG--HGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARL-LDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIH-NFTATDADTG-TNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGK---------TASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP 1643          

HSP 5 Score: 146.747 bits (369), Expect = 6.845e-34
Identity = 152/563 (27.00%), Postives = 252/563 (44.76%), Query Frame = 1
Query:  676 IPENSDLVSIIKIEGAIDKDFSAKNRVK-SYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDL--SNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPA-QKLIGLSVSDRDLKENGRVSCELKED-----LQSLELKDVGGGFYD------LWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFF-VQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYD---HKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEW 2301
            IP  + + S+I   G    D + ++ V+ S    D    F+I+ +N  ++++   K +D+E ++     +QA           Q+ I+++D NDN P+F       ++ ES  +G  +    A D D     +  Y +V +  + L    F I   +G LIL   LD   S R ++    ++A+D       S+     +++ V+D+NDN P        V E+  + ++ + E+     ++I ++ SD D   N R++  + +        S+   DV   F        ++   P D E  D  +      D+G P+      + + + D N+  P FQ ++Y   + EN   GS V  V A+D D  ++A + YS+   +   F +   TG IST   P DRE+  +    V  +D  T  ++A V V+I + DVNDN P           V+E     T++  ++ A DRD  Q N  + Y  +   D   H L       F I PT+G I T VVLD E+   + + V A D G+P R       + V DLNDN+P +
Sbjct:  787 IPRGTVVGSVIAASG----DVAHRSPVRYSIYSGDPDGYFSIE-TNSGNIRI--AKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL----FAIDARSGHLILSQHLDYESSQRHTLI---VTATD---GGVPSLSTNLTILVDVQDVNDNPP--------VFEKDEY-SVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSL-LPINSSFQVHPVTGEISTR-EPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVV-RVRAVDRDHGQ-NASITYSIVKGRDSDGHGL-------FSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTF 1312          

HSP 6 Score: 125.561 bits (314), Expect = 2.235e-27
Identity = 165/720 (22.92%), Postives = 302/720 (41.94%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDL------------KLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV---IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVS-----KGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPT-IKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELK-DVGGGFYDLWSTHP---YDYEKEDLIKTLFECQDHGKPSLKEYRTIEIH--IEDVNEYPPGFQNNEYLGSLRENTPPGSPVL--TVRATDRDKSAELIYSIDRKVLKH-FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKD----------------------DKTNPKTANVL-VKIEILDVNDNDPVFLLSSL-QFFVQENVK---IKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSP-TRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKL---GTYVLKFTARDNG 2580
            ++ +E+ D+NDN+P F ++  +  + E++ L  ++     I++            FED   T+T+ N   +DL             L + + +D E Q+ +   ++A + +   + Q   +   I++ D NDN P++ ++  +  + E+ PVG  I    A D D       +Y+++        ++      F++   TG+L L++ LD    +  +   + A D+  +    ++    V + + D ND+ P  +   +      S+F++   +  E    ++ +   D D  +NG+++ E+         + +   G  +L  + P    D EK      +   +DHG+P  K+  ++ +H  ++  +  PP F    Y  ++ EN P GS VL  T ++    ++A L Y I   V    F +D + G+I+T    FDRE  +     V V+D                      D +N +  +V  + I + DVNDN P F   S     V EN +   I T +     A+D D +  N  + Y            ++   F I  ++GE+     LDRE++  +T+ ++A D G P +R    N TI+V D NDN P +   +     +  +P                   ++++ A+D D     R+ Y L       F ++  +G LIT V  L      +Y     A D G
Sbjct: 1297 MLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTL-NPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDF-EAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAV---DEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKK-SSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRG-QFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVV-----ASDLD-EGPNADLIYSITG-------GNLGNKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPL---------------GTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSG-LITTVGKLDRELQASYNFMVLATDGG 1979          

HSP 7 Score: 120.939 bits (302), Expect = 5.444e-26
Identity = 146/524 (27.86%), Postives = 226/524 (43.13%), Query Frame = 1
Query: 1141 TGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQ-KLIGLSVSDRDLKE---------NGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRA--TDRDKSAELIYSIDRKVL---KHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDP----VFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVV---LDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD---NMFGLNETTGELITLVSPLKLGTY---VLKFTARDNGVPPLSNDASITVHVQD 2628
            TG +  K +LD   R S     I  S +             V++ V+D NDN PT         + SM   I+  EN P + K   L   D DL+          +G V+   +  L S   +D G  + DL  +   D E       L E  D G P L+ + T+ I I+DVN+  P F  + Y  ++ EN   G+ VL V A  TD D++  + Y+I+R+     + F ID +TG I  +    D E   + +  V  KD    P      V I + DVNDN P    +FL       + E+ +   +   +++  D D        K E+  +  +  +      F +      I  ++V   LDRE   N+T++V A D G+P   A  +  + + D+NDN PE        F++     +Y     N+ ++A+    +L++ A D+DE     + Y L    +     F ++  TG LIT  S +   T     L   ARD GVPPLS+ A++ V + D
Sbjct:   76 TGEIRTKVKLDRETRASYSLVAIPLSGR----------NIRVLVTVKDENDNAPTFP-------QTSMH--IEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFR--LSSHRERD-GVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKA-LDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQ-PGEFVARISVHDPDS-------KTEYANV--NVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPE--------FEQD----LYHA---NVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTG-LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHD 550          

HSP 8 Score: 120.939 bits (302), Expect = 5.924e-26
Identity = 192/749 (25.63%), Postives = 314/749 (41.92%), Query Frame = 1
Query:  559 KFEVIILGSYSKN-----SFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKF-----------EDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQ----IVIQIDDENDNIPKF--SKESYEKT----IVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSN----RISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDL--KENGRVSCEL----KEDLQSLELKD---VGGGFYDLWSTHPY-------DYEKEDLIKTLFECQDHGKPSLKE--------YRTIEIHIEDVNEYPPGFQNNEYLG-SLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKH-FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEIL--DVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVR----DLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNM---FGLNETTGELITLVSPLKLGTYVLKF--TARDNGVPPLSN 2598
            + E+  L + + N     +  + IE+ D+NDN P +  +   + + E + + +II    A D D +  N    Y+            E +   F +D+       L LQ  +D+E    Y   +QA + S+  + + Q    + ++I D ND+ P F     S  KT    I ++  +G+ +  + A+D D     +  Y+I            F+I+  TG + L   L  +     +   F   I A D  + +    +   N+ + V+  ++N P         V R+  L     EN P+   + L V+ + L   EN  +S E+      DL  ++ +       G +D  S   Y       D  ++  + +    +     S+ +          TI I + DVN+  P F+     G S+ EN+ PG  + TV A+D D+   A+LIYSI    L + FSID+ +G +S    P DRE  S    ++   D +  PK+      I I   D NDN P F LS     VQE+  + T +  +++A D D       V         + L    +  F I   +G I T+  LDRE   ++   V A D G   R+   +AT+ V+    D+NDN       RPI F+R+  P+I + PA     + +  + +LK++A+D D      + Y L      +   F +N +TG L    S       +L     ARD G PP S+
Sbjct: 1397 RLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDAD-TGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTG---ALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEG----RFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPE--PKKSSLNLHLIVQGSHNNPPRFL----QAVYRATIL-----ENVPSGSFV-LQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSAR--PLDREQHSRYTLQIQASD-RGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVV-QISAVDADLGVNARLV---------YSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGG---RYEVRSATVPVQINVLDINDN-------RPI-FERY--PYIGQVPA-----LIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSS 2093          

HSP 9 Score: 108.612 bits (270), Expect = 2.770e-22
Identity = 106/409 (25.92%), Postives = 177/409 (43.28%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQI-VSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQ--CQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELK-DVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPP--GFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLIS 1815
            I I + D+NDN P FR      +S+PENS+   I  +  +   +    + + S    +    F+ID+S+ E       + +D E+ + YT  +QA +     S Q  C I I ++D+NDN P+F    Y  ++ E  P+G  ++++ A+D D     +  Y +      N     F I   +G +    +LD   + S + F + A+D  + +  S      V I+V DINDN+P        + ER  ++       +P Q L+ +   D DL  N  +   L  +  ++  K  +      L ++     E   L+      +D G P       IE+ I +  +  P   FQN  Y   L+EN+P G+ +L V A   D   +       KV   F   N+ G++S
Sbjct: 1780 IYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGE----LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLA-----NETQWQFAIDGQSGLITTVGKLDRELQAS-YNFMVLATDGGRYEVRSAT--VPVQINVLDINDNRP--------IFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQ-------KVQFSFGAGNEDGILS 2161          

HSP 10 Score: 106.686 bits (265), Expect = 1.192e-21
Identity = 156/596 (26.17%), Postives = 242/596 (40.60%), Query Frame = 1
Query:  922 QIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLD-LSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSV-----SDRDLKENGRVSCEL---KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPG----FQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLK----HFSIDNKTGLISTSFV--PFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKH---KLILKLKAIDQDENDAGRVCYYLQTNGDNM--FGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            ++++ + DENDN P F + S      E+ P   +   + A D+D   +N   Y IVS GN N   R        G L L  Q+    +R +   + +   + L      +     V I ++D+NDN+P          +   F T+      P    +G SV     SD D  ENG V   +   + D + +   D   G   ++     D+E ++L + +   +DHG+  L+    + I + DVN+  P     F +++    + E+  PG  V  +   D D   E  Y+     L     HF++  +   I    V  P DRE+ S     V   D  T P  A+  + + I DVNDN P F        V E     T +   L A DRD + +N+ + Y      +     H +  FQI P TG I T   +D E  P   +TV A D G P   + A   + + D+NDN+P                 I++    N+S +AE     + ILK+ A D D      V Y +     ++  F +   +GE I +   L   +  +Y     A D G   LS  A I + + D
Sbjct:  106 RVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVS-GNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLI-EALDGGTPPLRGFMTVNITIQDVNDNQPIFN-------QSRYFATV------PENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGA--IYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTE--YANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVL-AHDRD-EGLNSALTYSLAETPE----THAQ-WFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEP-----------------IFDQSFYNVS-VAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGE-ICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTD 654          

HSP 11 Score: 82.8037 bits (203), Expect = 1.920e-14
Identity = 122/546 (22.34%), Postives = 225/546 (41.21%), Query Frame = 1
Query:  559 KFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQ------IVSIPENSDLVSI---IKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSN------LEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKL---KSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIG-LSVSDRDLKENGRVSCELKEDLQS-----LELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI-----DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKI-KTKLEGKLNATDRDCDQMNNFVKYEFMTLYDH 2100
            + +VI   +  +   ++++ + D NDN P F   +       + +I E S+ +S+   +    A D D    N    Y  E + + F++  SN      +  L+  +  S DY     +   +          +   + +Q +D      +F +  Y   I E+ P+G  +L++    +D       +   +  GN        +    + +++L   LD   R  ++K ++  S           +     +VII + D NDN P        + +RS     +I E  P +  I  L   D D +EN   + E+  D+ S     +   D+  G   + +   YD   +     +  C  H +  L   +   + + D N+  P F   EY+  L EN P GS V    A+D DK    +L YSI     D    K F +D+++GL++++FV FD E    +++++ +       K A+V V++EI   ++  P F   + +F +   V + +  + G++ ATD D    +  V Y+    + H
Sbjct: 2449 ELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDY-----FVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALD-------QSLAIIAGNEESAFELLQ----SKAIVLVKPLD-RERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP--------IFDRSAKYEAEISELAPLRYSIAQLQAIDAD-QEN-TPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFV-FDYEQR--QRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGP-DGRVVYQLSAPHSH 2963          

HSP 12 Score: 80.8777 bits (198), Expect = 7.976e-14
Identity = 90/376 (23.94%), Postives = 161/376 (42.82%), Query Frame = 1
Query: 1546 IKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI-DRKVLKHFSIDNK-TGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKL---ILKLKAIDQD-ENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLK-----LGTYVLKFTARDNGVPPLSNDASITVHVQDNG 2634
            I+ +   +    P L  Y  + I +ED N+  P F   +++ ++ E    G+ V  V A D D    A L Y I D      F I+   +G++ T+ V  DRE+  I + ++   D+     T    ++++I+DVNDN P F  ++L       V +    E     T    + ++ +    +    +  +      +F +   +G++     LD E    + + V A D+    R      T+ V D NDN P ++  +P         +    PAI  S+I+E   +   +L + A D D E +  +V Y ++   +  F ++ + G +   +S L+      G Y ++  A+D G P L +   + V   DNG
Sbjct: 2235 IRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIV-LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-------VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVL---TVRVNDENDNAPVFLAQQP-------PAYFAILPAI--SEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG-FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNG 2589          

HSP 13 Score: 73.9442 bits (180), Expect = 1.084e-11
Identity = 138/606 (22.77%), Postives = 250/606 (41.25%), Query Frame = 1
Query:  577 LGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTK--TFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDS----TGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLIS-RYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQ-KLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGF--YDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNP------KTANVLVKIEILDVNDNDPVFLLSS-LQFFVQENVKIKTKLEGKLNATDRDCDQM-NNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKY----PNWTITVKAYDSGSPTRF-AFANATIYVRDLNDNQPEWIYPRPINF 2325
            L SY++    + IE++D NDN P F   + + ++ E ++  + +    A D D  +  R++ Y   D      F I+ +    ++  +   +D E +++Y   + A ++     TG +T   I +QI D NDN P F   +   T+ E+  +G  I  + A D+D   +    Y++ ++   ++ +   F +   +G L+LK +LD   +   ++  + ASD         E RT + + V D NDN P             +    +I E+      L+ ++ +D D + N      + E  Q         G    ++    P      D    +   +D GKP+LK    + +   D       F  N+Y   + E  P GS VL +     D+S  +I   +      F +     ++     P DRE   + +  + +      P       ++ + V I ILD NDN P+F  S+  +  + E   ++  +  +L A D D +   N+ V Y+  +  D     HM   F I   TG    L V +R  Y     ++ + ++A DS       +     + + D NDN+P++     ++F
Sbjct: 2249 LASYAE----LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLR-YHIVDGNHDNAFVIEPAFSGIVRTNI--VLDREIRDIYKLKIIATDEGVPQMTGTAT---IRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQ-QEYELDVIASDAAH------EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRII-AKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESA---FELLQSKAIVLVK--PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSI-AQLQAIDADQENTPNSEVVYDITSGNDE----HM---FTIDLVTG---VLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHF 2817          

HSP 14 Score: 70.8626 bits (172), Expect = 8.904e-11
Identity = 128/568 (22.54%), Postives = 240/568 (42.25%), Query Frame = 1
Query:  895 DSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRI-SVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDL--KENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTI-EIHIEDVNEYPPGFQNNE---------YLGSLRENTPPGSPVLTVRATDRDK---SAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNV--KDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKT-KLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTIT-VKAYDSGSPTRFAFANAT-----IYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDA--GRVCYYLQT-NGDNMFGLNETTGEL 2514
            D+   ++  ++VI+++DENDN PKFS++ +  T+ E    G  + +V A D D     +  Y IV   + N     F I P   S I+++ + L   I  ++K +I A+D+   + T       + + + D+NDN+PT      N+V  S       +  E    +  +S +D D       R+  E   D++++ +  +      L      DYE    ++  +E       +  E RT+  + + D N+  P F   +          +  + E+      +LTV ATD D    ++++IY I+    + FS+    G++S +       ++S   + V +  KD       ++ L++++  D       FL +  +  + E   + +  L+   +A D+    +    +  F  L   K I  +KP                LDRE+   + +  V ++  G P   +  +++     I + D NDN P  I+ R   ++              IS++A     I +L+AID D+ +     V Y + + N ++MF ++  TG L
Sbjct: 2245 DAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNA----FVIEP-AFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGT---ATIRVQIVDVNDNQPTFP--PNNLVTVS-------EATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYE----LQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIE-PAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAF-ELLQSKAIVLVKP----------------LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP--IFDRSAKYE------------AEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVL 2759          

HSP 15 Score: 66.2402 bits (160), Expect = 2.698e-9
Identity = 79/309 (25.57%), Postives = 127/309 (41.10%), Query Frame = 1
Query: 1732 DKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMN----NFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL---QTNGDNMFGLNETTGELITLVSPLKLGT---YVLKFTARDNGVPPLSNDASITVHVQD 2628
            D     I   +  V    +ID  TG I T  V  DRE  +           +      N+ V + + D NDN P F  +S+     EN   + K    L A D D +  N    N V       +     R    V  +     +++    LDRE  P +++ ++A D G+P    F    I ++D+NDNQP +      N  R+ +  + E   +  S        +L++ A D D ++ G V Y +   Q++ + MF ++  TG  I +   L   T   + L   A+D+G  PL   A +++ V D
Sbjct:   53 DSGPPYIIVAEAGVETDLAIDRATGEIRTK-VKLDRETRASYSLVAIPLSGR------NIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVK-RTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYL-----DLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIF------NQSRYFA-TVPENATVGTS--------VLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGA-IYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTD 332          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 2.904e-58
Identity = 248/878 (28.25%), Postives = 390/878 (44.42%), Query Frame = 1
Query:  286 LFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPN------VDYSVTYDNKYFSIIXXXXXXKEV------IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQID--DENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVP--------------------PLSND---ASITVHVQDNGRFANIN------LTIIIGMIAITVSISVFL-IVAIICVRRQPRFQ 2748
            +F + +   +F+  A Q  N +I EE P N ++GN+   L+ +  PN      + + + Y      +I       E+      ID EKLC             + EV IL         I   I+DINDN P F      +SIPENS + S   +  A+D D    N V++Y+   S   F +D     +     +L +QK +D E+++ Y   ++  ED          ++Q+   D NDN P F +   E +I E+ PVG  + ++ A D D  +  K  +   S    N+  R F ++  TG + +K  LD     +  K  + ASD        +  R  V+++V D+NDN P+I +     +   +  T+ + EN P    I L +V+D+D   NGRV+C    ++    L+ V    + L +    DYE  KE  IK L    D GKP L +   + I ++D N+  P F  +    S+ EN  PG  ++ V ATD D    AE+ Y +       FS+D +TG++ T     DRE      F +  KD+   P T+NV V + I+D NDN PVF  +  +F+V EN+  +    G +  TD D    N+ V    +   D          F I   TG I   +  DREK  ++T  VKA D G  +R + A  TI V D+NDN+P +I P P N+   +       P+ N   +      + ++ A+D D      V Y +   N  ++F +++ TG  ITL+       LG + +   A D G P                     L N+    SI   V  N   A+++      + I++  +A T+++ V + I A++  R+ P  +
Sbjct:   41 IFAVLLVCVVFHSGA-QEKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC--FYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGI-NGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKV-EDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSF-SNLVSNIARRLFHLNATTGLITIKEPLDREETPN-HKLLVLASDG-----GLMPARAMVLVNVTDVNDNVPSIDI---RYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI-PFRLRPVFSNQFLLENAAYLDYESTKEYAIKLL--AADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGML-TVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLP-RHGTVGLITVTDPDYGD-NSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP-PYNYSYELV-----LPSTNPGTV------VFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGN-ITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVVRCRQAPHLK 875          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 222.631 bits (566), Expect = 1.060e-57
Identity = 216/708 (30.51%), Postives = 329/708 (46.47%), Query Frame = 1
Query:  499 IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQT-NGDNMFGLNETTGELITL---VSPLKLGTYVLKFTARDNGVP 2586
            ID EKLC       E+ C  + EV+IL +       I I +KD NDN P F +    +SIPEN+ + S   I  A D D +  N V+ Y+  +    F +D     +     +L +Q+++D E+++ Y   ++  +  T   +   I+ + + D NDN P F +   E  I E+ PVG  ++++ A D D     +  Y I          R F ++  TG + ++  LD     ++ K  + ASD      +S   R  V I+V D+NDN P I +     +   +  T+ + E +P    I L +VSD+D   NG+V C ++ ++    LK V    Y L ++   DYE            D GKPSL +   + + +ED N+ PP F       S+ EN   G  + T+ ATD D  K+A+++Y +       F +D KTG+++ S V FDRE      F V  +D+ T P  +   V + +LD NDN P F  +  QFFV EN+  K    G +  TD D  + N  V    +   D+         F + P +G I++ V  DRE+  ++T  VKA D G P R + A  TI V D+NDN P  I P P N    + P      AI  S +AE       + A+D D      + Y + + N   +F ++  TG  ITL    +P  +G + L     D G P
Sbjct:   92 IDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRY-IFGAQVAPATKRLFALNNTTGLITVQRSLD-REETAIHKVTVLASDG-----SSTPARATVTINVTDVNDNPPNIDL---RYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA-SFFDLDRKTGVLTASRV-FDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLP-KYSTVGVITVTDADAGE-NKAVTLSILNDNDN---------FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISP-PSNTSFKLVPL----SAIPGSVVAE-------VFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGN-ITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 118.242 bits (295), Expect = 2.614e-25
Identity = 147/550 (26.73%), Postives = 236/550 (42.91%), Query Frame = 1
Query: 1078 YKIVSK-GNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSK-FTSVE---------DRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDV----GGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVL----KHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDP----VFLLSSLQ--FFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGR---VCYYLQTNGDNMFGLNETTGELIT--LVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            Y++VSK G+  L+    K+S  TG +   S     NRI   K    AS   +++ F  +E             + I V+D NDN P            S  + I I EN        + S +D D   NG    EL        L  V    G  +  L      D E++D      + +D G P       +++ + DVN+  P F+  +    + EN P G+ V+ + ATD D   +AE+ Y    +V     + F+++N TGLI+      DRE T+I +  V   D  + P  A   V I + DVNDN P     +++S +    ++ E   + TK+   +  +D+D D     V  + +   + ++  H+K V+  +     +ET  +LD E    ++  + A DSG P+    A   + + D NDN P                 I+  P I +S ++E ++  L L  I   + D+G+   + Y L  N  + F L+  TG L    +    +   ++   TARDNG PPL + A++ V V D
Sbjct:   64 YRLVSKAGDAPLV----KVSSSTGEIFTTS-----NRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFP---------SPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRS-LDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKI-ALITVSDKDTD-----VNGKVICFIEREVPFHLKAVYDNQYL---LETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPP-----------------IFNQPVIELS-VSENNRRGLYLTTISATDEDSGKNADIVYQLGPNA-SFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD 564          

HSP 3 Score: 89.3521 bits (220), Expect = 1.846e-16
Identity = 141/594 (23.74%), Postives = 243/594 (40.91%), Query Frame = 1
Query:  922 QIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDT---GSLILKSQLDLSNRIS-VFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRV----SCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGS-------LRENTPPGSPV--LTVRATDRDKSAELIYSIDRKVLKHFSI--DNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKP---VFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVS--PLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +I I + D NDN P F       +I E+  +        A D D   FN  ++  +  G +++       +P+      LI++  LD   + + V K ++      +   T++     + + V D+NDN+P  K   G V        + I EN P    +I L  +D D+  N  +      ++    + L   +   G   +  +   D E+  + K      D    S     T+ I++ DVN+ PP   +  Y+ S       L E  P  + +  +TV   D D + ++I  I+R+V  H     DN+  L ++S +  D E T    F++   D          LV++++ D NDN P+F    ++  V EN +    L   ++ATD D  +             +  ++  + P    F +   TG +    V DRE+   +  TV A D+G+P   + A   + V D NDN P++ +        H   F+ E           K+  +  +   D D  +   V   +  + DN F L+  +G + + VS    +  +Y     A D G PP S+ A +T++V D
Sbjct:  127 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDT-GFNGVQHYELLNG-QSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAI-----LQVTVSDVNDNRPVFK--EGQV-------EVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRS--LDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNI-DLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLL--DYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLT-TISATDEDSGK-------------NADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH-------NHFQFFVSEN--------LPKYSTVGVITVTDADAGENKAVTLSILNDNDN-FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD 667          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 1.092e-57
Identity = 248/878 (28.25%), Postives = 389/878 (44.31%), Query Frame = 1
Query:  286 LFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPN------VDYSVTYDNKYFSIIXXXXXXKEV------IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQID--DENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVP--------------------PLSND---ASITVHVQDNGRFANIN------LTIIIGMIAITVSISVFL-IVAIICVRRQPRFQ 2748
            +F + ++  +F+  A Q  N +I EE P N ++G++   L+ +  PN      + + + Y      +I       E+      ID EKLC             + EV IL         I   I+DINDN P F      +SIPENS + S   +  A+D D    N V++Y+   S   F +D     +     +L +QK +D EK++ Y   ++  ED          ++Q+   D NDN P F +   E +I E+ PVG  + ++ A D D  +  K  +   S    N+  R F ++  TG + +K  LD     +  K  + ASD        +  R  V+++V D+NDN P+I +     +   +  T+ + EN P    I L +V+D+D   NGRV+C    ++    L+ V    + L +    DYE  KE  IK L    D GKP L +   + I ++D N+  P F  +    S+ EN  PG  +  V ATD D    AE+ Y +       FS+D +TG++ T     DRE      F +  KD+   P T+NV V + I+D NDN PVF  +   F+V EN+  +    G +  TD D    N+ V    +   D          F I   TG I   +  DREK  ++T  VKA D G  +R + A  TI V D+NDN+P +I P P N+   +       P+ N   +      + ++ A+D D      V Y +   N  ++F +++ TG  ITL+       LG + +   A D G P                     L N+    SI   V  N   A+++      + I++  +A T+++ V + I A++  R+ P  +
Sbjct:    9 IFAVLLACVVFHSGA-QEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC--FYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGI-NGVQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKV-EDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSF-SNLVSNIARRLFHLNATTGLITIKEPLDREETPN-HKLLVLASDG-----GLMPARAMVLVNVTDVNDNVPSIDI---RYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI-PFRLRPVFSNQFLLETAAYLDYESTKEYAIKLL--AADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGML-TVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLP-RHGTVGLITVTDPDYGD-NSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP-PSNYSYELV-----LPSTNPGTV------VFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGN-ITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTNDYVKILVAAVAGTITVVVVIFITAVVRCRQAPHLK 843          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.034e-56
Identity = 246/878 (28.02%), Postives = 387/878 (44.08%), Query Frame = 1
Query:  286 LFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPN------VDYSVTYDNKYFSIIXXXXXXKEV------IDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQID--DENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVP--------------------PLSND---ASITVHVQDNGRFANIN------LTIIIGMIAITVSISVFL-IVAIICVRRQPRFQ 2748
            +F + ++  +F+  A Q  N +I EE P N ++G++   L+ +  PN      + + + Y      +I       E+      ID EKLC             + EV IL         I   I+DINDN P F      +SIPENS + S   +  A+D D    N V++Y+   S   F +D     +     +L +QK +D E+++ Y   ++  ED          ++Q+   D NDN P F +   E +I E+ PVG  + ++ A D D  +  K  +   S    N+  R F ++  TG + +K  LD        K  + ASD        +  R  V+++V D+NDN P+I +     +   +  T+ + EN P    I L +V+D+D   NGRV+C    ++    L+ V    + L +    DYE  KE  IK L    D GKP L +   + I ++D N+  P F  +    S+ EN  PG  +  V ATD D    AE+ Y +       FS+D +TG++ T     DRE      F +  KD+   P T+NV V + I+D NDN PVF  +   F+V EN+  +    G +  TD D    N+ V    +   D          F I   TG I   +  DREK  ++T  VKA D G  +R + A  TI V D+NDN+P +I P P N+   +       P+ N   +      + ++ A+D D      V Y +   N  ++F +++ TG  ITL+       LG + +   A D G P                     L N+    S    V  N   A+++      + I++  +A T+++ V + I A++  R+ P  +
Sbjct:    9 IFAVLLACVVFHSGA-QEKNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC--FYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDV-GTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKV-EDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSF-SNLVSNIARRLFHLNATTGLITIKEPLD-REETPNHKLLVLASDG-----GLMPARAMVLVNVTDVNDNVPSIDI---RYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEI-PFRLRPVFSNQFLLETAAYLDYESTKEYAIKLL--AADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGML-TVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLP-RHGTVGLITVTDPDYGD-NSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP-PSNYSYELV-----LPSTNPGTV------VFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGN-ITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVVRCRQAPHLK 843          
BLAST of Protocadherin vs. TrEMBL
Match: W6UEM3 (Protocadherin OS=Echinococcus granulosus OX=6210 GN=EGR_08610 PE=4 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 2.440e-101
Identity = 332/1125 (29.51%), Postives = 509/1125 (45.24%), Query Frame = 1
Query:  340 FNLSINEETPINSVVGNIQNFLSNNFYPNVDYSVTYDNKYFSIIXXX--XXXKEVIDLEKXXXXXXXXXXXXXVIKFEVI-ILGSYSKNSFI---ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTS-VEDRTNVIIHVEDINDNKPTIKVL-AGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLK------------------------HFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPK-TANVLVKIEILDVNDNDPVFL--------------LSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLI---------------------RHM--KPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY-YLQTNGDNM-----------------------------------FGLNETTGELITL--VSPLKLGTYVLKFTARDNG-VPPLSNDASITVHVQ-DNGRFAN---------INLTIIIGMIAITVSISVFLIVAIICVRRQP---------------RFQKYIPPSSGVKNDSGNPYCNPKHWN------YHTEENPLPPDNESFVFLPPS--------YCSSPHPDQLTMQVINNSRPASRMDYHLSLPSSNTYNIIESSNGSQTAQNVERLNGTLRSNNGFYGTNIPNSMGIIINGQ-ELDGDSADSGKGASEVD---LRLQHQFNLGNRNYPTMPFPHYSTATTS 3258
             N  I+EET +NS +G+I++ +    Y        Y   +F++ + +  V VK V+D E LC +   C   +     E + ++ + ++N      + +++ DINDNKP F ++ Q VSIPENS++   I +  A D D   +N+V  Y++ ++T+TF++D ++L  ++L L   +D E ++ Y+G L AC D   C T   ++I+I+D NDN+P+  K  Y   I ES  VG  IL + A D D  +  +  Y      + +L+   F+I  +TG + L+  LD   R S ++F ++A D + S+  S      +V + V+D+NDNKP I+++ AG  V  S  L +   EN     +  + V D D+ EN R +CEL +   + EL     G Y L +   +D+E+E ++ T+  C+D G PSL   + I + I DVNEYPP FQ +E+  S+ EN+PPG  V+++ A DRD  +EL YS+    L+                        +F +D KTG++ TS V  DRE+       V V D  T P  TA   V IE+LD NDN PVF+              L S  F ++EN    + L G+L A D D DQ N  +++   +++  K +                     R +  + +FQI P  G+IETLV  DRE    + + V   D+GS       +  + + D NDN PEW +P     Q            INI+  +    L+ +L+A D D +DAG+V +  L  NG  M                                   F LN +TGE++    + PL L    ++  A D G    L  D  + ++V+ D   F           +N+TII+ MIA+T  IS+ LI+AI+CVRR+P               R   Y P S  +  D          W       Y      LP D     +  P         +C  P  D +               Y L  P+ +  +     +   T     R  G L S  G       ++ GI + G  + D DS DSG+G SE     + L++Q  +GN         ++STA  S
Sbjct:    1 MNFEIHEETEVNSTIGSIRDVVPT--YSGTKTVFIYTGDFFNVDSQSGEVKVKTVLDRESLCQEHKQCCGTVNCTLTETVYVINAQTRNLMTPMHLRVKVNDINDNKPIFASSIQRVSIPENSEVGKSIGLRPATDADVDPRNKVTRYQWSEATETFSLDQTSLPAIRLRLNSPVDREVRSNYSGVLSAC-DIHSC-TSTDVLIEIEDVNDNLPQLYKRRYGLEISESLAVGSTILHMNATDRDSAENARIFYSFREPVDPDLVD-TFEIVANTGEIRLRRPLDAKIR-SSYEFSVTACDTVASECASNPTSNADVEVVVKDVNDNKPIIEIVPAGESVSSSDDLVVP--ENYLPGHIAVVRVKDADIGENSRTTCEL-DSHTTFELSHSAPGLYSLRTLRSFDFEQESILTTIIRCRDFGSPSLSSTQIITLRILDVNEYPPEFQMHEFKASVSENSPPGVEVISLNAVDRDGQSELSYSLAPPPLQQGASEDFYGVGSLPNTFETLGVNAYFDLDPKTGVLRTSRVQLDREVIERITLVVTVTDALTEPIFTATATVSIEVLDENDNSPVFVNPPANIGLPFDQNDLKSHTFTIRENAPRYSHLSGRLEARDPDADQ-NGQLQFSLRSVWALKSVAGSAGHSSGNIFDDLSGTSPGRQLVEQRIFQITP-DGDIETLVEFDRELVAMYLLNVAVRDNGSQPLATSTSLLVRILDENDNAPEWTFPTESARQ------------INITTASPPGSLVARLQAFDVDADDAGKVEFQVLDLNGQPMPPVSISRGLYNAPAQSPRLTSTVVQEELMGYRTGPFYLNGSTGEILVADRLVPLNLK---IRLRAIDCGHAQRLFTDTWMAINVKMDPNEFGGFLGGGRTGALNVTIILVMIAVTAIISLLLIIAIVCVRRKPGRAVVGNGTAVEPEGRVVAYSPGSPFLTTDPSKEALTTNTWTGLSKDFYPPLPGGLPVDENGRSYGSPLLGSDKTSIFCGVPPQDSM---------------YTLLEPNEDIISGTLPLHTFGTMSRNSRQAGILASIQG-------STTGIRMAGSLQYDADSGDSGRGPSEDGNQLMMLENQREVGN---------YWSTAEVS 1068          
BLAST of Protocadherin vs. TrEMBL
Match: A0A068WWV1 (Protocadherin 9 OS=Echinococcus granulosus OX=6210 GN=EgrG_000056500 PE=4 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 5.519e-100
Identity = 328/1107 (29.63%), Postives = 505/1107 (45.62%), Query Frame = 1
Query:  301 ISIFIFNCHAN-QI-FNLSINEETPINSVVGNIQNFLSNNFYPNVDYSVTYDNKYFSIIXXX--XXXKEVIDLEKXXXXXXXXXXXXXVIKFEVI-ILGSYSKNSFI---ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTS-VEDRTNVIIHVEDINDNKPTIKVL-AGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLK------------------------HFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPK-TANVLVKIEILDVNDNDPVFL--------------LSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLI---------------------RHM--KPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY-YLQTNGDNM-----------------------------------FGLNETTGELITL--VSPLKLGTYVLKFTARDNG-VPPLSNDASITVHVQ-DNGRFAN---------INLTIIIGMIAITVSISVFLIVAIICVRRQP---------------RFQKYIPPSSGVKNDSGNPYCNPKHWN------YHTEENPLPPDNESFVFLPPS--------YCSSPHPDQLTMQVINNSRPASRMDYHLSLPSSNTYNIIESSNGSQTAQNVERLNGTLRSNNGFYGTNIPNSMGIIINGQ-ELDGDSADSGKGASE 3168
            + + +   HA+ QI  N  I+EET +NS +G+I++ +    Y        Y   +F++ + +  V VK V+D E LC +   C   +     E + ++ + ++N      + +++ DINDNKP F ++ Q VSIPENS++   I +  A D D   +N+V  Y++ ++T+TF++D ++L  ++L L   +D E ++ Y+G L AC D   C T   ++I+I+D NDN+P+  K  Y   I ES  VG  IL + A D D  +  +  Y      + +L+   F+I  +TG + L+  LD   R S ++F ++A D + S+ +S      +V + V+D+NDNKP I+++ AG  V  S  L +   EN    ++  + V D D+ EN R +CEL +   + EL     G Y L +   +D+E+E ++ T+  C+D G PSL   + I + I DVNEYPP FQ +E+  S+ EN+PPG  V+++ A DRD  +EL YS+    L+                        +F +D KTG++ TS V  DRE+       V V D  T P  TA   V IE+LD NDN PVF+              L S  F ++EN    + L G+L A D D DQ N  +++   +++  K +                     R +  + +FQI P  G+IETLV  DRE    + + V   D+GS       +  + + D NDN PEW +P     Q            INI+  +    L+ +L+A D D +DAG+V +  L  NG  M                                   F LN +TGE++    + PL L    ++  A D G    L  D  + ++V+ D   F           +N+TII+ MIA+T  IS+ LI+AI+CVRR+P               R   Y P S  +  D          W       Y      LP D     +  P         +C  P  D +               Y L  P+ +  +     +   T     R  G L S  G       ++ GI + G  + D DS DSG+G SE
Sbjct:    7 VLLLLTAVHASSQISMNFEIHEETEVNSTIGSIRDVVPT--YSGTKTVFIYTGDFFNVDSQSGEVKVKTVLDRESLCQEHKQCCGTVNCTLTETVYVINAQTRNLMTPMHLRVKVNDINDNKPIFASSIQRVSIPENSEVGKSIGLRPATDADVDPRNKVTRYQWSEATETFSLDQTSLPAIRLRLNSPVDREVRSNYSGVLSAC-DIHSC-TSTDVLIEIEDVNDNLPQLYKRRYGLEISESLAVGSTILHMNATDRDSAENARIFYSFREPVDPDLVD-TFEIVANTGEIRLRRPLDAKIR-SSYEFSVTACDTVASECSSNPTSNADVEVVVKDVNDNKPIIEIVPAGESVSSSDDLVVP--ENYLPGQIAVVRVKDADIGENSRTTCEL-DSHTTFELSHSAPGLYSLQTLRSFDFEQESILTTIIRCRDFGSPSLSSTQIITLRILDVNEYPPEFQMHEFKASVSENSPPGVEVISLNAVDRDGQSELSYSLAPPPLQQGASEDFYGVGSLPNTFETLGVNAYFDLDPKTGVLRTSRVQLDREVIERITLVVTVTDALTEPIFTATATVSIEVLDENDNSPVFVNPPANIGLPFDQNDLKSHTFTIRENAPRYSHLSGRLEARDPDADQ-NGQLQFSLRSVWALKSVAGSAGHSSGNIFDDLSGTSPGRQLVEQRIFQITP-DGDIETLVEFDRELVAMYLLNVAVRDNGSQPLATSTSLLVRILDENDNAPEWTFPTESARQ------------INITTASPPGSLVARLQAFDVDADDAGKVEFQVLDLNGQPMPPVSISRGLYNAPAQSPRLTSTVVQEELMGYRTGPFYLNGSTGEILVADRLVPLNLK---IRLRAIDCGHAQRLFTDTWMAINVKMDPNEFGGFLGGGRTGALNVTIILVMIAVTAIISLLLIIAIVCVRRKPGRAVVGNGTAVEPEGRVVAYSPGSPFLTTDPSKEALTTNTWTGLSKDFYPPLPGGLPVDENGRSYGSPLLGSDKTSIFCGVPPQDSM---------------YTLLEPNEDIISGTLPLHTFGTMSRNSRQAGILASIQG-------STTGIRMAGSLQYDADSGDSGRGPSE 1065          
BLAST of Protocadherin vs. TrEMBL
Match: A0A087VXD3 (Protocadherin 9 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000056500 PE=4 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 3.265e-98
Identity = 291/919 (31.66%), Postives = 443/919 (48.20%), Query Frame = 1
Query:  340 FNLSINEETPINSVVGNIQNFLSNNFYPNVDYSVTYDNKYFSIIXXXXXXK--EVIDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIK----DINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTS-VEDRTNVIIHVEDINDNKPTIKVL-AGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLK------------------------HFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPK-TANVLVKIEILDVNDNDPVFL--------------LSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLI---------------------RHM--KPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY-YLQTNGDNM-----------------------------------FGLNETTGELITL--VSPLKLGTYVLKFTARDNG-VPPLSNDASITVHVQ-DNGRFAN---------INLTIIIGMIAITVSISVFLIVAIICVRRQP 2739
             N  I+EET +NS +G+I++ +    Y        Y   +F++ + +  VK   V+D E LC +   C   +     E + + +    +F+  ++++    DINDNKP F ++ Q VSIPENS++   I +  A D D   +N+V  Y++ + T+TF++D ++L  ++L L   +D E ++ Y+G L AC D   C T   ++I+I+D NDN P+  K  Y   I ES  VG  IL V A D D  +  +  Y      + +L+   F+I  +TG + L+  LD   R S ++F ++A D + S+  S      +V + V+D+NDNKP I+++ AG  V  S  L +   EN    ++  + V D D+ EN R +CEL +   + EL   G G Y L +   +D+E+E ++ T+  C+D G PSL   + I + I DVNEYPP FQ  ++  S+ EN+PPG  V+++ A DRD  +EL YS+    L+                        +F +D KTG++ TS V  DRE+       V V D  T P  TA   V IE+LD NDN PVF+              L S  F V+EN    + L G+L A D D DQ N  +++   +++  K +                     R +  + +FQI P  G IETLV  DRE    + + V   D+GS       +  + + D NDN PEW +P     Q            INI+  +    L+ +L+A D D +DAG+V +  L  NG  M                                   F LN +TGE+I    + PL L    ++  A D G    L  D  + ++V+ D   F           +N+TII+ MIA+T  IS+ LI+AI+CVRR+P
Sbjct:   22 INFEIHEETEVNSTIGSIRDVVPT--YSGTKTVFIYTGDFFNVDSQSGEVKVKTVLDRESLCQEHKQCCGTVNCTLTETVYVINAQTRNFMTPVQLRVKVNDINDNKPIFASSIQRVSIPENSEVGKSIGLRPATDADVDPRNKVTRYQWSEVTETFSLDQTSLPAIRLRLNSPVDREVRSNYSGVLSAC-DIHSC-TSTDVLIEIEDVNDNSPQLYKRRYGLEISESLAVGSTILHVNATDRDSAENARIFYSFREPVDPDLVD-TFEIVANTGEIRLRRPLDAKIR-SSYEFSVTACDTVASECASNPTSNADVEVVVKDVNDNKPIIEIVPAGESVSSSDDLVVP--ENYLPGQIAVVRVKDADIGENSRTTCEL-DSHTTFELSHSGTGLYSLRTLRSFDFEQESILTTIIRCRDFGSPSLSSTQIITLRIFDVNEYPPEFQMRKFKASVSENSPPGVEVISLNAVDRDGQSELSYSLAPPPLQQGARENLYGVESLPNTFETLSFNAYFDLDPKTGVLRTSRVQLDREVIERITLVVTVTDALTEPIFTATATVSIEVLDENDNSPVFVNPPPNIGLPFDQNDLQSHTFTVRENAPRYSHLSGRLEARDPDADQ-NGQLQFSLRSVWALKSVADSVGHSSGNIFDDLSGTSPGRQLVEQRIFQITPDGG-IETLVEFDRELVAMYLLNVAVRDNGSQPLATSTSLLVRILDENDNAPEWTFPTESARQ------------INITTASPPGSLVARLQAFDVDADDAGKVEFQVLDLNGQPMPPVSTSRSLYNTPAQPSRLTSTVVQEELMGYRTGPFYLNGSTGEIIVADRLVPLNLK---IRLRAIDCGQAQRLFTDTWMIINVKMDPNEFGGFLGGGRTGALNVTIILVMIAVTAIISLLLIIAIVCVRRKP 914          
BLAST of Protocadherin vs. TrEMBL
Match: A0A4Z2DTR8 (Protocadherin-1 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_005628 PE=4 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 3.658e-92
Identity = 279/925 (30.16%), Postives = 440/925 (47.57%), Query Frame = 1
Query:  337 IFNLSINEETPINSVVGNIQNFLSNNFYPNVDYSVTYDNKYFSIIXXXXXXK-EVIDLEKXXXXXXXXXXXXXVIKF--EVIILGSYSKNSFII--SIEIKDINDNKPYFRT-NKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFE--DSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVE-----------DRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKED----------------LQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLIST-------------SFVPFDREMTSIKQFEVNVKDDK----------------------------TNPK--------TANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFA-NATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELITL----------------------VSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANI--NLTIIIGMIAITVSISVFLIVAIICVRRQPRFQKYIPPSSGVKN 2781
            I  L I+EE+P+++ +GNI ++L +         +T D+ +F++  N ++     +DLE LC +   C E     +    V+I G  S+   ++  +I I+DIND+ P F + N QIV I E +++ S + +  A D D +  N+++ Y     +  +TF +D S+L +++L L + +DYE    Y+G ++AC D   C+ Q  + I + D NDN P F + SYE TI E+F VG+ +L + AID D     + ++++    + NL  + F++   +G LIL+S+L    R S ++F ++ S+ L S+  S++           D  NVII V+D+ND  P+I++++    +      + I+EN    ++  L V+D DL +NGRV C L  +                  S EL   G   Y L +T  +D E E  +     C D+G P     R + I +EDVNEYPP  +   Y  S+ EN   G  V+ V A DRD++A+L Y +  +  ++F+ID  TG+I+T             SF   DRE T    F V V D                               NP         TA+  + + +LDVNDN P F+     F + EN    T++ G+L A D D  + N  V+Y    ++          VF++  + G+I T+ V+DRE+   +T+ + A DS          N TI V D NDN+PEW YP   + +            +NI+      +++ ++ A+D D  + GRV Y L   +   +F ++  TGE+  +                       +PL  G Y L+  A D G P  + +  + V+V  +    N+  N  III MIAIT  ISV L+VAIICVRR+   Q   P      N
Sbjct:   27 IVKLKIDEESPLHTTLGNISSYLFSQ------SKITSDSIFFTVTQNGLIQLIRRLDLETLCLEQALCCEHNKPCELTSNVVIEGVNSEELELVELNILIQDINDHVPQFISGNNQIVKISELAEIGSTLNLMPASDADLAPDNQIQRYAIHGVELQQTFELDTSDLPNVRLRLTQPLDYELTTNYSGIIEAC-DRRQCAQQ-NLTILVIDANDNKPMFVQHSYELTIPENFSVGQTVLVLNAIDKDSELNARMDFRLQGDVDMNL-KKTFRLDSHSGHLILQSRLAAHQR-SEYRFSVTVSEVLSSQVQSIDALSSRIPVTSTDTANVIITVQDLNDFSPSIRMISPMEGKH-----LSIQENSAHVRVCVLQVTDNDLHDNGRVQCRLVANSFEPSSSTSDSHNSTSTDSFELTQTGN-HYTLLTTRSFDAELEPQLTVTIACTDYGVPPRSSSRELMIQVEDVNEYPPELERINYHASIMENVKSGIEVMQVVAHDRDQAAKLTYELSNEGKQYFTIDPITGVITTLGGDEKDENGNLLSFSLLDREKTEKITFSVCVTDGTPTNGCGLIALDHHSTMNNKEREKHSQQPANPLGDISRPVFTASATIFVTVLDVNDNQPQFITKG-PFSILENQPRFTQINGRLTALDADAGE-NGHVRYSIRHIWISATGIPSPDVFEVD-SEGQIRTMEVMDREQINAYTLEIVACDSAPLNPLCTELNITITVLDENDNKPEWHYPHARDKE------------VNITSDLPPGRVVARILAMDLDTGENGRVIYSLIDPHKRTVFQIDNITGEISVVKNNLNELGQNGDGTYILDDSIHSTPLLPGVYRLRLRASDMGHPEQATETWLQVNVFGSDSITNVGLNFMIIIVMIAITGLISVCLVVAIICVRRRSSLQWNRPQGHAQTN 920          
BLAST of Protocadherin vs. TrEMBL
Match: A0A3Q0KTJ1 (Putative cadherin OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 9.485e-92
Identity = 261/880 (29.66%), Postives = 395/880 (44.89%), Query Frame = 1
Query:  598 SFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRT-NVIIHVEDINDNKPTIKVLAGNVV-------------------------ERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCEL-----------KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKP-SLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIY-----------------------SIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPK-TANVLVKIEILDVNDNDPVF----LLSS---------LQFFVQENVKIKTKLEGKLNATDRD-------------------CDQMNNFVKYE--FMTLYDH-------------KLIRHM--KPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYY--------------------------------------LQTNGDNMFG-------LNETTGELITLVSPLKLGTYVLKFTARDNGVPPLSNDASITVHV----------QDNGRFANINLTIIIGMIAITVSISVFLIVAIICVRRQP 2739
            S ++ +EI+D NDN+P F    Q V++ E + + ++I I  A D D   +N+++ Y   + T TF +D S L  ++L L + +D E+ + Y  +L+AC+   G  T+  + IQI DENDN P+ +   + K ++E+ PVG  +L++ A DID  +  +  Y      + +L +  F++  DTG + L+  L  + R S ++F++ A D +    +  E+ T ++   VED+N+  P+I  +A                             E      + I EN P  ++  L+V D D  +N +VSC L           ++  Q+  L     G Y L +   +DYE E  I+T   C D+GKP  L   R I + I DVNE+ P F    Y+  + EN PPG  +LT  A DRD++A L Y                        ID +V KHF I+++TG+I TS +P DRE        V V D  + P  TA   V IEILD NDN PVF    + SS           F + EN    T+L  +L A D D                     + N F+      +T ++H              + RH+  +P+F+I  + G IETLV LDRE  P + + +   D G+    +     + V+D NDN P W++P P++              IN++   +   L  +L+A D D  +AG+V Y                                       L +N D++ G       LN TTGE I +   L  GT  L   A D G P    DA +T++V             G    +N+TII+ MI +T  IS+FLIV I+CVRR+P
Sbjct:  126 SVLLKVEIQDQNDNRPTFSAQSQTVTLSEATTVGTLISINAATDADIDPENQIQRYTLVEHTGTFKLDLSGLPTVRLELLRPLDREQVSEYKASLEACD--PGACTRQTLEIQILDENDNSPRLANTRFNKRLIENIPVGTVVLQLNATDIDSGERGRVMYSFHGNIDSDL-TETFELVRDTGEIKLRRPLAANIRDS-YEFKVIACDAVNRACSGNENSTADITFTVEDVNNFPPSIHAVAAGAALVTSSSDQNKVGESKTGESDHNSFNEPKPGDELSILENSPPSQIAVLTVRDDDTGDNSKVSCSLNDTNSNILSNGEKTTQNFILTPSTPGIYSLRTAKVFDYESESTIRTTVVCHDYGKPQQLTSARVITVQIIDVNEFQPEFSRRVYVSGVPENAPPGMDILTTTALDRDRAAVLSYKFAPSSTLSFSEGEKDSHKSDSIQIDDEVNKHFIIESQTGIIRTSQIPLDREKIGSVTLVVLVTDSVSPPIFTATTTVSIEILDENDNAPVFTNPPVRSSEAPQGDNEKFAFTIMENAPRFTQLSQRLEAKDPDQGDNGRVQFSLLATYALTKSSRRNQFIGSSPNMLTSFEHFIDRPGSDLNSEAGMTRHVVDQPIFRIT-SNGVIETLVELDRETVPVYILKIGVRDRGAQPLASTTMLRVNVQDANDNAPVWVFPTPVDR------------TINLTTGMKPGSLAGRLRAEDADSFEAGKVEYLFLGPRGETIEGVTLEEGLLNVLNPPKPGLTKTVKPGQKLSSNSDDLKGYRAGPLYLNGTTGE-IWVAQALTSGTINLHLRAEDQGTPRSHTDAWLTINVFIDPSEGIGFLSFGGDGTLNITIILAMITVTAIISLFLIVGIVCVRRRP 987          

HSP 2 Score: 65.4698 bits (158), Expect = 1.141e-6
Identity = 84/275 (30.55%), Postives = 113/275 (41.09%), Query Frame = 1
Query: 1903 ANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLN-ATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDN----MFGLNETTGELITLVSPLKLG---TYVLKFTARDNGVPPLSND----ASITVHVQDNGRFANINLTIIIGMIAITVS 2691
            A+VL+K+EI D NDN P F   S    + E   + T +   +N ATD D D  N   +Y   TL +H      K      PT   +E L  LDRE+   +  +++A D G+ TR       I + D NDN P     R   F + +   I   P   +         +L+L A D D  + GRV Y    N D+     F L   TGE I L  PL      +Y  K  A D      S +    A IT  V+D   F      +  G   +T S
Sbjct:  125 ASVLLKVEIQDQNDNRPTFSAQSQTVTLSEATTVGTLI--SINAATDADIDPENQIQRY---TLVEHT--GTFKLDLSGLPTV-RLELLRPLDREQVSEYKASLEACDPGACTRQTLE---IQILDENDNSPRLANTR---FNKRL---IENIPVGTV---------VLQLNATDIDSGERGRVMYSFHGNIDSDLTETFELVRDTGE-IKLRRPLAANIRDSYEFKVIACDAVNRACSGNENSTADITFTVEDVNNFPPSIHAVAAGAALVTSS 372          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 225.328 bits (573), Expect = 8.633e-60
Identity = 235/875 (26.86%), Postives = 383/875 (43.77%), Query Frame = 1
Query:  301 ISIFIFNCHANQIF----NLSINEETPINSVVGNIQNFLSNNFYPNVDYSVT------YDNKYFSIIXXXXXXKEVID----LEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQI--DDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY-YLQTNGDNMFGLNETTGELITL---VSPLKLGTYVLKFTARDNGVP-PLSNDASITVHVQD---NGRF-------------------------ANINLTIIIGMIAITVS-ISVFLIVAIICVRRQPRFQ 2748
            + + I  C  +  +    + ++ EE P N  +GN++  L  N  PN+  S        Y      ++       E+      +++         E  C  + EV +L         I   I+DINDN P F++    +SIPEN+ + +   +  A D D    N ++ Y+   S   F +D     +     +L +Q+++D E ++ +   ++  ED          ++Q+   D NDN P F     E  + E+ P+G  + ++ A D D     +  +   S        R+F I   TG + +K  LD  +   V K  + ASD      ++   R  VI++V D+NDN P+I       +   +  T+ + EN P    I L +V+DRD   NG+V+C    D+    LK V    + L +  P DYE  +E  IK +    D GKP L     + I I+D N+  P F   E   S+ EN  PG+ ++ + ATD D    A +IYS+       F+ID ++G++S S    DRE      F V  +D+ +NP  +NV VK+ + D NDN P F  +   F+V EN+ +   + G +  TD D    N  V    +   D+         F I P TG I+  +  DRE+  ++T  VKA DSG     ++A  TI V D+NDN+P ++ P   N+   + PF                 ++ ++ AID D      + Y  +  +   +F +++TTG  ITL   ++    G + L    +D G P  L + A + + V D   N  F                          N  + ++I +IA T++ I V  + A++  R+ PR +
Sbjct:   49 VLVLILTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGVFNEKRCFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGI-NGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKV-EDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSF-SNQISPATKRHFAIDSSTGLITVKQPLDRESN-PVHKLIVLASDG-----SATPSRATVIVNVTDVNDNVPSIDT---RYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDV-PFRLKPVFNDQFLLETAAPLDYETTREYAIKIV--ASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKR-LDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTV-GLITVTDADAGD-NAIVTLSIINGKDN---------FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSS-NYSYDLVPF-----------TTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGN-ITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNATFLQEQVRKSMETPLDKNVGDSDILPQTNGYVIVVIAIIAGTMTVILVIFVTALVRCRQTPRHK 883          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 225.713 bits (574), Expect = 1.601e-59
Identity = 235/875 (26.86%), Postives = 384/875 (43.89%), Query Frame = 1
Query:  301 ISIFIFNCHANQIF----NLSINEETPINSVVGNIQNFLSNNFYPNVDYSVT------YDNKYFSIIXXXXXXKEVID----LEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQI--DDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY-YLQTNGDNMFGLNETTGELITL---VSPLKLGTYVLKFTARDNGVP-PLSNDASITVHVQD---NGRF-------------------------ANINLTIIIGMIAITVS-ISVFLIVAIICVRRQPRFQ 2748
            + + I  C  +  +    + ++ EE P N  +GN++  L  N  PN+  S        Y      ++       E+      +++         E  C  + EV +L         I   I+DINDN P F++    +SIPEN+ + +   +  A D D    N ++ Y+   S   F +D     +     +L +Q+++D E ++ +   ++  ED          ++Q+   D NDN P F     E  + E+ P+G  + ++ A D D     +  +   S        R+F I   TG + +K  LD  +   V K  + ASD      ++   R  VI++V D+NDN P+I       +   +  T+ + EN P    I L +V+DRD   NG+V+C    D+    LK V    + L +  P DYE  +E  IK +    D GKP L     + I I+D N+  P F   E   S+ EN  PG+ ++ + ATD D    A +IYS+       F+ID ++G++S S    DRE      F V  +D+ +NP  +NV VK+ + D NDN P F  +   F+V EN+ +   + G +  TD D    N  V    +   D+         F I P TG I+  +  DRE+  ++T  VKA DSG     ++A  TI V D+NDN+P ++ P   N+   + PF     ++           + ++ AID D      + Y  +  +   +F +++TTG  ITL   ++    G + L    +D G P  L + A + + V D   N  F                          N  + ++I +IA T++ I V  + A++  R+ PR +
Sbjct:   49 VLVLILTCLVSLCWAQEKDYTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGVFNEKRCFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGI-NGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKV-EDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSF-SNQISPATKRHFAIDSSTGLITVKQPLDRESN-PVHKLIVLASDG-----SATPSRATVIVNVTDVNDNVPSIDT---RYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDV-PFRLKPVFNDQFLLETAAPLDYETTREYAIKIV--ASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKR-LDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTV-GLITVTDADAGD-NAIVTLSIINGKDN---------FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSS-NYSYDLVPFTTNPGSV-----------VTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGN-ITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNATFLQEQVRKSMETPLDKNVGDSDILPQTNGYVIVVIAIIAGTMTVILVIFVTALVRCRQTPRHK 883          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 218.779 bits (556), Expect = 8.152e-58
Identity = 208/703 (29.59%), Postives = 315/703 (44.81%), Query Frame = 1
Query:  613 IEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFE---DSTKTFTIDNSNLEDLKL---FLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYD------LWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI--DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQ-TNGDNMFGLNETTGELITLVSPLKL---GTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINL 2655
            IE++DINDN P F +    +S+ EN+ + +   I  A D+D + +N V  Y      +++  F++  +N    KL    +  ++D E ++ Y  T+ A +  T       ++ + I D NDN P+F K SYE  + E+ PVG  +L+V+A D D     + EY I    +   + +  +I   TG + +K  LD    IS FKF + A DK  S  +S    T V I V D NDN P +++    +   S  +   I E+ P    + L  VSD+D  EN  V+C +  D+   +L+  G    D      L +T P DYE+    +      D G P+L    ++ + + D N+  P F    +     E   PG  VL V A D D    AEL+YSI  D      F ID  +G +     P DRE     +F V   D           V I++LD NDNDP F+LSS  F V EN+   + + G +   D D  + N  V+        +         F ++  TG I + +  DREK  ++T  +KA D G P R ++   TI V D NDN P    P   +F+R             +S +A    ++  ++A D D      + Y +   N   +F ++ + GE I L   L     G + L     D G P  S  A   VH+  N   +N++L
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRD-TERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP--VPKMLQIERSTGIISVKGPLD-REEISSFKFHVIARDKGPSPKSST---TYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVA-NISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDV-PFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRAR-SPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPV-GMVTVLDMDKGE-NAQVQLSVEPDVGN---------FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRR-------------LSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGE-IKLTKELTRKHGGLHRLVVKVSDRGKP--SRHAIALVHIYVNETISNVSL 784          

HSP 2 Score: 96.2857 bits (238), Expect = 1.446e-19
Identity = 94/347 (27.09%), Postives = 159/347 (45.82%), Query Frame = 1
Query: 1657 NEYLGSL----RENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREM---TSIK------QFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGE-IETLVV---LDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD---NMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            N  LG +    RE  PP + + ++ A      +  +Y ++     +  +D KTG I T+ +P DRE      IK      +FEV+V D   N     +  +IE+ D+NDN P F    L   VQEN  +         ATDRD ++ N  +KY+     +   +  +    Q+    GE +  L+V   LDRE   ++ +T+ A D G+P+R++ A   + + D NDN P++      +++  +S    E   +  S        +L++KA D D    G + Y +    D    M  +  +TG +I++  PL   ++ ++     ARD G  P S+   +++ V D
Sbjct:   19 NSALGGILYHVREEQPPNTLIGSLAADQGLPDSGHLYKLEVGA-PYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATF-AIPQATDRDTER-NGVLKYDLSAGPEASALFSL----QMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQF---EKSSYEAEVS----ENSPVGYS--------VLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTG-IISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTD 342          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 219.55 bits (558), Expect = 1.061e-57
Identity = 209/711 (29.40%), Postives = 320/711 (45.01%), Query Frame = 1
Query:  613 IEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFE---DSTKTFTIDNSNLEDLKL---FLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYD------LWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI--DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQ-TNGDNMFGLNETTGELITLVSPLKL---GTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTIIIGMIA 2679
            IE++DINDN P F +    +S+ EN+ + +   I  A D+D + +N V  Y      +++  F++  +N    KL    +  ++D E ++ Y  T+ A +  T       ++ + I D NDN P+F K SYE  + E+ PVG  +L+V+A D D     + EY I    +   + +  +I   TG + +K  LD    IS FKF + A DK  S  +S    T V I V D NDN P +++    +   S  +   I E+ P    + L  VSD+D  EN  V+C +  D+   +L+  G    D      L +T P DYE+    +      D G P+L    ++ + + D N+  P F    +     E   PG  VL V A D D    AEL+YSI  D      F ID  +G +  +  P DRE     +F V   D           V I++LD NDNDP F+LSS  F V EN+   + + G +   D D  + N  V+        +         F ++  TG I + +  DREK  ++T  +KA D G P R ++   TI V D NDN P    P   +F+R             +S +A    ++  ++A D D      + Y +   N   +F ++ + GE I L   L     G + L     D G P  S  A   VH+  N   +N++L  + G++ 
Sbjct:  155 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRD-TERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP--VPKMLQIERSTGIISVKGPLD-REEISSFKFHVIARDKGPSPKSST---TYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVA-NISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDV-PFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEV-RARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPV-GMVTVLDMDKGE-NAQVQLSVEPDVGN---------FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRR-------------LSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGE-IKLTKELTRKHGGLHRLVVKVSDRGKP--SRHAIALVHIYVNETISNVSL--VEGLVG 826          

HSP 2 Score: 96.2857 bits (238), Expect = 1.587e-19
Identity = 94/347 (27.09%), Postives = 159/347 (45.82%), Query Frame = 1
Query: 1657 NEYLGSL----RENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREM---TSIK------QFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGE-IETLVV---LDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD---NMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            N  LG +    RE  PP + + ++ A      +  +Y ++     +  +D KTG I T+ +P DRE      IK      +FEV+V D   N     +  +IE+ D+NDN P F    L   VQEN  +         ATDRD ++ N  +KY+     +   +  +    Q+    GE +  L+V   LDRE   ++ +T+ A D G+P+R++ A   + + D NDN P++      +++  +S    E   +  S        +L++KA D D    G + Y +    D    M  +  +TG +I++  PL   ++ ++     ARD G  P S+   +++ V D
Sbjct:   55 NSALGGILYHVREEQPPNTLIGSLAADQGLPDSGHLYKLEVGA-PYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATF-AIPQATDRDTER-NGVLKYDLSAGPEASALFSL----QMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQF---EKSSYEAEVS----ENSPVGYS--------VLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTG-IISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTD 378          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 217.624 bits (553), Expect = 2.189e-57
Identity = 211/693 (30.45%), Postives = 324/693 (46.75%), Query Frame = 1
Query:  559 KFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKI---VSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE--KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDN--MFGLNETTGELITLVSPLKL--GTYVLKFTARDNGVP 2586
            + EV+IL +       I I +KD NDN P F +    +SIPEN+ + S   I  A D D    N V  Y+  +    F +D     +     +L +Q+++D E+++ Y   ++  +  +   +   I+ + + D NDN P F +   E  I ES PVG  +++++A D D     + +Y     VS   R    R F ++  TG + ++  LD     +  K  + ASD      +S   R  V I+V D+NDN P I +     +      T+ + E +P    I L +VSD+D   NG+V C +++D+    LK V    Y L ++   DYE  KE + K +    D GKPSL +   + + +ED N+ PP F       ++ EN      + T+ ATD D  ++AE++Y +       F +D KTG+++ S V FDRE      F V  +D+ T    +   V + ILD NDN P F  +  QFFV EN+  K    G +  TD D  + N  V    +   ++         F + P TG I++ V  DRE+  ++T  V+A DSG P   + A  TI V D+NDN P  IYP P N    + P      AI  S +AE       + A+D D      + Y +  NG+N  +F ++  TG +     P +   G + L     D G P
Sbjct:  111 EIEVVILPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDM-GPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATR----RLFALNSTTGLITVQRPLD-REETANHKLSVLASDG-----SSSSARATVTINVTDVNDNAPNIDL---RYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDV-PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIV--ASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNA-SFFDLDRKTGVLTASRV-FDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLP-KYSTVGVITVTDADAGE-NAVVSLSILNDNEN---------FILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYP-PSNTSFKLVPL----SAIPGSVVAE-------VFAVDGDTGMNAELKYTI-VNGNNKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYP 760          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 181.03 bits (458), Expect = 1.166e-46
Identity = 202/731 (27.63%), Postives = 322/731 (44.05%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDS----TKTFTI---DNSNLEDLK-LFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLIS----RYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVG-GGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTIIIGMIAITVSISVFLIVAIICVRRQ 2736
            + I ++DINDN P F      VS+PEN+       I+ A D D S  N V+ Y+   S       F +   + +N E +  L ++KS+D E++ LY   L+A +  +   +   ++ I + D NDN P F +      I E+ PVG  ++++ A D D     +  Y++ +            R F++  ++G + +   L+      V++  I A+DK      +    T     V D+NDN PTI++     +   +   I I E       + L +VSD D+  NG V+C +       +LK +     Y L +    DYE ++      +  D G  SL    ++ I + D N+  P F    Y  S+ EN   G  ++TV ATDRD  K+AE++Y +       F +D +TG+IS +    DRE  +   F +  KD        N  V + +LDVNDN P F L+   F+V ENV  K    G +   D D  + N  V+   +   + +L       F I P +G I + V  DRE+   + + V+A D G P R +     I+V D+NDN P  + P      + + P                  ++ ++ A+D D      + Y++   N  N+F ++   G  ITL+ PL     G + L     D G+  + + A   VHV  N      N T I  +IA ++   +   VA    R Q
Sbjct:  139 VRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPD-SEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREES-PVYRIIILATDKGPEPVPATATVTVT---VTDVNDNSPTIEI---RDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTE-QLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVP-KHSTVGMVTVADSDEGE-NGRVRLSILGTDNRQL-------FSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTL------------PGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGN-ITLMEPLTETHHGLHRLVVRVSDIGI-AVQHHAVALVHVFVNETLE--NATYIEWLIAGSLQTPLDTDVAGFGRREQ 835          

HSP 2 Score: 49.6766 bits (117), Expect = 5.379e-6
Identity = 68/283 (24.03%), Postives = 110/283 (38.87%), Query Frame = 1
Query: 1675 LRENTPPGSPVLTVRATDRDKSAELIYSI-----DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQ---------FEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVV---LDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKL---ILKLKAIDQDENDAGRVCYYL 2463
            LRE    G+P + +R  D +   EL Y +     +        ++ +TG +  +    DRE     Q          +V V   +  P    + V+I + D+NDN P F    L   V EN     +   +  A D D  + N   +YE +   D   +   +          ++  LVV   LDRE+   + + ++A D GSP     A   I V D NDN P                 +++   +N+ +I E   +   +++L A D+D      V Y L
Sbjct:   47 LREGAFIGNPSVDLRLADYN--LELTYKVMLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALCGGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQ-PANDPDS-EANGVRRYELLP-SDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSP-----------------VFDQAEVNV-EIPENSPVGTHVVQLHASDRDAGSNAEVVYRL 306          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 167.933 bits (424), Expect = 1.139e-42
Identity = 159/561 (28.34%), Postives = 259/561 (46.17%), Query Frame = 1
Query:  349 SINEETPINSVVGNIQNFLSNNF--YPNVDYSVTYDNKYFSIIXXXXX-----XKEVIDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFII---SIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLK---LFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKED--LQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDK--SAELIYSI------DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPV 1956
            ++ EE P  ++VG + + L      +P+  + +   +  FS+++          +EVID E+ C     C     VI+F+V+   +  +  F +    +E+ DIND+ P F  ++  V I E+  L + + +EGA D D    N +++Y  +++ +      +  +  K   L ++  +D E++  YT  L A +      +   +V I + D NDN P F++ S   T+ E    G  +L + A D+D     +  Y   S  +   + R F++ P TG L LK QLD     S ++  I A D   S   S+     V++HVEDINDN P IK+   + + +S   T+ + E    +  +GL +VSD D  ENG V+C L+     + L  +D     Y + +    D E+      + E  D G P     R   + + D N+  P F  + Y  SL EN  PG+ V TV A D D   +  + Y++         V  + SI+  +G I  +  P D E  +   F+V  +DD   P   N  V + I+D NDN PV
Sbjct:   34 ALYEEQPAGTLVGRLSDDLQGRVAEHPSRHFRLMRRDD-FSLVHVEEADGTVSAREVIDREQQCGQAPSC-----VIRFDVLC--TLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGG-NALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAE-VRRLFQLDPKTGKLSLKGQLD-HELNSEYEISIQARDMGPS---SIPAHCKVLVHVEDINDNAPEIKL---DFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRD----DYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAI-YALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPV 572          

HSP 2 Score: 107.457 bits (267), Expect = 8.693e-24
Identity = 140/588 (23.81%), Postives = 231/588 (39.29%), Query Frame = 1
Query:  931 IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRV----SCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGS------LRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSI----DNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELITLVSPLKLGT-----YVLKFTARDNGVPPLSNDASITVHVQDNG 2634
            +++ D ND+ P F++      I ES  +G  +    A D+D        Y +       L  R          L++KS+LD       +  Q++A D      +     T V I V D NDN P     + NV  R        ++  P   L+ L+ +D D   NG V    S  +  +++ L   D   G   L      D+E     +   + +D G  S+  +  + +H+ED+N+  P  + +  + S      + E     S V  V  +D D +   + +   +   HF +    D+   + ++S    DRE  +     +   D  T P+ A     + +LD NDN+P F  S+ +  + EN      +   + A D D +  N  + Y  +          +     I P++G I  L  LD E   + T  V+A D G P     A  ++ + D NDN P   +P          P    T  + +   A    L+  ++A D D    G + Y + Q N  N+F +N   GE+ T  + +         + L    RD G P LS  A+I + V  +G
Sbjct:  124 VELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQE-GEYTLQLTAWDGGDPPRSGT---TLVRITVLDSNDNSPVFAQTSCNVTVR--------EDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQ--LDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYVVVTNSSL---DREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVT-TVTAWDADAEH-NGMIAYNVVE--SEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHP----------PLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHG 680          

HSP 3 Score: 92.8189 bits (229), Expect = 3.025e-19
Identity = 99/350 (28.29%), Postives = 152/350 (43.43%), Query Frame = 1
Query: 1609 EIHIEDVNEYPPGFQNNEYLGSLRENTPPGS--PVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKT-GLISTSFV---PFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLV-SPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            E+ + D+N++ P F  +E    + E+   G+  P+   R  D   +A   Y +D       ++  +T G      V     DRE       ++   D    P++   LV+I +LD NDN PVF  +S    V+E+    T L   LNATD D +  N  V Y F +  D ++ R    +FQ+ P TG++     LD E    + I+++A D G  +  A     ++V D+NDN PE I    I   R  + F+ E  A       E    ++ +  ID  EN  G V  +L+  G   F L     + + +  S L   ++  Y L   A D G PP       TV + D
Sbjct:  123 EVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLL-TLNATDVD-EGPNGEVVYSFSSPVDAEVRR----LFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPE-IKLDFIMQSRGDTVFVSEGAAY------ESFVGLVTVSDIDSAEN--GLVACHLR--GHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLD 455          

HSP 4 Score: 70.0922 bits (170), Expect = 2.787e-12
Identity = 76/276 (27.54%), Postives = 112/276 (40.58%), Query Frame = 1
Query: 1909 VLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTK--LEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVV---LDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD----NMFGLNETTGELITLVSPLKL---GTYVLKFTARDNGVPPLSNDASITVHVQD-NGRFANINLTIIIGMIAITVSIS 2697
            V  ++E+LD+ND+ P F  S +   + E+V + T+  LEG      RD D   N ++      Y            + R    +   LVV   LDRE+   +T+ + A+D G P R       I V D NDN P                F   +  + + + A    ++L L A D DE   G V Y   +  D     +F L+  TG+L +L   L       Y +   ARD G   +     + VHV+D N     I L  I+     TV +S
Sbjct:  120 VHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGA-----RDLDVGGNALRA-----YHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSP---------------VFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKL-SLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVS 369          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.696 bits (413), Expect = 3.351e-41
Identity = 196/735 (26.67%), Postives = 308/735 (41.90%), Query Frame = 1
Query:  556 IKFEVIILGSYSKNSFIISIE--IKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDST------KTFTIDNSNLEDLK----------------LFLQKSIDYEKQNLYTGTLQACEDSTG--CSTQCQIVIQIDDENDNIPKFSKESYEKT-IVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNR-ISVFKFQISASDKLK-SKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFL---TIKIKENEPAQK-LIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNE--------YLGSLRENTPPGSPVLTVRATDRDKS--AELIYSID-----RKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSS------LQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVF---QIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY-YLQTNGDNMFGLNETTG--ELITLVSPLKLGTYVLKFTARDNG 2580
            ++   +  G  S N  ++ ++  ++DIND+ P FR     VSI E+  +   + +  AID D +  N ++ Y+   ++        F++  S+ +D                  L L++ +D E    Y   L   ED      S    + I + D NDN P F         I E   VG  ++++ A D D        Y   +K           +   TG + +++   L    + V +  + A D  + S+  SV     V + + D NDN P  +V+A     +  +L    +KI EN P+   ++ +SVSD DL  +G V   L E     EL       + L +T   DYE+           D G P L +   + I + D+N+  P F N          Y  SLREN P G+ VL + ATD D      + +++        V + FS++ +TG ++ +  P DRE     +  V   D  +  + A  +V++ +LD NDN P F+  S       QFFV+E   + T + G ++ +D D +  N  V           L+R   P +         G + TLVVLDRE    + ++V+A DSG P   A    +I V D NDN P    P   +  +H+  F   +PA  +  ++        + A D D  D GR  Y  +  N   +F LN  +G   L   VS L  G + L    RD G
Sbjct:  111 VQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPD-AGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWG-EDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASV----TVTVELNDDNDNAPVFEVIA----LQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRL-EFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLA-TPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYV-GTVSTSDLD-EGDNARVAL--------NLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTF---SPAGMLVGVS--------VTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRG 812          

HSP 2 Score: 51.6026 bits (122), Expect = 1.264e-6
Identity = 47/165 (28.48%), Postives = 72/165 (43.64%), Query Frame = 1
Query: 2173 LDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYP--RPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNM-----FGLNETTGELITLVSPLKLG-----TYVLKFTARDNGVPPLSNDASITVHVQDN 2631
            LDRE  P++ + +   D G+P        TI V D NDN P ++ P  RP+    H                ++    +++L+A D D    G + Y   T   ++       ++ TTG L+T+ +  KL       + L   ARD G   LS  AS+TV V+ N
Sbjct:  230 LDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEH----------------SKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTG-LVTVRNAEKLDRETMPVHRLVVVARDGG--QLSRSASVTVTVELN 375          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 1.236e-40
Identity = 157/584 (26.88%), Postives = 258/584 (44.18%), Query Frame = 1
Query:  589 SKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQ--------DHGKPS-LKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRK-VLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWI 2304
            +++  I++I + D  D  P F  +     + EN    +++    A   D +A N        D   +F+I+ S     ++F   +ID E+Q  Y   L+   +S G + +  + + + D N++ P F + SYE +I E  PV      V A D D  K  + +Y+I  +GN       F I PD G L ++ +LD   R   +   +SA D      +S      V + V D+NDNKP        +   S ++    +E E    +  +  +D D   NG V+   ++   + EL    G    L       +++E LI+              D G+P  L++  T+++ ++DVN+ PP F  + Y  S+ E+    + +L V A+D D+     L Y+I+       F++D  TG I T     DRE T+     V+  D  T+P  A+  V +++LD NDN P F  S L     E+ ++  +L   L A+D D     + V+Y  +    H         F I  +TG +     LD E    + + V A D G P R +     ++VRD NDN P ++
Sbjct:  638 ARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNA-NVTYLIVSGDQRGSFSIEWSGG---RIFTANAIDREEQAFYQ--LRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEI-GEGNGG---EKFGIFPD-GQLYVRYELDRETR-EEYSLTVSAMDTGVEPLSS---SVTVNVTVLDVNDNKP--------LFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRV-----FDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQI-TLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVG-ELLITLTASDEDTGPSGD-VRYAIVAGNTHA-------TFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFL 1183          

HSP 2 Score: 156.377 bits (394), Expect = 1.450e-38
Identity = 180/693 (25.97%), Postives = 289/693 (41.70%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQI-VSIPENSDLVSIIKIEGAIDKDFSAKNRV--KSYKFEDSTKTFTIDNSNLEDLKLFLQKS----IDYEKQNLYTGTLQACEDSTGCS--TQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDL-KENGRVSCEL--KEDLQSLELKDVG-GGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEY-RTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI-DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVS--PLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            + + + D+NDN P F     + V+  E++ +   + ++ A+D+D    N V   +YK     +   +        + FL  +    +D E    Y   +QA ED        + Q+ + + D NDN P F K +Y  ++ E  PVG  +                   ++ +G   L        P TG +  +  LD   R   +   + A+D      +    R   +I + D+NDN P I+ +      RS  +    +   P      ++V+D D    NG +S  +    +     L   G  G   L      D E+  +        D+GKP  +    ++ +++ DVN++ P F  + Y  +L E  P GS V  V A D D    A+L YSI     L  FS+D  TGL++T     DRE+ S     ++ +D    PKTA   + + +LDVND  P+F  +       EN  +       ++A D D  + N  V+Y F    D  +    + +F++   TG++ TL  LDRE+   + + V+A D GSP   + A  T+ V DLNDN P + YP      ++ +  +   P             +  + A D D    G V Y L       F +N  TG + T VS    +   Y L+ TA D G     + A +T+ V D
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDV-GPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQA-EDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-----------------RDLLHRGRGPLA---VPFDPKTGMVSTRQPLDFEARRQ-YTLSLRAADGGNPPLSG---RATAVIQLLDVNDNDPAIRFVYLPPAARSASVD---ESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDG-KVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVEN-SLPGLFVVSVSAADSDLGE-NGTVRYNF----DPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF-YP-----VQYFASILENEP---------GGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVAD 650          

HSP 3 Score: 149.058 bits (375), Expect = 2.525e-36
Identity = 149/547 (27.24%), Postives = 245/547 (44.79%), Query Frame = 1
Query:  592 KNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDN--SNLEDLKLFLQKS-IDYEKQNLYTGTLQACEDSTGCSTQCQIVIQI--DDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCEL-KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDK--SAELIYSIDRKV--LKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVK-DDKTNP----KTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREK 2187
             +S  +++ + D+NDNKP F ++  +    E  ++ S++    A D D  +   V +Y FE     F +D+    +  L++F +++ I       ++ ++ A +       Q +  +Q+   D NDN P+F+K  Y+ ++ ES     ++L+V A D+D        Y I ++GN       F +   TG + L   LD     S +   +SA+D   S   +      V + V D NDN P            S+     ++     + LI L+ SD D   +G V   +   +  +    D   G   ++     D+E + L +     +D G+P       + +H+ D N+ PP F   +   S+ EN P G+ V+TV A D D   + EL YSI R+     HF+ID ++G I T+    DRE+T    FEV V+  DK  P    ++A   V + + D NDN P F ++     V         + G L A+D D +  N  V+Y  +T  D  ++      F++   TG IET   LDRE 
Sbjct:  843 SSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGV-TYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAI-NEGNEG---GKFTVDASTGQITLLGSLDREETAS-YTLVVSATDSGTSPLAA---SCTVAVQVLDENDNPPRFT--------ESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTG--SVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTA-AEIDREVTG-GLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRF-VTPTAILVDGLRAAAGSVVGTLQASDPD-EAENAAVRYA-VTGGDAAIL------FRLDRRTGIIETSTELDRES 1359          

HSP 4 Score: 142.895 bits (359), Expect = 2.222e-34
Identity = 174/693 (25.11%), Postives = 293/693 (42.28%), Query Frame = 1
Query:  613 IEIKDINDNKP-----YFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKT--FTIDNSNLEDLKLF-LQKSIDYEKQNLYTGTLQACEDS--TGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDL-----QSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAE--LIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELITLVSPLKLGT---YVLKFTARDNGVPPLSNDASITVHVQD 2628
            I++ D+NDN P     Y     +  S+ E++   ++  +    D D    N   S       +   F +    +  L++  +   +D E+  +Y  T+ A ++      S    +V+ ++D ND+ P+F+  +Y   + E  P G  +  V A+D D     K  Y IVS  +      +F +   TG +    ++D     SV    ISA D+     T+    T++ + + D+ND  P        +  ++ ++   ++ + P   ++ +S +D DL ENG V      D+     +   L  + G    L S    D E+ +    + + QD G P L     + + + D+N+  P F   +Y  S+ EN P G+ V TV ATD D+ A   + Y +       F ++  TG +ST  V  DRE  ++ Q +V   D       +  +V I + D  D  P F      F V ENV   T L G ++A+  D   +N  V Y  ++          +  F I  + G I T   +DRE+   + + V A   G       A+ ++ V D+N++ P         F R      YE   ++I++    +     ++A D+D    G V Y + + NG   FG+    G+L      L   T   Y L  +A D GV PLS+  ++ V V D
Sbjct:  213 IQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLG----WFSVDESTGLVTTDGKVDREVASSVV-LNISAQDQGAQPKTAY---TSLTVTLLDVNDEPP--------LFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKS---LDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTR-VSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGT-LVGSVSASTLD---LNANVTYLIVS-------GDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGE---ASVSVLVHDVNNHAPV--------FDRAS----YE---VSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPD-GQLYVRYE-LDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLD 854          

HSP 5 Score: 132.494 bits (332), Expect = 3.503e-31
Identity = 153/644 (23.76%), Postives = 267/644 (41.46%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYK-FEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVE-SFPVGKE----ILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIK--VLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSL--ELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQD---HGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATD----RDKSAELIYSIDRKVLKH--------FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPV--FQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY 2457
            + I ++D+NDN P F   +  + + EN+    +I    A D D   +N + +Y     S   F +D ++     L   + +D E++  Y  T++A + +   +T  ++ + + D NDN P+FS+ +Y   + E + P GK     I  V A D D   F +  Y +    + +     F + P TG+L +   LD  +R + +  +  A+D      T+      + ++V D NDN P+++   LA  V E          +  P   L+ +S +D D      V+ EL+  + S   E +   G    L      D E++     +    D   H    L     + + + DVN+  P F +        E++P G+ V TV+A D    R+   E   + D +            F+++  TG +       DRE        V   D    P T+   + + + D NDN P F     +  + E+    T++  +L+A D D +  N  ++Y+         I    P   F++ P  G +     LDRE+  ++ + V+A D G P R   A+  + + D+ND  P +           +SP+          +      LIL++ A D D   +G+V Y
Sbjct: 1502 VEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDAD-QGQNALVTYSVLSGSEGAFVVDAASG---VLRASRRLDREERASYLLTVRASDGT--HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESR-ACYVLRARATDGGGLAATA-----RLYVNVLDANDNAPSVQNDSLAAEVPE----------DAPPGTSLLRISATDDDEG----VNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRS-ALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRL-VRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVL-RLSAWDPD-EGANGELRYD---------IASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAF----------QLSPYTVHA----RENTQGPPVLILQVVARDDDLGSSGQVTY 2092          

HSP 6 Score: 129.028 bits (323), Expect = 3.815e-30
Identity = 156/590 (26.44%), Postives = 242/590 (41.02%), Query Frame = 1
Query:  922 QIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIK--VLAGNVVERSMFLTIKIKENEPAQKLIGLSVS-DRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWS----THPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLK-HFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPK---TANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMT--LYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTN---GDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            Q+ I ++D NDN P F+    E  + E+   G+ I  + A D D  +     Y ++S          F +   +G L    +LD   R S +   + ASD   +          + + V D NDN P       + +V E +        + +  + +IG  ++ D D    G V+  L     S +  D   G + +      T P D E            D G   L     + +++ D N+  P  QN+     + E+ PPG+ +L + ATD D+   AEL +SI     +  F++ N  G +S +    DRE  S     V V D   +P    ++ V V + + DVNDN P F  S       E+  +   +   + A D D  + N++V+Y   T               F +   TGE+  +  LDRE   ++ +TV A D G P   + A   + V D NDN P   +PR     R      YE     I++       +L+L A D DE   G + Y + +    GD  F L+   G L  +  PL   +  +Y L   ARD G P  S+ AS+ V + D
Sbjct: 1501 QVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEG-----AFVVDAASGVLRASRRLDREERAS-YLLTVRASDGTHAT------DARLSVAVRDANDNSPRFSRHAYSFDVAEDAA------PDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDS-DWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGND-GQLSVARA-LDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFT-SPRSALAPEDSPVGAVV-ATVQAVDPDSGR-NSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPR--FPR-----RE-----YEA---AIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD--FRLDPVLGTL-AVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSD 2046          

HSP 7 Score: 118.627 bits (296), Expect = 5.667e-27
Identity = 135/562 (24.02%), Postives = 213/562 (37.90%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSI-----PENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNS-NLEDL--KLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIG-LSVSDRDLKENGRVSCELKEDLQS-----------LELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSA--ELIYSI-DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYD 2223
            +S+ ++D NDN P F  +     +     P+     ++I    A D D      V +Y    S  +   D +  L  +   L + + +D E +  Y    +A  D  G +   ++ + + D NDN P    +S    + E  P G  +L++ A D D     + E+ I S          F +  D G L +   LD   R S +   +  SD+ +     +     V + + D+NDN P           RS        E+ P   ++  +   D D   N  V   L  D +              L  V G   ++      D E            D G+P L    T+ + + D N+  P F   EY  ++ E+ PPG+ VL + A D D+ A  EL Y I        F +D   G ++ +  P DRE T+  +  V  +D     ++    V++ + DVND  P F LS      +EN +    L  ++ A D D       V Y      D          F + P  G +  L  LDRE  P   + + A D
Sbjct: 1603 LSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEV-TYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARAT-DGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEG----RFAVGND-GQLSVARALD-RERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAF------TSPRSAL----APEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTG---EVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVAR-PLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQ-VTYAAAGGNDGG-------AFSVSP-DGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 8 Score: 116.701 bits (291), Expect = 2.212e-26
Identity = 149/586 (25.43%), Postives = 236/586 (40.27%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVK-SYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTG-CSTQCQIVIQIDDENDNIPK-----FSKESYEKTIVESFPVGKEILKVEAIDIDGPKFN-KTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLI-GLSVSDRDLKENG--RVSCELKEDLQSLELKDVGGGFYDLWST-HPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSID----RKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQ--ENVKIKTKLEGKLNATDRDCDQ-MNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEW 2301
            +++ ++D NDN P F       S+ E+S +       GA  +D   + R   +  F+  T   +             ++ +D+E +  YT +L+A +      S +   VIQ+ D NDN P          +   ++ ES   G     V   D D P  N +    IV    R     +    P    L + SQLD   RI ++   I ASD  K    S     +++++V D+ND+ P                   + E  PA   +  ++  D D   N   R S     DL    + +  G    L +T    D E    +      QD G      Y ++ + + DVN+ PP F   +Y+ +  EN+ PG  V++V A D D  ++  + Y+ D     +  + F +D+ TG ++T     DRE        V  +D  + P  +   V + + D+NDN PVF    +Q+F    EN   +         T  D D+  N  V+Y+ +T  D          FQ+   TG + T V LDRE+   + + V A D G     + A  TI V D  D  P +
Sbjct:  122 VNVTVQDANDNPPAFEKPAYRASVAEDSPV-------GAALRDLLHRGRGPLAVPFDPKTGMVST------------RQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLD-RERIPMYNLTILASDNGKPVARSAT--ASLVVYVNDVNDHAPRFA---------LSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTG----LVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTT-LKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFY--PVQYFASILEN---EPGGTAVTTVTATDPDRGANGTVRYQ-LTAGDAAR-------FQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTF 658          

HSP 9 Score: 101.679 bits (252), Expect = 8.596e-22
Identity = 113/473 (23.89%), Postives = 189/473 (39.96%), Query Frame = 1
Query: 1258 TNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVS-DRDLKENGRVSCELK-----EDLQSLELKDVGG-GFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDP----VFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDH-KLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSP-TRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD-NMFGLNETTGELIT--LVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            T V + V D+NDN P+              + +  KE+    + + L  + DRD+  NG      K     E+ + +  + V    F  L +T P D E         + +D G P       + + ++D N+ PP F+   Y  S+ E++P G+ +  +    R   A                D KTG++ST   P D E        +   D    P +      I++LDVNDNDP    V+L  + +    +       +   +  TD D    N  +    +   +    + H   V  +R     ++    LDRE+ P + +T+ A D+G P  R A A+  +YV D+ND+ P                F     A  +S+ A     +  + A+D D     ++ Y + +  D   F ++E+TG + T   V      + VL  +A+D G  P +   S+TV + D
Sbjct:    7 TEVRVVVGDVNDNAPSFP--------EPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDLLHRGRGPLA-------------VPFDPKTGMVSTR-QPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLR----VLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPR---------------FALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLD 438          

HSP 10 Score: 79.337 bits (194), Expect = 4.774e-15
Identity = 69/247 (27.94%), Postives = 100/247 (40.49%), Query Frame = 1
Query: 1579 KPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENV----KIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVR--DLNDNQP 2295
            +P +  +  +EI +EDVN+ PP F   E    + ENT  G  + T+ ATD D+   A + YS+       F +D  +G++  S    DRE  +     V   D        +  + + + D NDN P F   +  F V E+     K    + G + A D D       V Y      D          F + P TG +     LDRE    + +  +A D G       A A +YV   D NDN P
Sbjct: 1493 RPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRR-LDREERASYLLTVRASDGT---HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGE-VTYALAPSEDSDW---ADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG----LAATARLYVNVLDANDNAP 1727          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 5.853e-40
Identity = 170/702 (24.22%), Postives = 290/702 (41.31%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACED--STGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHP----------YDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYS-IDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFF---VQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLK------------LGTYVLKFTARDNGVPPLSNDASITVHV 2622
            +++ ++D NDN P F   +   ++PE++ + S + +  A D D +  N + SY+       F+++ S  +   +    S+D E +  Y   + A +   + G S+   +V+ + D ND+ P+F    Y      S P G  +  V A D D        + +         S  F + P  G  ++ +   L          +  SD      ++V   T V +   D  +     +   G    RS       +E++P    I + V+ R  +  G VS  L            GG   D+++  P           D+E +   + + E +D G P    Y  +E+ + D+N+  P F ++ +   + ENTPP + ++ + A D+D     ++ YS ID  +   F ++  +G I  S    DRE  +  +  V   D  +  +   V V I + D NDN P F     Q F   V+E+  +   +   L  +  D D+  N       +L D  L       F I P+TGEI     L+RE    + + V+A D   P      + TI V D+NDN P                F      I   + +E   L+ ++ A D D+   G+V +++++  +N F +   +GE I  V PL+            L  Y    TA D G PPLS+DA++T+++
Sbjct:   12 VTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDAD-AGLNAIISYRLRGGDGHFSVNPSTGQ---IITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGS-----ASAGFSVDPRRG--VIHAARALQGPRDDLTLTVRVSDGGAPPRSAV---TTVTVRFRDAGEFP---RFAPG---PRSF----SFREDQPPGTTITV-VAARSSRRAGPVSYHLAS----------GGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRT-IVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIR-SVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRF----TQIFSAHVREDAAVGFPV---LRVSTLDADEGPNAAIT--FSLLDPSL------PFSIHPSTGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPR---------------FGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN-FRVGRDSGE-IHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINI 641          

HSP 2 Score: 147.132 bits (370), Expect = 1.337e-35
Identity = 182/702 (25.93%), Postives = 292/702 (41.60%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTI--DNSNLEDLK--LFLQKSIDYEKQNL--YTGTLQACEDSTG-CSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLI-LKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPA-QKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLIST-SFVPFDREMTSIKQFEVNVKD----DKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL--QTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVH---VQDNGRF 2640
            ++I + D+NDN P F      +  PE S+  +++    A D D  A  +V  +     T+ F +  D+  +  ++   +   +      NL  Y+  + A +      S+   + I I   N N P+F +E Y   +  +   G  IL + A+D D     +  Y +V  GN    SR F +  D G  + L++ L   +  S+F   + A D+ +   +S   R   II V + N   P               L + + EN PA   L  ++ +D D   NG +   +     S  L D+     D+      DYE E L        D G  +  E   + I + DVN+ PP    ++Y   + EN P G+ VL + A D D   +A  +YS+D      F ++ KTG+++T  F+ ++ + T    +E+ V+     D  +  TA   V ++I  VN+  P F+     F V E+  +   + G + ATDRD   ++  V   F  L+     +     F +   TGEI     LDRE+  + T+ V A ++GS   F      + V   + N P      P+      S  +Y      +S+ A     ++ + A D D     R   +L    N    F +N  TG LI + SPL    +  Y L   A D G PP +    + V    V DNG F
Sbjct:  525 VTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVF-FFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVG-GN---ASRRFDV--DAGGFLHLRASL-AGDAGSIFSVTVEARDRGRPPLSS---RATAIISVTEENQYAPRFA---------HPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGS-GLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQT----YELTVRAFNYPDTFHYSTAQ--VHVQITGVNEYFPRFVQREYNFVVSESAPVGAPV-GSVFATDRDAG-IDGTV---FYMLFGESRSKG----FSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDP------PV-----FSSALYHG---RVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTG-LIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPF 1175          

HSP 3 Score: 130.568 bits (327), Expect = 1.453e-30
Identity = 163/656 (24.85%), Postives = 275/656 (41.92%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQ-C--QIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDID-GPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIG-LSVSDRDLKENGRVSCELKEDLQSLEL-KDVGGGFYDLWSTHPYDYE-------KEDLIKTLF--ECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRAT--DRDKSAELIYS-IDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELIT 2520
            + +++ DINDN P F +++    +PEN+   +I+ +  A+DKD     +V     + +       N N  +++     ++D E    Y  T++A +   G  TQ C  +++I + DENDN P+F+ + +   + E   VG  +L+V  +D D GP    T + ++        S  F I P TG + +  +L+  +R S +  ++ ASD   +        T+V I V+D+NDN P     A           I+  E    + L+  +S SD D   NG+V   ++   ++  + +D G    ++ S  P  Y          +L K  F     D G+P L    T+ I+I   N   P F    Y   +      G+ +L + A   DRD + ++ YS +     + F +D    L   + +  D    SI    V  +D    P ++     I + + N   P F    L+  + EN    + L  ++ ATD D   +N  + Y   +     L       F I   +G++  +  LD E    + ++V A D G   +   +  +I V D+NDN P       +N   +  P I E         A     +L + A+D D        Y L     ++F LN+ TG L T
Sbjct:  322 LEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLT-AVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSV--STLDRENVASYELTVKATD--RGSPTQHCTVKVLISVTDENDNSPRFT-QIFSAHVREDAAVGFPVLRVSTLDADEGPNAAIT-FSLLDP------SLPFSIHPSTGEITVSRRLNREDR-SGYAVKVRASDPAWTV------STDVTIVVDDVNDNAPRFGQTA---------YYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSG----EIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGD--AGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLA-RVTATDTDAG-VNGAIVYSIASGDGSGL-------FDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPM------LNASDYY-PVIPEN--------APSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTT 918          

HSP 4 Score: 111.309 bits (277), Expect = 1.031e-24
Identity = 152/583 (26.07%), Postives = 239/583 (40.99%), Query Frame = 1
Query:  589 SKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNR-VKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIG-LSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRT----IEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAE------LIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPE 2298
            S+ + IIS+   + N   P F      +S+PEN    S +    A D D       V S    D +  F I  ++ +   + L   +DYE + LY  ++ A +      T+C  V I + D NDN P  +   Y   I E+ P G  +L ++A+D D P    T Y +   G  +L    F ++  TG L  +  LD   +   ++  + A +   +   S      V + +  +N+  P         V+R       + E+ P    +G +  +DRD   +G V   L  + +S     V     ++  +   D E+E         ++ G  S++ +      + + I D N+ PP F +  Y G + E    G+ V+ V A D D          LI S +    + FSI+  TGLI  +  P DRE   +    V   D    P T   +V + + DVNDN P  L SS +  V EN      +   LN    D D   N   Y F  L      R     F +  ++G ++T   +DRE+ P + + V   D+GSP   +     + V D NDN  E
Sbjct:  737 SRATAIISV--TEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGD---VLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSL-DDGEADL----FVLNQKTGVLTTQGFLDYETK-QTYELTVRAFNYPDTFHYST---AQVHVQITGVNEYFPRF-------VQREY--NFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFS-VNEHTGEIIVSSQLDREREASATLRVIAKNAG--SIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAG--RAFSINAHTGLIVVA-SPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAK--VTENQPAGMTV---LNLEAGDPDLPPNKGPYTFQLLGSDPAWRGY---FSLS-SSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSE 1280          

HSP 5 Score: 96.2857 bits (238), Expect = 3.658e-20
Identity = 155/705 (21.99%), Postives = 274/705 (38.87%), Query Frame = 1
Query:  592 KNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFY------DLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYP----------NWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLK--LGT-YVLKFTARDNGVPPLSNDASITVHVQDNGRFA 2643
             +S  + + + D+ND+ P F     +   P ++   + +    A D D      ++      ++  F++D        +   +++   + +L      +   +   S    + ++  D  +  P+F+      +  E  P G  I  V A      +     Y + S GN   +   F + P +G + +   LD   +   ++  + A D   S F        + + V DINDN P            S     K+ EN P + ++ L+  D+D   NG+V   + +        ++G  F       ++ S    D E     +   +  D G P+      + I + D N+  P F    +   +RE+   G PVL V   D D+   A + +S+    L  FSI   TG I+ S    +RE  S    +V   D      T +  V I + DVNDN P F  ++      E  + +  L  +++A+D D D  N  V +          +R     F++   +GEI ++  L R + P           ++  V A D G P   + A  TI +   N N P ++  R            Y TP   ++        IL + A+D D +  G++ Y +   G+     +   G  + L + L    G+ + +   ARD G PPLS+ A+  + V +  ++A
Sbjct:  111 SSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRG---VIHAARALQGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAARSSR--RAGPVSYHLASGGN---LGDVFAVDPQSGEVSVHRALDHEYQHH-YELVVEARD---SGFPPFSAYLKLEVDVLDINDNAPEFS---------SSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIID-------GNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRF-TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLP-FSIHPSTGEITVSRR-LNREDRSGYAVKVRASDPA---WTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEA-LVARVSASDAD-DGANGQVFF---------FMRSQTENFRVGRDSGEIHSVRPL-RYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRER------------YSTP---VAATVRAGTRILDMSAVDPDRDVNGQIAYSV-VGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYA 752          

HSP 6 Score: 90.8929 bits (224), Expect = 1.590e-18
Identity = 95/359 (26.46%), Postives = 147/359 (40.95%), Query Frame = 1
Query: 1576 GKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSID-RKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPK-TANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQM-NNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD--NMFGLNETTGELITLVSPLK---LGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            G+P L    T+ + +ED N+  P F   E   ++ E+ P GS V  V ATD D     I S   R    HFS++  TG I T+    DRE       EV   D    P  +++  + + + DVND+ P FL +    +   +    T +      T RD D   N  +++         L       F + P  G I     L   +  + T+TV+  D G+P R A    T+  RD  +       PR  +F+        + P   I+ +A +                AG V Y+L + G+  ++F ++  +GE +++   L       Y L   ARD+G PP S    + V V D
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQIITT-ASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAV---FAVTARDADAGPNGDLRF--------SLSGSASAGFSVDPRRGVIHAARALQGPRD-DLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFRED------QPPGTTITVVAAR------------SSRRAGPVSYHLASGGNLGDVFAVDPQSGE-VSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLD 328          

HSP 7 Score: 79.337 bits (194), Expect = 5.777e-15
Identity = 108/458 (23.58%), Postives = 187/458 (40.83%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDS-TKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGC-----STQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPA-QKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWST------HPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNE----YLGSLRENTP-PGSPVLTVRATDRDKSAELIYSIDRKVLKHFSID-NKTGLISTSFVPFDREMTSIKQFEVNVK--DDKTNPKTANVLV 1917
            + ++I  +N+  P F   +    + E++ + + +    A D+D      V    F +S +K F+++    E   + +   +D E++   + TL+    + G        +  + + I D ND  P FS   Y   + E+  VG  ++ V A D D P   +T   ++  GN     R F I+  TG +++ S LD  + + ++   + A D  +   T     T V++ +ED+NDN P +           +  + K+ EN+PA   ++ L   D DL  N     +     Q L       G++ L S+       P D E++          D G P L    T+ + + D N+ P   ++      Y GS     P PG  +  VR  D D S      +       FS   N   LIS       +  ++  +FE++V+  D K +P T    V
Sbjct:  950 VHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGE---IIVSSQLDRERE--ASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDP-PVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGN---AGRAFSINAHTGLIVVASPLDRES-VPLYNLTVVAVDMGEPPATGT---TVVVVALEDVNDNGPFL-----------LTSSAKVTENQPAGMTVLNLEAGDPDLPPN-----KGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGS-----PFPGGFIGDVRPRDPDISDRFNCDLTSGPFNVFSFQPNTCRLIS-------QPRSAEGRFELSVRGSDGKHSPATTTARV 1366          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 229.565 bits (584), Expect = 7.259e-61
Identity = 208/683 (30.45%), Postives = 323/683 (47.29%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIG-LSVSDRDLKENGRVSCELKEDLQ--SLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSA--ELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKL---GTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            ++I ++DINDN P F+    +  + E+S     I    A D D S+   V+ Y   D+T  F+I+ S      + L+  +DYEK+  Y  T+ A +  T   +   +V + +DD NDN P+F+K  Y  T+ E+   G  +  V A D D     K  Y I+S GN N+    F +   TG +  +  LD    I+ +   I+A D    +F +    T V I + D NDN+PT           S F    I E+ P    +G L+ +DRD+  NG V+  +    Q  S +L D   G   + ST   D E       + +  D G P      +I + + DVN+  P F+ + + G +RE+    S VL V+  D+D+ +   +  S+  +   +F+ID+ TG +  S  P D E T+  Q  V  +D  +  K+A   VKI I++VNDN P F+  +    + E+V I T +  KLNATD D   +  F   E           +    F+I  ++G I     LDRE   N+T+ V+A ++GS     + NATI V D+NDN P +    P ++ +     ++E   I         + + K+ A D+DE +  +V Y L     + F +N  TG L+T   PL      +Y L+ TA D+G P  S  A+IT+ + D
Sbjct:  569 VTIALQDINDNSPIFQ-GPYVFRVSESSSPGHQIGQVAATDADDSSNGDVR-YALSDNTDVFSINTSTG---LITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILS-GNENMA---FAMDRFTGEITTRVPLDRET-IASYSLTINADDGSLVRFMAA---TTVNISIADENDNQPTF-------TGPSRF---NISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQL-DPRSGILSVRST--LDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDS-TGFV-LSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVV-KLNATDSDGTPLT-FDIVE----------GNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVF---NPGSYAKS----LHENLPIG--------QTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATG-LVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTIND 1195          

HSP 2 Score: 218.394 bits (555), Expect = 2.109e-57
Identity = 205/679 (30.19%), Postives = 313/679 (46.10%), Query Frame = 1
Query:  613 IEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRV--KSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCS-TQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSA--ELIYSI-DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKLGT---YVLKFTARDNGVPPLSNDASITVHV 2622
            I + DINDN P F  +     + EN+   + +    A D+D S    +     K  D    FTID S      + + KS DYE +  Y  T+QA +          Q+ I I+D ND+ P FS  +Y K I ES  +G  ++ V A D+D     + EY+++S GN   +   F I  ++GS+ + S+LD     S +  Q+ A D   +  +S      V I ++DINDN P   +  G  V R        + + P  ++  ++ +D D   NG V   L ++     + +   G   L +    DYEK+         +D G PS      +++ ++DVN+ PP F  + Y  ++ EN   G  V  V ATD D  A  ++ YSI        F++D  TG I+T  VP DRE  +     +N  D       A   V I I D NDN P F   S +F + E+    T++ G+L ATDRD    N  V Y  ++        +    FQ+ P +G +     LDRE  P++T+ VKA D+GSP +   A+  + V D+NDN P         F++ +  F  E     I + A  H  +L++K  D+DE   G +   L   G + F + ++TG +++  +PL   T   Y L  TARD G P  S  A + + +
Sbjct:  364 INVNDINDNPPVFSPSAYQSRVKENTPAGTQVS---ATDRDSSTNGALVFGIIKGNDD-GVFTIDGSTG---IISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLIS-GN---VKGAFNIDANSGSIRVSSELDRETTPS-YSLQVEARDGGSTSRSSST---RVTIALQDINDNSP---IFQGPYVFRVS------ESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSI-NTSTGLITLKT--QLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTR-VPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPS-RFNISEDSPTGTRV-GQLTATDRDIGP-NGAVTYAIIS-------GNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPR--------FEKSL--FSGE-----IREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTI-DSTGFVLSK-TPLDYETTAAYQLTVTARDGGSPSKSATAQVKITI 987          

HSP 3 Score: 194.897 bits (494), Expect = 3.563e-50
Identity = 192/686 (27.99%), Postives = 305/686 (44.46%), Query Frame = 1
Query:  598 SFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACE-DSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGR-VSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYS-IDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNM-FGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +F+  I + D+NDN P+F  +     + E+  + SI++   A+D D     R+        T  FT+D+  +    +  + + D E +  Y   L+A +  S   S Q  + I+I D NDN P FS   Y  ++ E   +G  ++ V A D D        Y   S GN N     F +   TG + +   LD   R S +   +S +D+     T   D ++++I+V DINDN P        V   S + + ++KEN PA   +  S +DRD   NG  V   +K +   +   D   G   +  +   DYE +       + +D G P   +   + I IEDVN++ P F  + Y   + E+T  GS V+TV ATD D      L Y  I   V   F+ID  +G I  S    DRE T     +V  +D  +  ++++  V I + D+NDN P+F      F V E+     ++ G++ ATD D D  N  V+Y      D         VF I  +TG I     LD EK   + +TV A D G+P+R +     + V D+NDN P++        +   +  + E  A  ++        +  + A D D    G++ Y + +  +NM F ++  TGE+ T V PL    + +Y L   A D  +       ++ + + D
Sbjct:  151 TFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGV----IRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTS-GNTN---HAFTLDAVTGVVTVSRSLDFEQR-SSYALGLSVTDRGSPPLT---DTSHLLINVNDINDNPP--------VFSPSAYQS-RVKENTPAGTQV--SATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSP--DYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSS-ELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQI-GQVAATDAD-DSSNGDVRYALSDNTD---------VFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFA-------KSLYTCTVGENLAAGVA--------VCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRV-PLDRETIASYSLTINADDGSLVRFMAATTVNISIAD 782          

HSP 4 Score: 181.8 bits (460), Expect = 3.913e-46
Identity = 189/681 (27.75%), Postives = 286/681 (42.00%), Query Frame = 1
Query:  610 SIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCEL-KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELI--YS-IDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKL---GTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +I + D+NDN P F       S+ EN  +   +    A D+D     +V        T  F +   N     +  ++ +D E Q  Y+  + A +      S    I + I+D NDN P+FS+  Y  T+ E+   G  IL+V A D D     +  Y I+S  + N     F+I   TG + +   +D    ++ +   ISA D     + S      V I V D NDN P   + A N     +   + I       ++  ++ +DRD   N +V   + + D  +  +  + G    L      + E            D G P +   + + + + DVN+ PP F +  Y+GS+REN+   + VLTV A D D  A  +  YS I     K F I++ +G+I T+  P D E  S    EV   D K   KT    V I ++++ND  P F   +    V+EN    T +  K++A+DRD           F +L    +       F I   +G I T  VLDRE    + I V+  D+G+P        TI + D NDN P+               F   + + +I + +       KL A D DE    R+ Y L  N   M G    +  +ITL  PL      TY L   ARD+G PP ++  +I V V D
Sbjct: 1086 TIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEV---NPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNA----FRIDSTTGRITVVGVVD-REALASYNLTISAKDSGVPPWVST---AFVAITVADENDNSP---IFASNETSYGIDEGVSI-----GSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGV---LTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTT-TPLDFEEKSQYGLEVTATDSKYTAKTN---VTIRVINLNDITPAFTQQNYTASVRENSPTSTSVV-KVSASDRDS----------FGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPK---------------FDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIG---ASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVID 1711          

HSP 5 Score: 178.718 bits (452), Expect = 3.329e-45
Identity = 195/692 (28.18%), Postives = 309/692 (44.65%), Query Frame = 1
Query:  592 KNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENG--RVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI----DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIR-HMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            K   ++ I++KD NDN P F  N  + +I EN+     + I  A D+D S  N   +Y        F + NS   +++      +D+E ++ YT  + A +   G  T    +I +DD NDN P F+   Y+  + E   VG  + ++ A+D+D     +  Y +VS       + YF +    G +  K   D   + S ++  + A D       S   +  V I + D+NDN+P         V  S   T  + E+      ++ ++ SD+D   N   R S        +  L  V G    +  +   D+E+           D G P L +   + I++ D+N+ PP F  + Y   ++ENTP G+    V ATDRD S    L++ I    D  V   F+ID  TG+IS +  P D E  +     V  +D     K     V I I DVND+ PVF  S+    + E+  I + +   + ATD D                +++LI  ++K  F I   +G I     LDRE  P++++ V+A D GS +R +    TI ++D+NDN P         FQ    P+++      +S+ +     I ++ A D D++  G V Y L  N D +F +N +TG LITL + L   K   Y++  TA+D G P  S+   + V V D
Sbjct:   51 KGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQ-VAIVTATDRD-SGTNAAITYSLFSGENKFMM-NSKTGEIRTVTP--LDHETKDSYTMRISAFD---GKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGD-----TSYFTVDSQ-GVIRTKGAFDRETKAS-YQVALRAQD---GGSPSRSGQATVEIEILDVNDNRP---------VFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGV---VTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQ---VSATDRDSSTNGALVFGIIKGNDDGV---FTIDGSTGIISIAKSP-DYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVV-TVTATDLDSGPRGRL---------EYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPI--------FQ---GPYVFR-----VSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTD-VFSINTSTG-LITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDD 677          

HSP 6 Score: 168.318 bits (425), Expect = 6.160e-42
Identity = 191/687 (27.80%), Postives = 300/687 (43.67%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVK-SYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISV--FKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENG--RVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRT-IEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSI-DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTN-GDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            I++ I D+NDN P F  +K  +++ EN+   S I    A D D  A  RV  S    +    F ID++     ++ +   +D E    Y  T+ A +       +   + I + DENDN P F+       I E   +G  +  V A D D     +  Y IV +G+    +  F I+   G L +K ++   NR +V  +   I ASD+     TS ++ T V   V D+NDN P         V  S      ++EN   +  ++ ++  D D+  N   R S     D +  ++    G    + +T P D+E+    K+ +  +     S    +T + I + ++N+  P F    Y  S+REN+P  + V+ V A+DRD    L YSI   K    FSID ++G+IST+ V  DRE+ S+   +V V D    P +    V I+ILD NDN P F  SS    + EN    +    KL ATD D +  N  + Y                 F I  ++G I     LDRE    + + ++A D G+P + +     + V D+ND++P           R   P               K   ++++ A D D      + + L +N   ++F L+ TTG++ T V PL   +   Y L+    D G P LS+ A + + V D
Sbjct: 1189 ITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTT---GRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIV-RGD----TSAFAINAMNGVLTVKKEI---NRETVPTYTLTIRASDRGSPMMTSDKELTVV---VNDVNDNPP---------VFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGV---IMTTTPLDFEE----KSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSGIISTADV-LDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILEN-SAPSSFSFKLAATDAD-EGTNARITYNL----------SRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQP---------------KETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKV-PLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVID 1816          

HSP 7 Score: 167.933 bits (424), Expect = 7.119e-42
Identity = 161/592 (27.20%), Postives = 273/592 (46.11%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACE-DSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWS----------THPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHIS 2340
            ++I + D NDN P F +N+    I E   + S + +  A D+D  +  +V        T  F I   N  +  L ++K I+ E    YT T++A +  S   ++  ++ + ++D NDN P F+ +SY  ++ E+      +L V A D D        Y I+S  +     + FKI+  +G ++  + LD   + S +  +++A+D   SK+T+   +TNV I V ++ND  P                T  ++EN P +  ++ +S SDRD                SL    VGG   D +S              D E   L        D G P L     + I I D N+  P F ++ Y  S+ EN+ P S    + ATD D+   A + Y++ R     F I   +G+I+ +  P DRE  S     +  +D  T P+ +++ +++ ++D+ND+ P+   SSL+  V+EN   +T +  ++ A+D D   +N  + +  ++          K VF +  TTG+I T V LDRE+   +T+ +   D G+P+  + A+  I V D +DN P +   +P  +   IS
Sbjct: 1294 VAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAI---NAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDE----KRFKINSTSGVIMTTTPLDFEEK-SQYGLEVTATD---SKYTA---KTNVTIRVINLNDITPAFT---------QQNYTASVRENSPTSTSVVKVSASDRD-------------SFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRN--DAFMIGASSGVITLA-QPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVM-RILASDADT-GLNAELTFSLLS-------NEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRF---QPTEYNVTIS 1834          

HSP 8 Score: 160.999 bits (406), Expect = 1.007e-39
Identity = 175/621 (28.18%), Postives = 275/621 (44.28%), Query Frame = 1
Query:  790 FTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGC-STQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKH-FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELITLVSPLKLGT---YVLKFTARDNGVPPLSNDASITVHVQD 2628
            FTID+S          +  D E ++ Y  T+ A + +  C   +  +VI + DENDN P+F   SY   I E+ P   ++  V A D D        Y + S  N+      F ++  TG +   + LD   + S +  +ISA D   + F         +I V+D+NDN P     A +V +  ++  + +        +  L+  D D+  N R+S  L     S    D  G    + +   +D E +   +     QD G PS     T+EI I DVN+  P F + +Y  S+ E+   G+ ++TV A+D+D    A+L YS       H F++D  TG+++ S    D E  S     ++V D  + P T    + I + D+NDN PVF  S+ Q  V+EN    T    +++ATDRD    N  + +  +   D         VF I  +TG I      D E    + +TV+A D G P ++  A  TI++ D+ND+ P +    P N+ + I     E+  I           ++ + A D D    GR+ Y L   N    F ++  +G  I + S L   T   Y L+  ARD G    S+   +T+ +QD
Sbjct:   12 FTIDSSTGS--ITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAA-QVAIVTATDRDSGTNAAITYSLFSGENK------FMMNSKTGEIRTVTPLDHETKDS-YTMRISAFDGKHTTFVP-------LITVDDVNDNAP---FFALSVYKTGVYEDVAV-----GSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGV---IRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSR-SLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT----QVSATDRDS-STNGALVFGIIKGNDDG-------VFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVF---SPSNYSKQIP----ESTVIG--------STVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGS-IRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQD 575          

HSP 9 Score: 132.494 bits (332), Expect = 5.103e-31
Identity = 127/488 (26.02%), Postives = 226/488 (46.31%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKF--EDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKH-FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVL-VKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCD 2052
            +++ + D+NDN P F +   I S+ ENS   + +    A D D  A N V  Y     +  K F I++++     +     +D+E+++ Y   L+     +  + +  + I++ + ND  P F++++Y  ++ E+ P    ++KV A D D   F    Y IV  G ++  S  F I   +G +     LD    +S++  Q+  +D      +++   T V I + D NDN P          + S + +  ++ + P+     L+ +D D   N R++  L  +   +    +G     +    P D E +       + +DHG P      TI + + D+N++ P   ++   GS+REN P  + V+ + A+D D    AEL +S+     K  F++DN TG IST  VP DRE  ++    + V  DK NP  ++V  V I+++D +DN P F  +     + E++     +   +  T RD D
Sbjct: 1398 LTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGA-NAVLRYSIISGNDEKRFKINSTSG---VIMTTTPLDFEEKSQYG--LEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIV--GGKD--SDKFSIDQRSGIISTADVLD-RELVSLYAIQVRVTDAGNPPLSNL---TWVTIKILDENDNSPKF--------DSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFM----IGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTK-VPLDREQQAVYTLRIGVA-DKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASI---VQVTARDID 1852          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 191.43 bits (485), Expect = 5.079e-49
Identity = 204/669 (30.49%), Postives = 295/669 (44.10%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFE--DSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTL-FECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKV-LKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLK---LGTYVLKFTARDNG 2580
            + + + D+NDN+P F  +   V   EN+ +   I    AID+D S K  +  +  E  ++ + F++D S L    + L K +D E Q+ Y  T++A +     S    IV I + D ND  P FSK  Y  TI E       I  V AI  D     +  Y I SKGN + I     +   TG+L L+S++D   +I      + A DK            NV I V DINDN P            S  + +++ E+ P       +SV D D    GRVS  L  +  +L   D   G   L  T   DY       TL  + QD G P       +E+ + DVN+Y P F N  Y   + E TPP S ++ V ATD D  ++  + Y+ D KV    F + N   +   S    DRE       +V   D  T  ++++  VK+ + DVNDN+P F  +S  FFV+EN  + T L G ++A+D D +  N  V Y F T             F +   TG+I T  VLDRE   ++  ++ A D GS  R      T+ VRD+ND  P+               F     ++ +++       +L L A D D+        Y+   G   F LN+ TG ++TLVSPL       ++L   A D G
Sbjct:  585 VHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRD-SPKFAITRFIIEQGNADEVFSVDGSGL----ITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSI-SKGNTDNIV----LINSTGTLYLQSEVD-HEKIPSLYLTVQAKDKGTPPLFGY---ANVTIAVIDINDNSPQFN---------SSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSL--TKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIFIKS--KLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYL-GAVSASDSD-EGSNGHVTYRFDTQVAQ---------FIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPK---------------FSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTG-VLTLVSPLDREVTHRHILHVVASDKG 1199          

HSP 2 Score: 175.252 bits (443), Expect = 5.521e-44
Identity = 181/651 (27.80%), Postives = 293/651 (45.01%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKF--EDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACE-DSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQ-KLIGLSVSDRDLKENGRV--------SCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKV-LKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNF-VKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTG 2508
            I I + D+NDN P F       ++PE   + S++    A+D D     +V+ YK    ++  TF I+ +      L   +++D+E  N Y   + A +       T  Q+V I ++D NDN P F K      I E+ P+   +  ++A D D    ++  Y I S+  R     +FKI+ +TG +     +D    IS +  ++ A+D+  ++   + +   + I ++D+NDN P         V R++     + E+EP   ++  ++  D D  + G V        + +   DL++  LK +G            DYE            D G P L  Y+   + + DVN+ PP F  + ++G++ EN P G+ V+ V A DRD    AEL YSI   V +  FSID  +GLI T+ +  DRE        V+        + ++  V+I ++D NDN P F+   +   V EN   +         T +D D  NN  V Y  M+        +    F I  +TGE+ T   LDRE   ++ ++V+A D   P   AFAN TI++ D NDN P         FQ+     +Y +    IS++      IL L A D+D    G + Y L  +   ++ ++  TG
Sbjct: 1210 IEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVR-YKIVNGNTDGTFKINETTGVISTL---RALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPR----AHFKINSETGLIQTTHPID-REEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKF-------VSRNL---TYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGS----------LDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSI-LDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARL----IYTLTVQDLDYGNNTKVLYSIMS-------GNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPV--------FQQS----LYSS---TISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTG 1804          

HSP 3 Score: 163.696 bits (413), Expect = 2.021e-40
Identity = 183/678 (26.99%), Postives = 288/678 (42.48%), Query Frame = 1
Query:  580 GSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEK-QNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCEL--KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSA--ELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRF-AFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY-YLQTNGDNMFGLNETTGELITLVSPLKL---GTYVLKFTARDNG 2580
            G  S N  I++I + D+ND  P F   +   +I E+S  +S+I    AI +D      V     + +T    + NS      L+LQ  +D+EK  +LY  T+QA +  T        + I + D NDN P+F+  S    + E  P+G     V   D D     +  + ++S          F +  +TG+L L   +D  N    +   + A D      +S      + + V D+ND  P      GN    +  L    +   P   +I +  +D D  ENGR+S     K D     L++ GG  +        D E+ +L K +    DHG P       +++ ++DVN+  P FQ   Y   ++EN P  + +  V A+D D+ +   + Y  D +V + F +D +TG I+TS V  DRE  +   F +   D  ++P+     V + + DVND  P F  +     V E++ + + L   L ATD D    N+ + Y         +I      F +   TG +  +  LDRE      + V A D G            I V D+NDN P                FI ET    + +      ++  + A+D D+ D G+V Y  +  N D  F +NETTG +I+ +  L       YVL+ +A D G
Sbjct:  680 GQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINST---GTLYLQSEVDHEKIPSLYL-TVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNP-----GTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSST---AMLELKVVDVNDYSPVF----GNWSYTAHVL----ETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRN-GGKIFIKSKLDREDIEEYNL-KVI--AIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ-FIVDKQTGKITTSQV-LDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLL-TLIATDDDQQGPNSDITY---------MIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPV---------------FINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTG-VISTLRALDFEVTNRYVLRVSATDMG 1305          

HSP 4 Score: 162.925 bits (411), Expect = 2.813e-40
Identity = 196/713 (27.49%), Postives = 307/713 (43.06%), Query Frame = 1
Query:  598 SFIISIEIKDINDNKPYF--RTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQK------------------SIDYEKQNLYTGTLQACEDSTGCSTQ-CQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRVSCELKEDLQSLELK-DVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSI-----DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVR--DLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELITLVSPLKLGT---YVLKFTARDNGVPPLSNDASITVHVQD 2628
            S+ + + ++D+NDN P F   T+ ++V    + D    +    A+D DF +          +ST+++TI + N+ ++   + K                   +D E+ + Y   + A +     +    ++ I ++D NDN P+FS  SY  TI E+  VG  IL+V A D D     + +Y I +  +   I   F I P TG ++   +LD   + S +   + A DK  S    +     V I V D+NDN P I       V  ++  + ++ EN     ++  +SVSD D  +NG V+  L+       +K DV      +      D E  D       C D G P     ++  I++ DVN+  P F  + Y   + EN    + V  V A D+D   ++EL+Y+I      R  L  F+ID  +G+I+T+    DRE        V V D  + P + N  V + + D NDNDP F  SS    + EN    + +  +L A D D  + N+ + Y  +T           P F + P  G +     LD E   ++T  V A D G  +     NAT++V   DLNDNQP +             P  Y       + I +    I +LKAID+D        + + Q N D +F ++ +   LITL   L   T   Y+L   A D G     N A + + V D
Sbjct:   41 SYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLI---AVDSDFGS----------NSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAI---FGIHPTTGVIVNNVRLDYEAKRS-YLIVVKAEDKGSSH--QLSSSAIVRIEVLDVNDNNPVIH------VSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTA-TDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVV-QLLAQDPDIGE-NSLILYSILT--------PNTPFF-LDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRS----CNATVHVSLTDLNDNQPVF------------DPSSYSVEYFENTRIGQS---ICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGS--GLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLD 695          

HSP 5 Score: 147.132 bits (370), Expect = 2.397e-35
Identity = 177/696 (25.43%), Postives = 293/696 (42.10%), Query Frame = 1
Query:  595 NSFIISIEIKDINDNKPYFRTNKQI---VSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLF-LQKSIDYEKQNLYTGTLQA-CEDSTGC--STQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQK-LIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKH------FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKLG----TYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +S I+ IE+ D+NDN P    +  +     + EN+ + + +      D D S KN   +   E     F++    L D  +  + +S+D E  + +   L+A C D      +T+    I + D ND  PKF + +YE  + E+  V   +  V A+D D    ++  Y I +         +F I P +G +   + LD   +I      +   D+     +   D  +VI+++ D NDN P     + N    S+F      EN P+   ++ L   D D+ EN  +   +        L    G    + ++   D+E +          D G  S     T+ + + D+N+  P F  + Y     ENT  G  +  ++A DRD      ++I R +++       FS+D  +GLI+ + +  DRE        V   D          +V I +LDVND  P+F  +   F +QE+ +  + + G ++A  RD    N  V Y         ++        +  +TG +     +D EK P+  +TV+A D G+P  F +AN TI V D+NDN P++          + S  +   P     D    H     +   D D    GRV + L +N   +F L+  TG L +L   +  G    +Y L   A+D G PP S+ A + + V D
Sbjct:  261 SSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDAD-SGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFF--LKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLD-REQIPQVVLTVLVHDRGSPPLS---DNCSVIVNLTDSNDNDPYFNQSSYNA---SLF------ENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDPRKGL---VTNSRTLDHEVQSSYTFQVAATDGGGRSCNA--TVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPK---FAITRFIIEQGNADEVFSVDG-SGLITLAKL-LDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVI-GHVHAISRD-KGTNAEVVYSISKGNTDNIV--------LINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQF----------NSSSILVRLP----EDTPIGHTF-YTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGAL-SLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVD 904          

HSP 6 Score: 144.821 bits (364), Expect = 1.129e-34
Identity = 155/587 (26.41%), Postives = 261/587 (44.46%), Query Frame = 1
Query:  595 NSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNI-PKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFY------DLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSA--ELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQ---FEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQ-MNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRP 2316
            N+  + I I+D+NDN P F  ++ +  + E+      +    A+D D      V+       T  F++D   L+   L L  S+DYE    YT  + A +  +   T  Q+   +  + ++  P+F+++ +  T+ E+ P G  ++KV A D D     +  Y I S    +     F I   +G ++  S LD   + + F    +       + +S    T+V I+V D NDN P            S  +T+K+ EN PA+ +  L+V D D   N +V       L S+   +  G F       +L +T   D E +   +   + +D   P    +  I I IED N+ PP FQ + Y  ++ E TPPG+ +L + A+D+D  +   ++Y++       +SID++TG++ ++     R  TSIKQ   F    KD   +PK A V V+I+I D N++ P F  +  +  +  N    + L   + ATD D D+  N  V Y    L D K   +   +F +   TG + T             + + A D GSP    +    I + ++ D+ P ++   P
Sbjct: 1420 NTATLKIIIQDLNDNAPKF-VSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLD---LKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMD----KFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSS----TSVRINVMDRNDNPPKFI---------SPVVTLKVPENSPARLIYTLTVQDLDYGNNTKV-------LYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAA----RFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTS-ASALVTMVTATDADTDKSTNGKVTYR---LDDSK---NSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTP 1967          

HSP 7 Score: 141.739 bits (356), Expect = 8.838e-34
Identity = 177/685 (25.84%), Postives = 297/685 (43.36%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFR----TNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKT--FTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLK-ENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYE-KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI-DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKD-DKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTR---FAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSN 2598
            ++ +++ D+ND  P F     T   + + P +S+++ ++    A D D     R+ SY F+    T  F + N      K+F++  +D E    Y   + A +  T   S+   + + +DD NDN P F + SY   + E+ PV   +  V A D D        Y+  ++  +      F +   TG +     LD   + S + F I A+D   S      D+T V + V D+ND  P           ++ + ++ + E+ P    L+ L  +D D +  N  ++  +    ++  L  V G    L    P D E     I  +      G  SL+    IEI++ DVN+  P F N     ++ E  P GS V  V A D D+    ++ Y I +      F I+  TG+IST     D E+T+     V+  D  K   KT+  LV I + D NDN P F  + +  ++ ENV I T +   + A D D   +N+ + Y   +       +  +  F+I   TG I+T   +DRE+   +++ V+A D     +   +  A   I ++DLNDN P+++  R + +     PF ++               +  + A+D D    G V Y + +     F L+  TG ++ L+  L    +  Y L  +A D G PPL++
Sbjct:  897 MLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVV----ATDVDSGENGRI-SYAFDSKVDTSKFGLRNGG----KIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ------FIVDKQTGKITTSQVLDREAKAS-YVFSIVATDGGSSPRV---DKTQVTVIVRDVNDCSPKFS--------KNKY-SVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGV---LTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVIST-LRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVT-TIKAHDDDS-GLNSRIWYTIDS-------QSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFV-SRNLTYVMEDEPFNFQ---------------VTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTG-VLKLIGSLDYEDVPQYTLHISATDLGSPPLTS 1523          

HSP 8 Score: 135.191 bits (339), Expect = 8.758e-32
Identity = 179/691 (25.90%), Postives = 283/691 (40.96%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENS--DLVSIIKIEGAIDKDFSAKNRV-KSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQ-CQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVS---DRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLG-SLRENTPPGSPVLTVRATDRDKSAELIYSI-DRKVLKHFSIDNKTGLISTSFV-PFDREMTSIKQFEVNVKDDKTNPKTAN--VLVKIEILDVNDNDPVFLLSS-LQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAI------------NISDIAEKHKLILKLKAIDQDENDAGRVCYYLQ-TNGDNM-FGLNETTGELI---TLVSPLKLGTYVLKFTARDNGVPP 2589
            + I + D NDN P F +    + +PENS   L+  + ++   D D+    +V  S    ++   FTI  S  E   L     +D E +  Y  ++QA + +    T    I I I+D+NDN P F +  Y  TI E  P G  IL + A D D        Y +      N     + I   TG +   ++ + S +     F I+       K   V  R    I +ED N++ P                 + I  N  A  L+ +  +   D D   NG+V+  L +   S  L  V      + ++  +    +         +DHG P L+ Y  ++I I ++ + PP F N      S+ EN+  GS + TVRA      A++ YSI      + F +D  TG+IS +     D E T  K F +++        + N  +++ I ++D NDN P F  S+ L    ++    K +   K+ ATD D    N  V Y   T        +   VF I  TTGEI T  +LDRE   ++ + ++  DSG P +       + V DLNDN P +     +N +         T  +            N+   +     IL++ A DQD     ++ Y    TN D + + ++  TG +    T+   ++     +   A D GVPP
Sbjct: 1632 VRINVMDRNDNPPKFISPVVTLKVPENSPARLIYTLTVQ---DLDYGNNTKVLYSIMSGNTDGAFTIGRSTGE---LSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTL-----SNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVR----IKIEDKNNHAPQFTKTP---------YEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRAR-ASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYEST--KNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDS-GTNGKVTYSIWT-------GNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPP 2287          

HSP 9 Score: 128.642 bits (322), Expect = 1.060e-29
Identity = 183/721 (25.38%), Postives = 293/721 (40.64%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRTNKQI-VSIPENSDL---VSIIKIEGAIDKDFS----AKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKE--ILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDK-LKSKFTSVEDRTNVIIHVEDINDNKPTIKVLA----------GNVV--------ERSMFLTIKIKE-NEPAQKLIGLSVSDRDLKENGRVSCELK-EDLQSLELK-DVGGGFYDLWSTHPYDYE-KEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS---AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY-YLQTNGDNMFGLNETTGELITLVS----PLKLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRF 2640
            I+ I I +I D+ P F       VSIPENS +   ++ ++   + D   +    + N+ +++  +  T   ++ +++          ++DYE    +   L A            I+ I + D NDN P F   +    + E     K   ++KV A D+D     K  Y I + GN   +   F I   TG +     LD     S F   I  +D  +  K T+ +    V + V D+NDN P    L+          G VV        ++   LT  +K  + P   ++ +S +D+D   N ++       +   ++ K D   G      T   D   ++  I+   +  D G P  +    + I I       P F+   Y G + EN   G+ VLTVR TD         + Y+I+     +F I  ++G+IS +  P D E        V+  DD    K   V V I + DVND  PVF  S       E + + T +   ++A D+D    N  V +   +  D       K  F I   TG I T   LD E      ++V+A D GSP      + TI V DLNDN P +  P P + Q      + E   +N          + ++ A D+D     R+ +  +   G  +F +++ +G L T ++       +  Y L   A D G PPLS++ +I V+V D   +
Sbjct: 1947 IVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPFTGVISVASAD----------ALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWT-GNEAGV---FTIDSTTGEITTAKLLDRETTAS-FDLVIRGTDSGIPPKSTNCQ----VKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRT--IDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIIT----REPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENS--NYFRIGQRSGVISVN-KPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVV-NVSAADKDS-GANGRVWFAIQSGDD-------KGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQ------VLENLPLN--------SRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEY 2616          

HSP 10 Score: 123.635 bits (309), Expect = 3.340e-28
Identity = 170/690 (24.64%), Postives = 275/690 (39.86%), Query Frame = 1
Query:  580 GSYSKNSF-IISIEIKDINDNKPYFRTNKQIVSIPENSDLVS---IIKIEGAIDKDFSAKNRVK-SYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGC-STQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKG----------------NRNLISRY-----------FKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLA--GNVVERSMF----LTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAE-----LIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQ-FFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYP--NWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTG 2508
            G  S N + I+ I + D NDN P F  +  +  + E++       ++K+  A D D     +V  S    +    FTID++  E   +   K +D E    +   ++  +      ST CQ+ + + D NDN P F   S E  I E    G  +  V A D D  K ++  Y + S                    N   +Y           +KI  DTG +  +  +D+  R S  +  + A D+              +++V  I   +P  ++ +  G V E +M     LT+++ +N     L             GR+S  + E+     +    G    +    P DYE +     +    D   PS      + I++ DVN+  P F  + Y+    E  P G+ V+ V A D+D  A       I S D K    F+ID KTG+I T     D E        V   D+ + P   +V V I +LD+NDN PVF +       V EN+ + ++L  ++NATDRD    N  + +  +      L       F I   +G + T +  D E      +++T+KA D+G+P   +     + V D ++  P        +F R    F       ++   A+    + ++ A D+D  D GRV +       N   +N TTG
Sbjct: 2043 GWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVT-ATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGE---ITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLS-EVNIREDTRTGAVVTSVVATDTD--KESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPP-------QRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPL-------------GRISYNI-ENSNYFRIGQRSGV---ISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDK--GSFAIDRKTGVIRTQRA-LDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLY-EINATDRDS-GANARLSFTVIGGTGQGL-------FLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDP--------SFNRMDYKF-------DVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNALKMNATTG 2674          

HSP 11 Score: 118.627 bits (296), Expect = 1.192e-26
Identity = 171/685 (24.96%), Postives = 283/685 (41.31%), Query Frame = 1
Query:  637 NKPYFRTNKQIVSIPENSDL-VSIIKIEGAIDKDFSAKNRVKSYKFEDSTKT--FTIDNSNLEDLKLFLQKSI-DYEKQNLYTGTLQACEDSTGCS-----TQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD----KSAELIYSID--RKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFL-LSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTG--EIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQT-NGDNMFGLNETTGELIT--LVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            N P F  +  I ++ EN     S++K+  A D+D S  N   +Y      +   F+ID  +     L +  SI D EK++ Y  T+ A    TG S     +   + I + D NDN PKF        + E+ P  + I  +   D+D     K  Y I+S GN +     F I   TG L   ++LD   + S ++  + A D     +T+     N+ I +ED NDN P        V ++S++ +   +   P   ++ L+ SD+D   NG +   L  D   +   D   G   ++S   ++   +         +D G+        + I IED N + P F    Y   +  NT   + V  V ATD D     + ++ Y +D  +     F +++ TG + TS   F           +  +D  + P     +V+I I ++ D+ P FL  +  +  + EN K+     G    T R     +  V Y  ++        +    F + P TG   + +   LD E   N+ + + A   G  +   +    I V D NDN P +    P N    ++    +T A        K + ++K+ A D D    G+V Y + T N   +F ++ TTGE+ T  L+      ++ L     D+G+PP S +  + V V D
Sbjct: 1537 NPPEFTRDLFIGTVSENKPTGTSVVKVT-AYDRD-SGSNAELTYSIPSGVEMDKFSIDKHS----GLIVTNSILDREKKDTYFLTVHA----TGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSP-ARLIYTLTVQDLDYGNNTKVLYSIMS-GNTD---GAFTIGRSTGELSTTTKLDRETKAS-YQLSVQAKDITPPYYTAF---ANITIFIEDQNDNPP--------VFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGI--VYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTS-AGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKV-----GSYITTVRARASSDAQVTYSIIS-------GNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAF---HPSNMLAQLAE---DTGAF-------KPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTD 2166          

HSP 12 Score: 115.546 bits (288), Expect = 8.188e-26
Identity = 136/501 (27.15%), Postives = 227/501 (45.31%), Query Frame = 1
Query: 1204 QISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGR-----VSCELKEDLQSLELKDVGGGFY-DL---WSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKH--FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPK-TANVLVKIEILDVNDNDPVFLLS---SLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD-----NMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQDN 2631
            ++SA +    +F++      V+++V+D+NDN P+       V   S  L +   + +  QKLI +   D D   N       VS  +    + +  +D  G  Y DL    S+   D E+ D         D G P+   +  + I +ED N+  P F N  Y G++ EN   G+ +L V A+D+D   +AE+ YSI+        F I   TG+I  + V  D E        V  +D  ++ + +++ +V+IE+LDVNDN+PV  +S      + V EN  I T++  +++ +D D  + N  V    +TL        MK  F +      I     LDRE + ++ +     D G P R    +  I V D+ND  P+        F RH     YET    + + A  + L+  + A+DQD      + Y +    +     + F ++ ++G +IT  + L   ++   VL     D G PPLS++ S+ V++ D+
Sbjct:   24 KVSAYNLTIVEFSTPPKSYTVLVYVQDLNDNSPSF------VRGTSAKLVVFENDKDFRQKLIAV---DSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNN-VRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQV-ARVSVSDADSGK-NGEVN---VTLEGGDGYFSMK--FDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPK--------FDRH----TYET---RVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSG-MITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDS 491          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 181.8 bits (460), Expect = 3.956e-46
Identity = 185/657 (28.16%), Postives = 283/657 (43.07%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFE--DSTKTFTIDNSNL---EDLKLFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLA-----GNVVERSMFLTIKIKENEPAQKLIG-LSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI-DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY-YLQTNGDNMFGLNETTGELITLVS 2529
            + +++ DINDN+P F T    + I E+ D+ +   I  A D D +  N    Y     D+T TF++  +       L +  +K +D E  + Y   + A +  T      C I I I DEND+ P F++ SY  +I E+   G  IL+V A D D       +Y I     ++  +  F +   TG +  K  LD   + S + F + ASD       S  D   V I+V D NDN P +K+       G+   RS        EN      I  + V+D+D   N +   ++         K    GFY +    P D E            D G PS      + I + DVN+  P F +N Y  ++ E    GS VL + ATD D+     + YSI     L  F +D ++GL++T+  P DRE  S     +  +D  + PKT +  V + I+D NDN P F+ SS +  + E   I   +  +++ATD D    N  + YE            +  +F++   TG + T   LDRE    ++ TV A D G P   +     + + D+NDN P + YP     +   S    E P             +L++ A D DE     + Y  +  N +  F ++ +TG + TL S
Sbjct:   81 VQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPD-AGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQS--NSIFDLDSSTGVIRTKQNLDFEVKNS-YTFNVIASD---GGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRS--------ENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTA-KPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVL-QVSATDVDSGD-NGRITYEI-----SSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF-YP----VEYFASIMENEPPG-----------KLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLAS 698          

HSP 2 Score: 169.859 bits (429), Expect = 1.974e-42
Identity = 195/701 (27.82%), Postives = 293/701 (41.80%), Query Frame = 1
Query:  580 GSYSKNSF-IISIEIKDINDNKPYFR--------TNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGC-STQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQ---KLIGLSVSDRDLKENGRVSCEL-KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSID---RKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKLG---TYVLKFTARDNGVPPLSNDASITVHV 2622
            G  SKN    ++I + D NDN P  +         +K I S  ENS + + I      DKD S  N     K  +           L    + LQK +D E    Y  TL   +      ST   ++I + D NDN P F+  +Y   I E    G  +L++ A D D        Y I   G  +L   +F++   +G +     LD   ++S     I+A D   +  T     T V + + D NDNKP           R M  + K   +E A     ++ +S +D D  +NGR++ E+   D Q   L ++      LW+    D E + L       +DHG P L     +E+ I D+N+  P F   EY  S+ EN PPG  +L V ATD D+    + S D        +FSID+ TG+IST     D E+       ++ KD          +V + +L+  DN PVFL     F V ENV  K  L G++ AT +D    N  + Y  ++     L       F +  T G I+    +DRE+   + + V A         A A   I V D NDN P+               F   +  ++I       +++    A+D D    G V Y L +N + +  +N T+G +I L   L  G    Y ++  A D+G PP    +++T+H+
Sbjct:  289 GVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRS--ENSLINTNIAYILVTDKD-SNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSIT--GGNDL--GWFQVDFQSGLVTTAKPLD-REQVSSVTITITAQDHGSAPKTG---STTVTVTIIDGNDNKP-----------RFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGK-LLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVIST-LASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVP-KGTLVGRVYATTKD---KNGSISYAIVSGDPTNL-------FLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQ---------------FSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSG-VIKLARKLTDGDETQYTVQVLASDSGSPP--QHSTMTIHI 936          

HSP 3 Score: 167.933 bits (424), Expect = 6.792e-42
Identity = 185/699 (26.47%), Postives = 303/699 (43.35%), Query Frame = 1
Query:  583 SYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKT--FTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCST-QCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPT---IKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCEL--KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSI-DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKL--NATDRDCDQ-MNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-QTNGDNMFGLNETTGELI---TLVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQDN 2631
            S S   F++ I++ D+NDN P F +N    +I E +   S +    A D D    N   SY          F +D    +   +   K +D E+ +  T T+ A +  +   T    + + I D NDN P+F K SY+ TI E   +G  +L+V A D+D     +  Y+I S   +  ++  F+++  TG L  KSQLD   + S++ F + A D    +  S      V + + DINDN P    ++  A             I ENEP  KL+ ++ +D D   N  +S ++    +  +  +    G    L S    D+E E+    +   +D G     +   + + + +  +  P F    Y  ++ EN P G+ V  V AT +DK+  + Y+I        F +D+  G+I  +    DRE  +     V  +     P +A   V IE+LD NDN P F  SS+   +       T L G++  NA   D D   N  V+Y+        L  + + +  I  T+G I+    L       +T+ V A DSGSP +   +  TI++    ++ P++     +       P  Y+                  + A+DQD    G++ Y + Q N + +FG+    G+L    +L+  LK G+Y L   A D GVP  S    +T+++QD+
Sbjct:  404 SRSTLGFVL-IDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPD-EGDNGTVSYSITGGNDLGWFQVD---FQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQ--VNGLFELNTQTGVLWTKSQLDRETK-SLYSFTVLAKDHGDPQLMS---SVKVELTISDINDNAPVFYPVEYFA------------SIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLAS---LDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKNGSISYAIVSGDPTNLFLVDSTGGIIKING-DMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDID-----GTWLVGQVVYNAAAVDLDAGKNGLVRYQ--------LTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQ--HSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQ---------------FFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFP-GGKLYIRKSLLQALK-GSYDLIVRATDGGVPSFSASVPVTIYIQDS 1043          

HSP 4 Score: 147.132 bits (370), Expect = 1.678e-35
Identity = 138/490 (28.16%), Postives = 211/490 (43.06%), Query Frame = 1
Query: 1261 NVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELK--EDLQSLELKDVG---GGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSA--ELIYSIDRKVLKH---FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSL------QFFVQENVKIKTKLEGKLNATDRDCDQMN------------NFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNM--FGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            +V + V+DINDN+P    L         + T++I+E+        + + +D D   NG V   +   ++  +  L       G    + +  P D E  D  +      D G P+L  Y  I I I D N++ P F  N YLGS+ ENT PG  +L V A DRD  +  ++ Y+ID   ++    F +D+ TG+I T     D E+ +   F V   D     K     V I +LD NDN P   ++ L      +    EN  I T +   L  TD+D +  +               K EF+  Y    I+  KP                LDRE  P + +T+   D G P+R       I V D+NDN P                F       NIS++A+    +L+L A D DE D G V Y + T G+++  F ++  +G L+T   PL   ++ +  +  TA+D+G  P +   ++TV + D
Sbjct:   80 SVQVQVDDINDNEPRFPTL---------YYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTK-QNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYIL-VTDKDSNTNSQTELKITNGDDEGCFKVEFLGFY---FIQLQKP----------------LDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPA---------------FTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSI-TGGNDLGWFQVDFQSG-LVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIID 522          

HSP 5 Score: 132.109 bits (331), Expect = 6.213e-31
Identity = 176/709 (24.82%), Postives = 304/709 (42.88%), Query Frame = 1
Query:  586 YSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKF--EDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGC----STQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTL-------FECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPV--LTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREM--------TSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD--NMFGLNETTGELITLVSPLKLGT---YVLKFTARDNGVPPLSNDASITVHVQD 2628
            Y+  + ++++ + +  DN P F       ++ EN    +++    A  KD   KN   SY     D T  F +D++      + +   +D E++  Y   L A     G     S Q  + I++ D NDN P+FS  S    I  ++ VG+ +    A+D+D  K     Y++ S     L      I+  +G + L  +L   +    +  Q+ ASD       S    + + IH+  ++ N P    L       S ++T  +     + +   +   D+D  +NG++   + +  +         G + ++      Y ++ L++ L           D G PS      + I+I+D N++   F NN +  ++ EN+ PG+ V  L   A D  ++ +++YS+      HF++D ++G I+T  V  DRE           I Q E    D  T  K    +V + + D+NDN PVF  +     V E + +      ++ A D D      F    F +L     +      F I  +TGE+     LDRE   ++ + VKA D+ +   ++ A   I V D ND +P  ++P                  +NI++ A    L++ L A D+D    G + Y + +NG+   MF +   TG LI +   L   T   Y L  TA+D+G+ PLS+  ++TV+V D
Sbjct:  720 YAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD---KNGSISYAIVSGDPTNLFLVDSTGG---IIKINGDMDREEKAQY---LLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLW-----INSTSGVIKLARKLTDGDETQ-YTVQVLASDS-----GSPPQHSTMTIHIT-LSINHPPKFTL-------SSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEE--------GLFGIFPGGKL-YIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSE-SHFAVDVRSGQITTR-VRLDREELIKNTGSNVYIMQAEAMYND--TTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSE-LSLPGSPVFRIKAMDADEGDNAKF----FYSLVSGTGMDK----FFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRP--VFPE-------------SDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSI-SNGNLAAMFDVESATGRLI-VAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLD 1361          

HSP 6 Score: 127.872 bits (320), Expect = 1.189e-29
Identity = 139/609 (22.82%), Postives = 251/609 (41.22%), Query Frame = 1
Query:  823 KLFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRI--SVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKH-FSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYP----NWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVS-PLKLGTYVLKFTARDNGVPPLSNDASITV 2616
            KL+++KS+    +  Y   ++A +      S    + I I D ND+   F   ++   + E+   G  +  + A  +D  +     Y ++S         +F +   +G +  + +LD    I  +     I  ++ + +  T   D+  VI+ V D+NDN P        V  R+++     + + P   +  +   D D  +N +    L      ++   +     +L  +   D E       + +  D    +L     IEI + D N+  P F  ++Y  ++ E+   GS V+ + A+D+D  ++  + YSI    L   F +++ TG +  +    D E T + +  +  +D    P ++ V V + +LDVNDN P+F    +   V+ENV     + G+  A+DRD    N  + +   +    K        F +   T EI T+  +D E  P    ++ + V A D GSP      + T+ V D NDN P ++ P          P      ++N          ++ + A D D N  G+V Y + +  +  F L+ +TG+L  +   P     Y L   A D G P       ++V
Sbjct: 1001 KLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISS------ESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAP--------VFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSG-TGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVA-KSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPV-GRCTASDRDTG-TNAHIAFSMYSQTPSK-------TFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSP----------PAAAAGSSLN----------VMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQLTIQASDGGQPSRQTQTVVSV 1564          

HSP 7 Score: 127.102 bits (318), Expect = 2.529e-29
Identity = 173/712 (24.30%), Postives = 292/712 (41.01%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQ-CQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLT----IKIKENEPAQKLIGLSVS-------DRDLK--------------ENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYS-IDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYP-RPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCY--YLQTNGDNMFGLNETTGELITLVS------PLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            ++IE+ D NDN P F T+  IV I     +  ++    A+D D + KN +  Y+   + +     NS    +KL  + +   E Q     T+Q     +G   Q   + I I    ++ PKF+  SY   ++ S P+  +   V A+D D  K  +  Y I  +GN   +   F I P  G L ++  L L      +   + A+D     F++      V I+++D ND+             RS+F+       + EN     L+G  V+        +D+                +G+++  ++ D + L +K+ G   Y + +   Y+   +  IK             ++   + + + D+N+  P F    Y  ++ E + PGSPV  ++A D D+   A+  YS +    +  F I++ TG +  S    DRE TS     V   D       +   ++I + D ND  PVF  S     + E+  I + L   LNA+D+D  Q N  +KY            ++  +F +   TG +     LD E    + +T+ A D G     +  N T+ V D+NDN P  ++P +P+               + + +       + +  A D+D      + +  Y QT     F +N  T E+ T+ +      P    ++ L   A D G P LS   SITV V D
Sbjct:  830 VNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLD-AGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQY----TVQVLASDSGSPPQHSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSI-PQGNEEGL---FGIFPG-GKLYIRKSL-LQALKGSYDLIVRATDGGVPSFSA---SVPVTIYIQDSNDH-------------RSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREEL-IKNTGSNVYIMQAEAMYN---DTTIK-------------RDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKT-LDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGS-LVINLNASDKDIGQ-NGLIKYSISN-------GNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAP--LFPTQPV--------------TLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTP-SKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTD 1470          

HSP 8 Score: 118.627 bits (296), Expect = 8.921e-27
Identity = 152/595 (25.55%), Postives = 242/595 (40.67%), Query Frame = 1
Query:  925 IVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGS---LILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKED-LQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQ------NNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFV---------PFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYL-----QTNGDNMFGLNETTGELITLVSPLKLGT---YVLKFTARDNGVPPLSNDASITVHVQD 2628
            + +Q+DD NDN P+F    Y   I ES  V        A D D       +Y I S  N    S      P TGS   +I K  LD       ++  I+A+D+             + I + D ND+ P        V  ++ +L    +  +P   ++ +S +DRD   NG +   +  D +QS  + D+      + +    D+E ++         D G PS  +  T+ I++ D N+  P  +      +N       EN+   + +  +  TD+D +        +  LK  + D++ G     F+         P DRE+       +NV D     ++    V I++ DVNDN P F  ++    + E  +  + +  +LNATD D +  N  V Y      D          FQ+   +G + T   LDRE+  + TIT+ A D GS  +      T+ + D NDN+P                F+  +    IS+ A     +L++ A D D  D GR+ Y +     Q NG  +F LN  TG L T  S L   T   Y     A+D+G P L +   + + + D
Sbjct:   81 VQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACP-TGSTLCVITKKPLD-RETTDFYQLNITATDRGTPALMG---YCLINITILDENDHAP--------VFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTN-----SQTELKITNGDDE-GCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVL-QLNATDPD-EGDNGTVSYSITGGNDLGW-------FQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPR---------------FMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNG--LFELNTQTGVLWTK-SQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISD 629          

HSP 9 Score: 108.227 bits (269), Expect = 1.527e-23
Identity = 138/560 (24.64%), Postives = 243/560 (43.39%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLE---DLKLFLQKSIDYEKQNLYTGTLQAC-EDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKL-IGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI-DRKVLKHFSIDNKTGLIST-SFVPFDREMTSIKQFE-VNVKDDKTNPK-TANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPN----WTITVKAYDSGSPTR 2241
            ++I I+D ND++  F  N    ++ ENS   +++    A   D S + +   Y    S   F +D  + +    ++L  ++ I     N+Y    +A   D+T    +  +++ + D NDN P FS+  Y  T+ E    G  + +++A+D D     K  Y +VS      + ++F I+  TG L L   LD     S +   + A+D   +   S      + I V D ND +P        V   S + T+ I E+     L I L+ SD+D+ +NG +   +        + DV      L      D+E   L +     QDHG   L     + +++ DVN+  P F       ++REN   G PV    A+DRD    A + +S+  +   K FS+++ T  I+T + +  +        F+ V +  D+ +PK +    + +++ D NDN P F +S        ++ + T     + A D D +  N  V Y         +I      F + P+TG+++ +      + P+    + +T++A D G P+R
Sbjct: 1036 VTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHS-RTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTG---MDKFF-INSSTGELHLSKTLD-RETTSSYNLVVKATDASNANLYSTA---KIEITVGDSNDQRP--------VFPESDY-TVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNG-NLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGF-VSPPAAAAGSSLNVMT-----ITAEDPDRNS-NGKVTY--------SIISGNNGYFNLHPSTGQLQMI-----HQIPDNPTIYQLTIQASDGGQPSR 1556          

HSP 10 Score: 64.6994 bits (156), Expect = 2.358e-10
Identity = 82/334 (24.55%), Postives = 145/334 (43.41%), Query Frame = 1
Query: 1657 NEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLN-ATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHK---LILKLKAIDQDENDAGRVCYYLQTNG---DNMFGLNETTGELIT---LVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            + Y   ++E  PPG+ V  V      + +           K F  ++ TG+IST+    DRE T+    +++++    NP    + V++++ D+NDN+P F        ++E++ + T     +N ATD D    N  V Y   +  D+     +        +T  + T   LDRE    + + + A D G+P    +    I + D ND+ P +                  T    +  IAE  K    IL++ A D+D    G + Y +  +    +++F L+ +TG + T   L   +K  +Y     A D GVP  ++ A++T++V D
Sbjct:   10 SSYTFHVQEEQPPGTYVGKVDGASAFEGSP----------KQFGFNSNTGVISTT-ARIDRETTT----QISLQLRTLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTT--NPINTATDPDAGN-NGTVDYTIAS-GDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVF------------------TQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVK-NSYTFNVIASDGGVPSKNDLATVTINVLD 305          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 179.104 bits (453), Expect = 2.891e-45
Identity = 181/676 (26.78%), Postives = 303/676 (44.82%), Query Frame = 1
Query:  628 INDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCS-TQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPI-NFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQT-NGDNMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            IND  P F  +   V++ E++    +I    A D+D    N +  Y    +   F +  S  +   + +   +D E +N+Y   + A     G   T  Q+ I + D  D+ P F+  S    + E+  +G  + K+ A+D D    +   Y I +     L    F I   TG +   ++LD  N ++ ++  + A D +      V D   V++ VED+NDN P   +            TI+  E  P    ++ +   D D+ +N  V   + E++      +   G   L S+   D E E+         D G PS     ++ I + D+N+  P F N +Y   +REN P G+PVL V A+D+D   +A+L Y +   +   F+ID  TG I+T   P +RE T      +   D     +     V I + D ND+ P F  S   F V+E+VK+   + G++  TD D +  N  V+Y +++  +  L+      F +  TTG I T   LDRE+  ++T+ + A D G P   +  +  I + D+NDN+P  ++ + + N     S F+                 ++++ A D DE   G+  Y +   + D++F ++  TG LIT+ + L   K   Y L  +A+D G PPL+    + +HV D
Sbjct: 1082 INDESPLFEKSMYYVNVSESASRGIVIGRVTATDRD-EGINAIIFYSSNGAEAKFYVSRSTGD---IIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKD--IGDTISYSIANGDPYGL----FTIDNVTGEIRTVAELDREN-VTQYELFVQAKDSVNL----VSDLLKVVVQVEDVNDNPPVFSMPG---------YTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAITGVISLGSSQ-LDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTR-EPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTV-GRVATTDEDIND-NARVRY-YISSGNTSLM------FSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKP--LFSKSVYNVTLRESVFL--------------KTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTG-LITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSD 1705          

HSP 2 Score: 152.91 bits (385), Expect = 3.595e-37
Identity = 187/648 (28.86%), Postives = 285/648 (43.98%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFE--DSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLIL-KSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQK-LIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDR-KVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQD-ENDAGRVCYYLQT-NGDNMFGLNETTGELITL 2523
            + I + D+ D+KPYF ++   V + EN+ + + +    A+DKD        SY     D    FTIDN   E   +     +D E    Y   +QA +     S   ++V+Q++D NDN P FS   Y     E  P G  IL+V+AID D        Y IV       ++ Y  ++  TG + L  SQLD       F F I A+D   S   S     +V I + DINDN P       N  +   +    ++EN+PA   ++ ++ SD+D+  N ++S  L   L +    D   G  ++ +  P + E+           D    + +    + I + D N++ P F  + Y  S+RE+   G  V  V  TD D   +A + Y I        FS+ N+T  I ++    DRE  +     +  KD       +N  V I I DVNDN P+F  S     ++E+V +KT++  ++ ATD D +  N    Y+               VF I   TG I     LD EK   + +TV A D G+P         I+V D++DN P +  PR        S  +YE       ++   H +I  + A D D E    RV Y +++ N D+MF + E +G +ITL
Sbjct: 1178 VHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIG---DTISYSIANGDPYGLFTIDNVTGE---IRTVAELDRENVTQYELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVEN-----VTDYVTVNAITGVISLGSSQLDREVE-EYFNFTIRATD---SGVPSKSSTASVAIKLVDINDNSPVF-----NNTDYYAY----VRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTG--NITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSV-NETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVV-QVIATDPD-EGANGQFTYKITA-------GDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPR-------YSAELYE-------NVTRGHHVI-TVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSG-VITL 1773          

HSP 3 Score: 149.058 bits (375), Expect = 5.479e-36
Identity = 175/657 (26.64%), Postives = 283/657 (43.07%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKT-FTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGC-STQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVER-SMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKE-DLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSA---ELIYSIDR-KVLKHFSIDNKTGLISTSFVP---FDREMTSIKQFEVNVKDDKTNPKTANVLVK--IEILDVNDNDPVFLLSS-LQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNM--FGLNETTGELITLVS 2529
            ++I++ DINDN P F        + EN    + + +  A DKD     ++ SY       T F ID    +   +  ++ ++ E+   YT TL+A + +        +++I + D ND++P+F++  Y  ++ E   VG  + +V   D D     +  Y I S GN +L+   F ++  TG +   S LD     S +   I+A D       ++E  T+V+I +ED+NDNKP       NV  R S+FL  ++         + +  +D D   NG+ + ++   D   +   D   G   + +    DYEK  L       QD G P L     +EIH+ DV++  P F    Y   L EN   G  V+TV ATD D  A    + Y I+       F I  ++G+I+ +  P    +RE  +  + +V     + N      LV   I +LDVNDN P F   S ++  +++   I       + A D D  +    +   F  +  ++       VFQ+   TG +     LDRE    +++ V A D G P   +     I V D+NDN P    P  +      + F           + E     + +  +   + D   + YY  TN +    F LNET+GEL T ++
Sbjct: 1385 VAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKL-SYVLSGVLYTRFAIDP---DTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYI-SSGNTSLM---FSVNETTGIISTTSTLDREQNAS-YTLIITAKDH---GIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQV---------VQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKA--KLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQV-AAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEII---FTIVSGNE-----NGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTF----------SVKENLDAGVPVGVVAAQDLDTKNLIYYYITNTEEQKYFILNETSGELRTRIT 1999          

HSP 4 Score: 128.257 bits (321), Expect = 1.165e-29
Identity = 170/667 (25.49%), Postives = 273/667 (40.93%), Query Frame = 1
Query:  637 NKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKN----RVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQ-NL-----------------YTG-----TLQACEDSTG--CSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLI-GLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGS-LRENTPPGSPVL-TVRATDRDKSA--ELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVF------LLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWT----------ITVKAYDSGSPT---RFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD 2478
            N+P F  +  I  + E+  L   + +   +      KN    RV  +     +  F ID ++     L++ K++DYEKQ N                  +TG      + A E  T    S    + + + + NDN P F+K SY  T+ E    G  I  + A D D   F    Y++     R   + YF ++ D G++     LD     ++ ++Q S   K    F        V + ++D+NDN P             M  T  I EN PA  ++  ++ +D+D  ENGR+S  +            G G   + +    D E            DHG  S  ++  + +++ D N+  P   +   + + + E    G+ +L ++ A D D  +  +L YS+       F++++ TG +  S    DRE+       +NV D+ + P T +  V + ILDVNDN P F       L++    V E      K    +NATD D D  N  V Y  ++  +H         F++ P TGE+     LDRE  P  +          + + A D  +P    + A    +I VRD NDN P+        FQ       YET    +S+ A     ++++ A DQD    G+V Y + T+GD
Sbjct:  254 NRPAFLQSVYIFDVREDVALPGRV-VSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTS---GTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYEL-----RGGQAAYFSVNADNGTISAAQILDYD---TLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFT---------GMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSGL--VTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGG-DSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDAD-ANGKVAYS-LSGDEHGF-------FRLDPVTGELSVRKELDRES-PQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQ--------FQSQ----NYET---RLSEAARPGSNVIQVSATDQDLEYKGKVIYNI-TDGD 870          

HSP 5 Score: 118.242 bits (295), Expect = 1.278e-26
Identity = 146/556 (26.26%), Postives = 247/556 (44.42%), Query Frame = 1
Query:  613 IEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTK-TFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDST-GCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKEN-EPAQKLIGLSVSDRDLK-ENGRVSCELKE-DLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIE---IHIEDVNEYPPGFQNNEYLGSLRENTPP--GSPVLTVRATDRDK--SAELIYSI-DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLL--------SSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKA 2217
            I + D ND+ P F  +    S+ E+  +   +      D+D +   RV+ Y    +T   F++   N     +    ++D E+   YT  + A +       +   ++I I+D NDN P FSK  Y  T+ ES  +  ++++V A D D     +  YKI +    ++    F I  +TG + +K++LD   + S++   +SA D      T       V IHV D++DN P        V  +  + + ++ EN      +I ++ +D D +  + RV   ++  +  S+ L     G   L  T      +E   +   +     + +L E +++    I + DVN+  P F +  Y+ S+ E+T P   + +LTV+A D D+  S E+I++I        F +DNKTG++ T   P DRE TS     V  +D      +++V V I +LD+NDN P+               F V+EN+     + G + A D D     N + Y      + K        F +  T+GE+ T + LDRE      + VKA
Sbjct: 1491 ITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSV---NETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDV----FYIDANTGLITIKAKLDYE-KTSLYNLTVSAQDLGTPPLTGA---CFVEIHVSDVDDNAP--------VFHKPRY-SAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVL-TRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPV-GVVAAQDLDT---KNLIYYYITNTEEQKY-------FILNETSGELRTRITLDREDSSVHYLYVKA 2014          

HSP 6 Score: 110.153 bits (274), Expect = 3.695e-24
Identity = 170/726 (23.42%), Postives = 296/726 (40.77%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV---IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNR-ISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVS--DRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNN------EYLGSLRENTPPGS---PVLTVRATDRDKSA--ELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQ---------FEVNVKDDKT---NPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNG--DNMFGLNETTGELIT--LVSPLKLGTYVLKFTARDNGVPPLSND-ASITVHVQD-NGRFANINLTIIIGMIA 2679
            +++ + ++NDNKP F  +    ++ E     + I    A D D      + +Y+       +   + N ++  +   + +DY+    Y  +L   +D  G   +  I    + + D NDN P+F+   Y   I E+ P G  + +V A D D  +  +  + I S G+      +F I+   GS ++ +  +L    I+ +   +SA D      +S      + ++V D NDN P I           + +T  I E      ++  S++  D D   NG+++  +        L    G      S    D E +D    +    D+G P      T+ + I DVN+  P F  N       Y+ ++ E   PG+    ++ + ATD D  A  ++ YS+       F +D  TG +S      DRE   + +          ++   D  T   + K+A V V I + D NDN P F   + +  + E  +  + +  +++ATD+D +             Y  K+I ++    + R    E+E LV     ++ NW          S          IYV D+NDN P +      N  ++ +  +  +P             +L++ A D+D+   G++ Y L TNG  D+ F +N  TGE+    ++    + T+VL   A D G P      A + + V+D N  F   + T   G IA
Sbjct:  375 VTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGAL-TYELRGGQAAYF--SVNADNGTISAAQILDYDTLRQYQFSL-VVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNI-SAGDD---GGHFSIN---GSGLVTTARELDRETIATYTLTVSAYDH---GVSSRHKHVQLTVNVLDENDNTPQIT--------DGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNSATGRLQ--ISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEG--PGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVR-KELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVI-QVSATDQDLE-------------YKGKVIYNITDGDENRKC--EVEKLV-----RHYNWHKKNCVLCKESKCSVERTYVVIYVDDVNDNDPVF------NQSKYAADVLENSPT---------GTPVLRVHASDRDQGANGKITYKL-TNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIA 1036          

HSP 7 Score: 108.227 bits (269), Expect = 1.517e-23
Identity = 156/630 (24.76%), Postives = 259/630 (41.11%), Query Frame = 1
Query:  937 IDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRVSCE-LKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTP-PGSPVL-TVRATDRDKSAELIYSIDRKVLKH--------FSIDNKTG-LISTSFVPFDREMTSIKQFE----------------------VNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGS-PTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAE---KHKLILKLKAIDQDENDAGRVCYYLQTNGD-NMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTIIIGMIAITVSIS 2697
            +DD NDN P F+++ Y   I E+  VG  ILK+ AID D    ++ +YK  +       + +F ++   G L L   LD     S +   + A D    K    E RT VII V DI+D  P           +S +L  +I+EN P    ++ +   D D+  N  +  E +  +   +   D   G   +  +   D EK D+ +   +  +   P+     T+ + + DVN+  P F  + Y+  +RE+   PG  V   ++ TD DK+      + R+VL H        F+ID  +G L     + +++++     +E                      V  + D +   +AN  V + +++VNDN P+F  SS  + + E +   T +   + ATD D                 ++L       F +    G I    +LD +    +  ++   D G      A A  T+ ++D+NDN PE+                  T     SDIAE      ++ ++ A D+D  + GR+ + +    D   F +N +   L+T    L    + TY L  +A D+GV        +TV+V D     N N   I   + IT +IS
Sbjct:   36 VDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQ--TPFFSLNSVNGELTLGGPLDFEVARS-YMLVVIAEDLGVPKL---ESRTTVIIEVTDISDMPPRFL--------QSFYLK-EIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFTIDSNTGVITVNGS--IDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNP-----VFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHI-ADITATDADLGTFGALT---------YELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEF------------------TGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSG--LVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDE----NDNTPQITDGLTITTNIS 609          

HSP 8 Score: 104.375 bits (259), Expect = 2.511e-22
Identity = 123/468 (26.28%), Postives = 204/468 (43.59%), Query Frame = 1
Query:  589 SKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFE--DSTKTFTID-NSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTG-CSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILK-SQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTI--KVLAGNVVER------SMFLTIKIKENEPAQ--KLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQN--------NEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSI-DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVK 1920
            S  S +I+IE  D+NDNKP F  +   V++ E+  L + +    A D D  A  +  +YK    D+   F ID N+ L    + ++  +DYEK +LY  T+ A +  T   +  C + I + D +DN P F K  Y   + E+   G  ++ V A DID    +K  Y  +  GN + +   F I   +G + L  +     NR +  ++++  +   +   T  +     +I V D+NDN P    +    +V+E       +  LT+K ++ +  +  ++I   VS     ENG    + K  +              L  T P D E       +   +D G+P+L    T+ I + D+N+  P  Q              S++EN   G PV  V A D D    + Y I + +  K+F ++  +G + T  +  DRE +S+    V   +DK N  T   L +
Sbjct: 1590 SNTSVMITIE--DVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQF-TYKITAGDTDDVFYIDANTGL----ITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSM---FLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSG---NENGVFQMDNKTGV--------------LTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDTKNLIYYYITNTEEQKYFILNETSGELRTR-ITLDREDSSVHYLYVKASNDKLNITTLQPLAR 2029          

HSP 9 Score: 94.3597 bits (233), Expect = 2.358e-19
Identity = 124/498 (24.90%), Postives = 228/498 (45.78%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVS-IPENSDLVSIIKIE-GAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKF------SKESYEKTIVES-FPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDL-SNRISV-------FKFQISASDKLKSKFTSVEDR----TNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSA--ELIYSI-DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVK-DDKTNPKTANVL--VKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKL 2016
            +++ + D NDN P       I + I E +   +++     A+D D  +  ++ +Y        FT+ NS    L++     +D E ++ Y   +   ++ +  +T    V + I D NDN P F      S  +Y  T+ E    + K ++ + A D D     K  Y +   G+ +    +F++ P TG L ++ +LD  S ++S        F   I+A+D+     T + DR      V I V D NDN P          +   + T   +   P   +I +S +D+DL+  G+V   + +  ++ + +       +    H Y++ K++ +     C++      + Y  + I+++DVN+  P F  ++Y   + EN+P G+PVL V A+DRD+ A  ++ Y + +      FSI+N TG I+ + V  DRE  ++  F + V+ +D+  P +      V I + D NDN P F  +  +  + EN  + + +
Sbjct:  584 LTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQL-TYSMSGGDSRFTL-NSATGRLQIS-PTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSL--SGDEH---GFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQA----TPISDRKSATVRVSITVRDTNDNSPQF--------QSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCE------VEKLVRH-YNWHKKNCVL----CKESKCSVERTY--VVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAGV-IDRE--AVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTI 1045          

HSP 10 Score: 93.2041 bits (230), Expect = 5.306e-19
Identity = 167/717 (23.29%), Postives = 287/717 (40.03%), Query Frame = 1
Query:  595 NSFIISIEIKDINDNKPYFRTNKQ------IVSIPENSDLVSIIKIE-GAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNL-------------YTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRVSCEL----KEDLQSLELKDVGG-----GFYDLWSTHPYDYEKEDLIKTLFECQDHGKP-SLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLV----KIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD--NMFGLNETTGELITLVSPLK--LGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            NS  + + I D+NDN P F  N        ++++ E    ++   I+  A D D  A  +V      D    F +D    E   L ++K +D E   +              T T QA   S   S   ++ I + D NDN P+F  ++YE  + E+   G  +++V A D D     K  Y I + G+ N                   + ++   +  + +        K    SVE RT V+I+V+D+NDN P        V  +S +    + EN P    ++ +  SDRD   NG+++ +L    K+D  +  + +V G     G  D  + H +       + T+ + +D G+P S K +  + I ++D N+  P F    Y G + EN+P GS +  V               D+K+             S++  P                  +++P+    L+    K  I  +ND  P+F  S     V E+   +  + G++ ATDRD + +N  + Y              +  F +  +TG+I     LDRE    + + V A +  +  +       I V D+ D++P                F   +  + +S+ A     + K+ A+D+   D G    Y   NGD   +F ++  TGE+ T+    +  +  Y L   A+D+ V  +S+   + V V+D
Sbjct:  686 NSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGE---LSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNI-TDGDEN------------------RKCEVEKLVRHYNWHKKNCVLCKESKCSVE-RTYVVIYVDDVNDNDP--------VFNQSKYAA-DVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDD--AFSINNVTGEITVAGVIDREAVHTF-------VLTV-QAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMVP--------------DQKIS------------SSTLRP------------------RSSPRAPAALLTAREKRPITLINDESPLFEKSMYYVNVSESAS-RGIVIGRVTATDRD-EGINAIIFYSS---------NGAEAKFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPY---------------FNSSSLTVKLSENASIGTNVTKITALDK---DIGDTISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDS-VNLVSDLLKVVVQVED 1286          

HSP 11 Score: 71.633 bits (174), Expect = 2.336e-12
Identity = 65/218 (29.82%), Postives = 109/218 (50.00%), Query Frame = 1
Query:  589 SKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKT----FTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGC---STQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASD 1221
            SK  F+I   + D NDN P F     +  I EN+ + + I    AID D    ++V+ YKF ++T T    F++++ N E   L L   +D+E    Y   L    +  G     ++  ++I++ D +D  P+F +  Y K I E+ P+G  ++ VEA D D    N   Y+I+S GN + +   F I  +TG + +   +D + +  VF+  + AS+
Sbjct:   29 SKFFFLI---VDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQ-YKFSNATATQTPFFSLNSVNGE---LTLGGPLDFEVARSYM--LVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIIS-GNSDGV---FTIDSNTGVITVNGSID-AEKTDVFRITVKASE 232          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 176.022 bits (445), Expect = 2.577e-44
Identity = 188/650 (28.92%), Postives = 296/650 (45.54%), Query Frame = 1
Query:  595 NSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGC-STQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDID-GPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSI--DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKP-VFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEW-IYPRPINFQRHISP--FIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGEL 2514
            N   + I + D+NDN P F ++     IPEN  +        A DKD      + ++ F  +   F+I N N   + +  ++ +D EK   +T  ++A +          QI I + D NDN PKFS+E Y  +I E+   G  +L+V+AID D GP      Y IVS    +   R F+I+P  G + L   L+ + +  V+ F +SASD + S  T++     V ++V D N + P  K        RS    +K ++      ++ +  +DRD   N ++S  +   +    + +  G    + +    D EK D  +      DHG P LK    + IHI DVN+  P F    Y   +RE+  PG  V+ V A+D D  K+A++IYS   +      F+ID+  G+I T   P DRE     +  V   D  T P  A+V VK+ + DV D+ P+F     +  V E+   ++ +   + A  +D       +         + ++R   P VF I P TG I+TL+ LD E    + +TV+A  + SP  F      +Y++D+NDN P    +   IN Q    P    Y+ PA +  D+++  KL  K+                ++ N      LN T+GEL
Sbjct:  321 NQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEI-TFSFMQNDLPFSI-NENTGGISI--KEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGP--TNVVYSIVSSSGHD---RCFRINPQ-GLITLSCTLNYNTK-HVYVFSVSASDGMLSS-TAL-----VYVNVTDSNTHAPEFK-------RRSYSAEVK-EDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTG---VIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRT-LKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVI-TVKAKSQDLSPETGMM---------YSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRA--TLSPF-FTETTVMVYLKDINDNTPVLEAFHMNINVQEGKVPPEARYKIPAYD-PDVSD--KLTFKV----------------MEGNAKEWVTLNATSGEL 909          

HSP 2 Score: 172.17 bits (435), Expect = 4.525e-43
Identity = 190/690 (27.54%), Postives = 296/690 (42.90%), Query Frame = 1
Query:  607 ISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLE----DLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQID--DENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLF--ECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS-AELIYSIDRKVL--KHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNM--FGLNETTGELITLVSPLKLGT---YVLKFTARDNGVPPLSNDASITVHVQD 2628
            ++I + D+NDN P F  N     IPE+  +   +    A D D  +   VK Y   +S      DNS          + + K +D EK   YT  +QA +D         + ++I   D ND  P+FSK+ Y  TI E  PV + +  V A D D     +  ++IVS  + N    +F I+   G + +K +LD    I VF   ++A DK +     + ++T V I + D+NDN P            S F T+  +     Q+   +   D+D   NG ++    ++     + +  GG      +   + ++E + K  F  + +D G P  +    I I + D+N+ PP F   EY  S+ EN+  G+ VL V+A D D     ++YSI       + F I N  GLI+ S    +     +  F V+  D      ++  LV + + D N + P F   S    V+E+  + T +   L ATDRD    N  + Y   TL          P F +  TTG I+T   LDREK   +   V A D G P   A +   I++ D+NDN P ++ P             YE     + +       ++++ A D D     ++ Y   +NGD    F ++ T G +I  + PL   T   Y L   A D G PP      + V ++D
Sbjct:  114 LTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVK-YCILNSDG----DNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQA-QDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMN----FFSINRINGEVRVKQKLDY-EMIGVFNLLVTAQDKGQP---FLYNQTTVDIALIDVNDNAPQFV--------SSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSINENTGGI-----SIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRI-NPQGLITLS-CTLNYNTKHVYVFSVSASDGML---SSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVL-ATDRDTGS-NAKISYSIATLV---------PEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPS------------YEA---KVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQG-IIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILED 744          

HSP 3 Score: 146.747 bits (369), Expect = 2.380e-35
Identity = 165/576 (28.65%), Postives = 250/576 (43.40%), Query Frame = 1
Query:  952 DNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISR-YFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVS-CELKEDL--QSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSA--ELIYSI-DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTAN-VLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNG-DNMFGLNETTGELITLVSPLKLGT---YVLKFTARDNGVPPLSNDASITVHVQDNGRFA 2643
            +N P+FS+   + ++ E   VG  +  V A D D        Y +    ++NL+S  YF I   TG +  K  LD       F F++ A D  +    S+E   ++ I+V D+NDN P        + ER+++     ++      ++ +  SD D   NG V  C L  D    +  + +V G    +      D EK        + QD G P      T++I + DVN+  P F    Y  ++RE+ P    V TVRATD D+ +  E+ + I     +  FSI+   G +       D EM  +    V  + DK  P   N   V I ++DVNDN P F+ S  Q  + EN  +  +   ++ A D+D    N  + + FM        ++  P F I   TG I     LDREK P +T  +KA D G P +   A  TI + D+NDN P+               F  E    +I++ +     +L++KAID D      V   + ++G D  F +N     LITL   L   T   YV   +A D     LS+ A + V+V D+   A
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSM--SPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHF-FRVKAEDGGEP---SLEGYMDLTINVLDVNDNGP--------IFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVM---KKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVK-QKLDYEMIGVFNLLVTAQ-DKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFY-RVQAYDKD-HGTNGEITFSFM--------QNDLP-FSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPK---------------FSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINPQG--LITLSCTLNYNTKHVYVFSVSASDG---MLSSTALVYVNVTDSNTHA 540          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 224.942 bits (572), Expect = 7.838e-60
Identity = 205/702 (29.20%), Postives = 318/702 (45.30%), Query Frame = 1
Query:  613 IEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTI------DNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCS-TQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYD------LWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI--DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKL---GTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINL 2655
            IE++DINDN P F  +   +S+PEN+ + ++  I  A D+D S +N V  Y         T+      D+   +  +L +  ++D E ++ Y  T++A +       +Q  + + + D NDN PKF   SYE  + E+ PVG  +L+V+A D D     + EY +      + + +  +I   TG + +K  LD    I+   F + A DK     +S   +T V I V D NDN P +++    +V  S  +   I E+ P    + L  VSD+D  EN  V+C +  D+   +L+       D      L +T P DYE+    +      D G P+L    ++++ + DVN+  P F    +     E   PG  +L V ATD D    AEL Y+I  D  +   F ID  TG +  +  P DRE     +F V   D  +        V I++LD NDNDP F+LS   F V EN+   + + G +   D D  + N  V         H  +      F ++  TG I + +  DREK  ++T  +KA D G P R ++   TI V D NDN P    P   +F R +SP              + H  +++ + +D   N A  V      N   +F ++ ++GE ITL   +     G + L     D G PP    A+  VH+  N   +N++L
Sbjct:  120 IEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRD-SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQA--VDPVPKLLRIDRTTGIIYVKGPLD-REEINSLSFYVVARDKGPQPKSS---KTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIA-NISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDV-PFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVK-ARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPV-GMVTVLDMDKGE-NAHV---------HLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSF-RQLSPVAS----------PDSHVDVVEAEDLDSGPN-ADLVFSIAGGNPYQLFRISPSSGE-ITLAKEMTRKHGGLHRLVVRVSDRGKPP--RHATALVHIYVNETISNVSL 785          

HSP 2 Score: 113.235 bits (282), Expect = 7.331e-25
Identity = 144/580 (24.83%), Postives = 242/580 (41.72%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRTNKQIVSIPENSDLV-SIIKIEGAIDKDFSAKNRVKSYKFEDST----KTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGC-STQCQIVIQIDDENDNIPKF--------SKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGS-------LILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQ-ENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYV 2271
            ++ + + D NDN P F        + ENS +  S+++++ A D D      ++ Y    +     K   ID +      ++++  +D E+ N  +  + A +      S++  + I++ D+NDN P          +       I E  PVG  +  V+  D D     + E  +V+      +    + + D+ S       L   + LD   R+  ++ +I A D      +S     ++ + V D+NDN P        V   ++F     +EN+P + ++ ++ +D D   N  +   +  D     L ++     ++ +  P D E ++  +      D G P  K   T+ I + D N+  P F  + Y  S+ EN PP SPV  V   D DK   A +  S++    K F + N TG I +S + FDRE  S   F +   D    P+++ V V I +LD NDNDPV    S   F Q   V         + A D D     + V +       ++L       F+I P++GEI     + R+      + V+  D G P R A A   IYV
Sbjct:  229 LLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVK-ADDSDMGPNGEIE-YSLHQAVDPVPKLLRIDRTTG---IIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKD-----EGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDY-ERVKEYRVEIVAVDSGNPALSST---NSLKVQVTDVNDNSP--------VFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGK-FVVQNGTGTILSS-ISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLV-FSIAGGNPYQL-------FRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 776          

HSP 3 Score: 100.523 bits (249), Expect = 5.710e-21
Identity = 99/348 (28.45%), Postives = 159/348 (45.69%), Query Frame = 1
Query: 1645 GFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREM-----TSIK------QFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVV---LDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD---NMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            G      L  ++E  PP + + ++ A      +  +Y ++     +  +D KTG I T+ +P DRE      + +K      +FEV+V D   NP    +  +IE+ D+NDN P F LS L   V EN  +       L ATDRD ++ N    Y      D   +  ++ V   R   G++  L+V   LDRE   ++ +T+KA D G+P R++ A   + V D NDN P++ +P             YE     +S+ +     +L++KA D D    G + Y L    D    +  ++ TTG +I +  PL   ++ +      ARD G  P S+   +T+ V D
Sbjct:   18 GPAKGSILYRVQEEQPPNTLIGSLAADHGLPDSGHLYKLEVGA-PYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPL-ATDRDSER-NGVADYALTAGPDAATLFGLQ-VADDR--GGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPS------------YEA---EVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTG-IIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTD 343          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 224.942 bits (572), Expect = 2.484e-59
Identity = 203/702 (28.92%), Postives = 317/702 (45.16%), Query Frame = 1
Query:  613 IEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTI------DNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCS-TQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYD------LWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSI--DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKL---GTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINL 2655
            IE++DINDN P F  +   +S+PEN+ + ++  I  A D+D S +N V  Y         T+      D+   +  +L +  ++D E ++ Y  T++A +       +Q  + + + D NDN PKF   SYE  + E+ PVG  +L+V+A D D     + EY +      + + +  +I   TG + +K  LD    I+   F + A DK     +S   +T V I V D NDN P +++    +V  S  +   I E+ P    + L  VSD+D  EN  V+C +  D+   +L+       D      L +T P DYE+    +      D G P+L    ++++ + DVN+  P F    +     E   PG  +L V ATD D    AEL Y+I  D  +   F ID  TG +  +  P DRE     +F V   D  +        V I++LD NDNDP F+LS   F V EN+   + + G +   D D  +            + H  +      F ++  TG I + +  DREK  ++T  +KA D G P R ++   TI V D NDN P    P   +F R +SP              + H  +++ + +D   N A  V      N   +F ++ ++GE ITL   +     G + L     D G PP    A+  VH+  N   +N++L
Sbjct:  197 IEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRD-SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQA--VDPVPKLLRIDRTTGIIYVKGPLD-REEINSLSFYVVARDKGPQPKSS---KTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIA-NISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDV-PFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVK-ARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPV-GMVTVLDMDKGE----------NAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSF-RQLSPVAS----------PDSHVDVVEAEDLDSGPN-ADLVFSIAGGNPYQLFRISPSSGE-ITLAKEMTRKHGGLHRLVVRVSDRGKPP--RHATALVHIYVNETISNVSL 862          

HSP 2 Score: 115.161 bits (287), Expect = 2.525e-25
Identity = 144/580 (24.83%), Postives = 242/580 (41.72%), Query Frame = 1
Query:  604 IISIEIKDINDNKPYFRTNKQIVSIPENSDLV-SIIKIEGAIDKDFSAKNRVKSYKFEDST----KTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGC-STQCQIVIQIDDENDNIPKF--------SKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGS-------LILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKS--AELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQ-ENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYV 2271
            ++ + + D NDN P F        + ENS +  S+++++ A D D      ++ Y    +     K   ID +      ++++  +D E+ N  +  + A +      S++  + I++ D+NDN P          +       I E  PVG  +  V+  D D     + E  +V+      +    + + D+ S       L   + LD   R+  ++ +I A D      +S     ++ + V D+NDN P        V   ++F     +EN+P + ++ ++ +D D   N  +   +  D     L ++     ++ +  P D E ++  +      D G P  K   T+ I + D N+  P F  + Y  S+ EN PP SPV  V   D DK   A +  S++    K F + N TG I +S + FDRE  S   F +   D    P+++ V V I +LD NDNDPV    S   F Q   V         + A D D     + V +       ++L       F+I P++GEI     + R+      + V+  D G P R A A   IYV
Sbjct:  306 LLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVK-ADDSDMGPNGEIE-YSLHQAVDPVPKLLRIDRTTG---IIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKD-----EGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDY-ERVKEYRVEIVAVDSGNPALSST---NSLKVQVTDVNDNSP--------VFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGK-FVVQNGTGTILSS-ISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLV-FSIAGGNPYQL-------FRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 853          

HSP 3 Score: 100.908 bits (250), Expect = 5.715e-21
Identity = 107/388 (27.58%), Postives = 173/388 (44.59%), Query Frame = 1
Query: 1645 GFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREM-----TSIK------QFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVV---LDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGD---NMFGLNETTGELITLVSPL---KLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTIIIGMIA-------ITVSISVFLIVAIICV 2727
            G      L  ++E  PP + + ++ A      +  +Y ++     +  +D KTG I T+ +P DRE      + +K      +FEV+V D   NP    +  +IE+ D+NDN P F LS L   V EN  +       L ATDRD ++ N    Y      D   +  ++ V   R   G++  L+V   LDRE   ++ +T+KA D G+P R++ A   + V D NDN P++ +P             YE     +S+ +     +L++KA D D    G + Y L    D    +  ++ TTG +I +  PL   ++ +      ARD G  P S+   +T+ V D    A       IG++        I+  + V   VA++ V
Sbjct:   95 GPAKGSILYRVQEEQPPNTLIGSLAADHGLPDSGHLYKLEVGA-PYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPL-ATDRDSER-NGVADYALTAGPDAATLFGLQ-VADDR--GGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPS------------YEA---EVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTG-IIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQV 460          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 216.853 bits (551), Expect = 3.239e-57
Identity = 204/689 (29.61%), Postives = 325/689 (47.17%), Query Frame = 1
Query:  559 KFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDID-GPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQT-NGDNMFGLNETTGELITL---VSPLKLGTYVLKFTARDNGVP 2586
            + EV++L +       I I +KD NDN P F +    +SIPEN+ + S   I  A D D +  N V  Y+  +    F +D     +     +L +Q+++D E+++ Y   ++  +  +   +   I+ + + D NDN P F +   E  I E+ P+G  +++++A D D GP  N   + +          R F ++  +G + ++  LD     ++ K  + ASD      +S   R  VII+V D+NDN P I +     +   +  T+ + E +P    I L +VSD+D   NG+V C +++D+    LK V    Y L ++   DYE            D GKPSL +   + + +ED N+ PP F       ++ EN      + T+ ATD D  K+AE++Y +       F +D KTG+++ S V FDRE      F V  +D+ T P  A   V + +LD NDN+P F  +  QFFV EN+  K    G +  TD D  + N  +    +   ++         F + P +G I++ V  DRE+  ++T  V+A DSG P   + A  TI V D+NDN P  IYP P N    + P      +I  S +AE       + A+D D      + Y + + N   +F ++  TG  ITL    +P  +G + L     D G P
Sbjct:  111 EIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPD-TGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGP--NAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLD-REETAIHKLSVLASDG-----SSSPARATVIINVTDVNDNPPNIDL---RYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDV-PFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNA-SFFDLDRKTGVLTASRV-FDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLP-KYSTVGVITVTDSDAGE-NAAISLSILNDNEN---------FILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYP-PSNTSFKLVPL----SSIPGSVVAE-------VFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGN-ITLEEKPAPTDIGLHRLVVNISDLGYP 760          

HSP 2 Score: 120.553 bits (301), Expect = 4.879e-27
Identity = 127/475 (26.74%), Postives = 204/475 (42.95%), Query Frame = 1
Query: 1270 IHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDV----GGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVL----KHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDP----VFLLSSLQ--FFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHK---LILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELIT--LVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            I V+D NDN P            S  + I I EN        + S +D D   N     EL     +  L  V    G  +  L      D E++D      + +D G P       +++ + DVN+  P F+ N+    + EN+P G+ V+ ++ATD D   +AE+ Y    +V     + F++++ +GLI+    P DRE T+I +  V   D  ++P  A V+  I + DVNDN P     +++S +    F+ E   I TK+   +  +D+D D     +  + +   +  +  H+K V+        +ET  +LD E    +   + A DSG P+    A   + + D NDN P                 I+  P I ++ + E +K    +  L A D+D      + Y L  N  + F L+  TG L    +        ++   TARDNG PPL   A++ V V D
Sbjct:  129 IIVKDTNDNAPMFP---------SPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQR-PLDREETAIHKLSVLASDGSSSPARATVI--INVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKI-ALITVSDKDTD-----INGKVICFIEKDVPFHLKAVYD---NQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPP-----------------IFTQPVIELA-VMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNA-SFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLD 563          

HSP 3 Score: 88.1965 bits (217), Expect = 4.042e-17
Identity = 141/606 (23.27%), Postives = 247/606 (40.76%), Query Frame = 1
Query:  922 QIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDT---GSLILKSQLDLSNRIS-VFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRV----SCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGS-------LRENTPPGSPV--LTVRATDRDKSAELIYSIDRKVLKHF-SIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKP---VFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVS--PLKLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTIII 2667
            +I I + D NDN P F       +I E+  +        A D D    +  +Y++++   ++        +P+      LI++  LD   + + V K ++      +   T++     + + V D+NDNKP         V R   + + I EN P    ++ L  +D D+  N  +      ++    + L   +   G   +    P D E+  + K      D      +   T+ I++ DVN+ PP   +  Y+ S       L E  P  + +  +TV   D D + ++I  I++ V  H  ++ +   L+ TS +  D E T    F++   D          LV++ + D NDN P+F    ++  V EN K    L   L+ATD D  +             + +++  + P    F +   TG +    V DRE    +  TV A D+G+P   A A   + V D NDN P++ +        H   F+ E           K+  +  +   D D  +   +   +  + +N F L+  +G + + VS    +  +Y     A D+G PP S+ A +T++V D     N N  I+I
Sbjct:  126 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELIN--GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAI-----LQVTVTDVNDNKP---------VFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITV--QRPLDREETAIHKLSVLASDGSSSPARA--TVIINVTDVNDNPPNI-DLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSAL-LDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLT-TLSATDEDSGK-------------NAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTH-------NHFQFFVSEN--------LPKYSTVGVITVTDSDAGENAAISLSILNDNEN-FILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVID----VNDNTPIVI 675          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 215.698 bits (548), Expect = 1.488e-56
Identity = 204/689 (29.61%), Postives = 325/689 (47.17%), Query Frame = 1
Query:  559 KFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDID-GPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQT-NGDNMFGLNETTGELITL---VSPLKLGTYVLKFTARDNGVP 2586
            + EV++L +       I I +KD NDN P F +    +SIPEN+ + S   I  A D D +  N V  Y+  +    F +D     +     +L +Q+++D E+++ Y   ++  +  +   +   I+ + + D NDN P F +   E  I E+ P+G  +++++A D D GP  N   + +          R F ++  +G + ++  LD     ++ K  + ASD      +S   R  VII+V D+NDN P I +     +   +  T+ + E +P    I L +VSD+D   NG+V C +++D+    LK V    Y L ++   DYE            D GKPSL +   + + +ED N+ PP F       ++ EN      + T+ ATD D  K+AE++Y +       F +D KTG+++ S V FDRE      F V  +D+ T P  A   V + +LD NDN+P F  +  QFFV EN+  K    G +  TD D  + N  +    +   ++         F + P +G I++ V  DRE+  ++T  V+A DSG P   + A  TI V D+NDN P  IYP P N    + P      +I  S +AE       + A+D D      + Y + + N   +F ++  TG  ITL    +P  +G + L     D G P
Sbjct:  111 EIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPD-TGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGP--NAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLD-REETAIHKLSVLASDG-----SSSPARATVIINVTDVNDNPPNIDL---RYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDV-PFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNA-SFFDLDRKTGVLTASRV-FDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLP-KYSTVGVITVTDSDAGE-NAAISLSILNDNEN---------FILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYP-PSNTSFKLVPL----SSIPGSVVAE-------VFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGN-ITLEEKPAPTDIGLHRLVVNISDLGYP 760          

HSP 2 Score: 119.783 bits (299), Expect = 9.604e-27
Identity = 127/475 (26.74%), Postives = 205/475 (43.16%), Query Frame = 1
Query: 1270 IHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDV----GGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVL----KHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDP----VFLLSSLQ--FFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHK---LILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELIT--LVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            I V+D NDN P            S  + I I EN        + S +D D   N     EL     +  L  V    G  +  L      D E++D      + +D G P       +++ + DVN+  P F+ N+    + EN+P G+ V+ ++ATD D   +AE+ Y    +V     + F++++ +GLI+    P DRE T+I +  V   D  ++P  A V+  I + DVNDN P     +++S +    F+ E   I TK+   +  +D+D D     +  + +   +  +  H+K V+  +     +ET  +LD E    +   + A DSG P+    A   + + D NDN P                 I+  P I ++ + E +K    +  L A D+D      + Y L  N  + F L+  TG L    +        ++   TARDNG PPL   A++ V V D
Sbjct:  129 IIVKDTNDNAPMFP---------SPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQR-PLDREETAIHKLSVLASDGSSSPARATVI--INVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKI-ALITVSDKDTD-----INGKVICFIEKDVPFHLKAVYDNQYL---LETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPP-----------------IFTQPVIELA-VMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNA-SFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLD 563          

HSP 3 Score: 88.1965 bits (217), Expect = 4.588e-17
Identity = 142/606 (23.43%), Postives = 247/606 (40.76%), Query Frame = 1
Query:  922 QIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDT---GSLILKSQLDLSNRIS-VFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRV----SCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGS-------LRENTPPGSPV--LTVRATDRDKSAELIYSIDRKVLKHF-SIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKP---VFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVS--PLKLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTIII 2667
            +I I + D NDN P F       +I E+  +        A D D    +  +Y++++   ++        +P+      LI++  LD   + + V K ++      +   T++     + + V D+NDNKP         V R   + + I EN P    ++ L  +D D+  N  +      ++    + L   +   G   +    P D E+  + K      D    S     T+ I++ DVN+ PP   +  Y+ S       L E  P  + +  +TV   D D + ++I  I++ V  H  ++ +   L+ TS +  D E T    F++   D          LV++ + D NDN P+F    ++  V EN K    L   L+ATD D  +             + +++  + P    F +   TG +    V DRE    +  TV A D+G+P   A A   + V D NDN P++ +        H   F+ E           K+  +  +   D D  +   +   +  + +N F L+  +G + + VS    +  +Y     A D+G PP S+ A +T++V D     N N  I+I
Sbjct:  126 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELIN--GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAI-----LQVTVTDVNDNKP---------VFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITV--QRPLDREETAIHKLSVLASDGS--SSPARATVIINVTDVNDNPPNI-DLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSAL-LDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLT-TLSATDEDSGK-------------NAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTH-------NHFQFFVSEN--------LPKYSTVGVITVTDSDAGENAAISLSILNDNEN-FILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVID----VNDNTPIVI 675          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 215.698 bits (548), Expect = 2.025e-56
Identity = 204/689 (29.61%), Postives = 325/689 (47.17%), Query Frame = 1
Query:  559 KFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLED----LKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIV-IQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDID-GPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQT-NGDNMFGLNETTGELITL---VSPLKLGTYVLKFTARDNGVP 2586
            + EV++L +       I I +KD NDN P F +    +SIPEN+ + S   I  A D D +  N V  Y+  +    F +D     +     +L +Q+++D E+++ Y   ++  +  +   +   I+ + + D NDN P F +   E  I E+ P+G  +++++A D D GP  N   + +          R F ++  +G + ++  LD     ++ K  + ASD      +S   R  VII+V D+NDN P I +     +   +  T+ + E +P    I L +VSD+D   NG+V C +++D+    LK V    Y L ++   DYE            D GKPSL +   + + +ED N+ PP F       ++ EN      + T+ ATD D  K+AE++Y +       F +D KTG+++ S V FDRE      F V  +D+ T P  A   V + +LD NDN+P F  +  QFFV EN+  K    G +  TD D  + N  +    +   ++         F + P +G I++ V  DRE+  ++T  V+A DSG P   + A  TI V D+NDN P  IYP P N    + P      +I  S +AE       + A+D D      + Y + + N   +F ++  TG  ITL    +P  +G + L     D G P
Sbjct:  111 EIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPD-TGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGP--NAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLD-REETAIHKLSVLASDG-----SSSPARATVIINVTDVNDNPPNIDL---RYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDV-PFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNA-SFFDLDRKTGVLTASRV-FDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLP-KYSTVGVITVTDSDAGE-NAAISLSILNDNEN---------FILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYP-PSNTSFKLVPL----SSIPGSVVAE-------VFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGN-ITLEEKPAPTDIGLHRLVVNISDLGYP 760          

HSP 2 Score: 119.398 bits (298), Expect = 1.245e-26
Identity = 127/475 (26.74%), Postives = 205/475 (43.16%), Query Frame = 1
Query: 1270 IHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGL-SVSDRDLKENGRVSCELKEDLQSLELKDV----GGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRD--KSAELIYSIDRKVL----KHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDP----VFLLSSLQ--FFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHK---LILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELIT--LVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQD 2628
            I V+D NDN P            S  + I I EN        + S +D D   N     EL     +  L  V    G  +  L      D E++D      + +D G P       +++ + DVN+  P F+ N+    + EN+P G+ V+ ++ATD D   +AE+ Y    +V     + F++++ +GLI+    P DRE T+I +  V   D  ++P  A V+  I + DVNDN P     +++S +    F+ E   I TK+   +  +D+D D     +  + +   +  +  H+K V+  +     +ET  +LD E    +   + A DSG P+    A   + + D NDN P                 I+  P I ++ + E +K    +  L A D+D      + Y L  N  + F L+  TG L    +        ++   TARDNG PPL   A++ V V D
Sbjct:  129 IIVKDTNDNAPMFP---------SPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQ-RPLDREETAIHKLSVLASDGSSSPARATVI--INVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKI-ALITVSDKDTD-----INGKVICFIEKDVPFHLKAVYDNQYL---LETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPP-----------------IFTQPVIELA-VMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNA-SFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLD 563          

HSP 3 Score: 87.8113 bits (216), Expect = 5.013e-17
Identity = 142/606 (23.43%), Postives = 247/606 (40.76%), Query Frame = 1
Query:  922 QIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDT---GSLILKSQLDLSNRIS-VFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEP-AQKLIGLSVSDRDLKENGRV----SCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGS-------LRENTPPGSPV--LTVRATDRDKSAELIYSIDRKVLKHF-SIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKP---VFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVS--PLKLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTIII 2667
            +I I + D NDN P F       +I E+  +        A D D    +  +Y++++   ++        +P+      LI++  LD   + + V K ++      +   T++     + + V D+NDNKP         V R   + + I EN P    ++ L  +D D+  N  +      ++    + L   +   G   +    P D E+  + K      D    S     T+ I++ DVN+ PP   +  Y+ S       L E  P  + +  +TV   D D + ++I  I++ V  H  ++ +   L+ TS +  D E T    F++   D          LV++ + D NDN P+F    ++  V EN K    L   L+ATD D  +             + +++  + P    F +   TG +    V DRE    +  TV A D+G+P   A A   + V D NDN P++ +        H   F+ E           K+  +  +   D D  +   +   +  + +N F L+  +G + + VS    +  +Y     A D+G PP S+ A +T++V D     N N  I+I
Sbjct:  126 KIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELIN--GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAI-----LQVTVTDVNDNKP---------VFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITV--QRPLDREETAIHKLSVLASDGS--SSPARATVIINVTDVNDNPPNI-DLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSAL-LDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLT-TLSATDEDSGK-------------NAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTH-------NHFQFFVSEN--------LPKYSTVGVITVTDSDAGENAAISLSILNDNEN-FILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVID----VNDNTPIVI 675          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000076551.1 (SMESG000076551.1)

HSP 1 Score: 2338.15 bits (6058), Expect = 0.000e+0
Identity = 1167/1167 (100.00%), Postives = 1167/1167 (100.00%), Query Frame = 1
Query:  262 MVSVSLKKLFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPNVDYSVTYDNKYFSIIXXXXXXKEVIDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTIIIGMIAITVSISVFLIVAIICVRRQPRFQKYIPPSSGVKNDSGNPYCNPKHWNYHTEENPLPPDNESFVFLPPSYCSSPHPDQLTMQVINNSRPASRMDYHLSLPSSNTYNIIESSNGSQTAQNVERLNGTLRSNNGFYGTNIPNSMGIIINGQELDGDSADSGKGASEVDLRLQHQFNLGNRNYPTMPFPHYSTATTSFGHYNNVSPNQYYSINTNPRGLDSRFLTVNPSHLPTGRRVASPSNSNCKCFMLPEDDVIQINQDNGYSMSTFSNRPKAINHDKSCIYNVEELSPTVVGNFYEDYNYCESSAPLKDFSIIDPNEASLENRDIDQSFNDLTENNHNKNLYASLDKNNPEKNYYPIGLEAK 3762
            MVSVSLKKLFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPNVDYSVTYDNKYFSIINNNVVVKEVIDLEKLCDDGLCCGEDLCVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTIIIGMIAITVSISVFLIVAIICVRRQPRFQKYIPPSSGVKNDSGNPYCNPKHWNYHTEENPLPPDNESFVFLPPSYCSSPHPDQLTMQVINNSRPASRMDYHLSLPSSNTYNIIESSNGSQTAQNVERLNGTLRSNNGFYGTNIPNSMGIIINGQELDGDSADSGKGASEVDLRLQHQFNLGNRNYPTMPFPHYSTATTSFGHYNNVSPNQYYSINTNPRGLDSRFLTVNPSHLPTGRRVASPSNSNCKCFMLPEDDVIQINQDNGYSMSTFSNRPKAINHDKSCIYNVEELSPTVVGNFYEDYNYCESSAPLKDFSIIDPNEASLENRDIDQSFNDLTENNHNKNLYASLDKNNPEKNYYPIGLEAK
Sbjct:    1 MVSVSLKKLFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSNNFYPNVDYSVTYDNKYFSIINNNVVVKEVIDLEKLCDDGLCCGEDLCVIKFEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTIIIGMIAITVSISVFLIVAIICVRRQPRFQKYIPPSSGVKNDSGNPYCNPKHWNYHTEENPLPPDNESFVFLPPSYCSSPHPDQLTMQVINNSRPASRMDYHLSLPSSNTYNIIESSNGSQTAQNVERLNGTLRSNNGFYGTNIPNSMGIIINGQELDGDSADSGKGASEVDLRLQHQFNLGNRNYPTMPFPHYSTATTSFGHYNNVSPNQYYSINTNPRGLDSRFLTVNPSHLPTGRRVASPSNSNCKCFMLPEDDVIQINQDNGYSMSTFSNRPKAINHDKSCIYNVEELSPTVVGNFYEDYNYCESSAPLKDFSIIDPNEASLENRDIDQSFNDLTENNHNKNLYASLDKNNPEKNYYPIGLEAK 1167          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000033639.1 (SMESG000033639.1)

HSP 1 Score: 476.478 bits (1225), Expect = 2.933e-148
Identity = 366/1087 (33.67%), Postives = 552/1087 (50.78%), Query Frame = 1
Query:  307 IFIFN-CHAN--QIFNLSINEETPINSVVGNIQNFLSNNFYPNVDYSVTYDNKYFSIIXXX--XXXKEVIDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKN---SFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCE-LKEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTIIIGMIAITVSISVFLIVAIICVRRQPRFQKYIPPSSGVKNDSGNPYCNPKH----WNYHTEENPLPP------DNESFVFLPPSYCSS------------PHPDQLTMQVINNSRPASRMDYHLSLPSSNTYNIIESSNGSQTAQNVERLNGTLRSNNGFYGTNIPNSMGIIINGQELDGDSADSGKGASEVDLRLQHQFNLGNRNYPTMPFPHYSTATTSFGHYNNVSPNQYYSINTNPRGLDSRFLTVNPSHLPTGRRVASPSNSN-CKCFMLPEDDVIQINQDNGYSMST 3471
            IF+F  CH    Q     I EE+PI+ V+GNI      + +P+ + +  +    F  +++   +++   IDLE +C     C E++  I    I+    S +   S  I + + D NDN P F   KQ V++ EN  +   + ++ A+D D ++ NRV  Y F++ T TF +D S L  + L ++K +DYE ++ Y  TL+AC+ +  C+TQ  + I + D+NDN P FS++ Y+  I+E+FPVG++I+ VEAID D   FNK  Y      + N I   F I+ +TGS+ L+ +L    R   +KF++ A+DK+   F       N+ I V+D+NDN P I  L+GN         I+I E +P ++L  L V+D D+  N  VSC+ L++ +    L  VG   Y L S   +DYE E  IK   EC DHG P    ++++ +H++D+NE+ P F+ +     L EN   G  +L V A+DRD SA L YS   +   +F+ID  TG I +     DREM    +  + V D   NPKT    V IE+LD NDN P F+  S  F + EN+   +K+ G++ ATD+D D++NN V ++    +D +  R  +P+F++   +GEI T+  LDRE   N+T+ ++A+D+G P   A  N TIYV D NDN P+W+ P   +   H          +NI+  +    LI+KL+A D D  +   V Y +  N   +F LN+ TGEL  +   L +G + L   A DNG PP  N+ S+ + + +    A +N++III +I IT  IS+FLI+AIICVRR+PR+      + G +N    P  +  H    W +HT+E    P      DN S ++ P    SS            PHP  +T Q I+N        Y+ ++ +S+ Y +   S    +  N+ R+       +         S G +    E+D DSADSGKG SE D  L     LG         PH S  +          P Q  ++N    G              +  R A P   N C C++LPED V+Q  Q+N    S+
Sbjct:    8 IFLFYLCHQGSCQTVTFKIMEESPIDMVIGNIV-----HLHPSFNKASYFIKSPFLKLSDKGDLMLSSRIDLETICAQHEMCCEEVECILKTTIMAKDKSSDQSESINIHVSVSDKNDNWPKFVKPKQTVNVAENEPIGFYLYLDRALDADATSANRVHQYIFKEPTGTFNLDQSRLPSIGLIVKKPLDYEVKSQYFATLEACDTNKQCNTQA-LEIHVLDQNDNYPSFSQQEYQIEILENFPVGQQIIAVEAIDKDSDLFNKIIYGFHELSDNN-IRNTFIITENTGSIKLQKKLSAKVR-QKYKFKVFAADKMAMAFHKA--VANIFIKVKDLNDNSPKITSLSGNS-------KIEINETDPPRELFTLQVTDDDIGVNANVSCQLLQQYINDFRLDAVGNEIYSLSSIRSFDYENEREIKAEIECYDHGSPRNVAHKSLNVHVKDINEFAPRFEKDFQKLKLLENREQGHNILQVSASDRDGSAVLKYSFTGEPNDYFTIDPHTGQIKSGIRRLDREMVERIEINIIVTDAIENPKTGQCTVIIEVLDENDNPPTFIDISGVFNISENLSSYSKVRGRIAATDKDKDEINNKVLFQLQHTFDSQNRRISEPIFKVT-ESGEILTVKKLDREINHNYTVEIRAFDTGLPMLSAHKNFTIYVEDQNDNDPDWVTPLSSHGGIH---------TVNITANSPPGYLIIKLQATDPDYGENSNVTYSVMNNNKLLFILNQVTGEL-RVARLLPIGQFQLFLRASDNGRPPRHNETSLFIFI-NGDEVATLNMSIIIVLIGITGFISIFLIIAIICVRRRPRYNN--TDTMGSQNSFEPPKTSNHHVTGTWGHHTDEGSYYPSGNFLSDNTSVLYFPNEIDSSVPMNTFVSKSNVPHP-LITYQNIDNC-------YYPNMSNSSGY-LRNCSTLGNSQTNIVRIPANSNCCDM-------TSAGSVGRFNEMDDDSADSGKGGSEDDNGLHQMPLLG---------PHNSFESNGKSRLYTTMPYQNRTLNNGRMG--------------SRARGALPHTINHCPCYILPEDSVVQSIQNNSNCHSS 1024          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000033639.1 (SMESG000033639.1)

HSP 1 Score: 470.7 bits (1210), Expect = 2.096e-146
Identity = 359/1067 (33.65%), Postives = 543/1067 (50.89%), Query Frame = 1
Query:  358 EETPINSVVGNIQNFLSNNFYPNVDYSVTYDNKYFSIIXXXX--XXKEVIDLEKXXXXXXXXXXXXXVIKFEVIILGSYSKN---SFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCEL-KEDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGELITLVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTIIIGMIAITVSISVFLIVAIICVRRQPRFQKYIPPSSGVKNDSGNPYCNPKH----WNYHTEENPLPP------DNESFVFLPPSYCSS------------PHPDQLTMQVINNSRPASRMDYHLSLPSSNTYNIIESSNGSQTAQNVERLNGTLRSNNGFYGTNIPNSMGIIINGQELDGDSADSGKGASEVDLRLQHQFNLGNRNYPTMPFPHYSTATTSFGHYNNVSPNQYYSINTNPRGLDSRFLTVNPSHLPTGRRVASPSNSN-CKCFMLPEDDVIQINQDNGYSMST 3471
            EE+PI+ V+GNI +      +P+ + +  +    F  +++    ++   IDLE +C     C E++  I    I+    S +   S  I + + D NDN P F   KQ V++ EN  +   + ++ A+D D ++ NRV  Y F++ T TF +D S L  + L ++K +DYE ++ Y  TL+AC+ +  C+TQ  + I + D+NDN P FS++ Y+  I+E+FPVG++I+ VEAID D   FNK  Y      + N I   F I+ +TGS+ L+ +L    R   +KF++ A+DK+   F       N+ I V+D+NDN P I  L+GN         I+I E +P ++L  L V+D D+  N  VSC+L ++ +    L  VG   Y L S   +DYE E  IK   EC DHG P    ++++ +H++D+NE+ P F+ +     L EN   G  +L V A+DRD SA L YS   +   +F+ID  TG I +     DREM    +  + V D   NPKT    V IE+LD NDN P F+  S  F + EN+   +K+ G++ ATD+D D++NN V ++    +D +  R  +P+F++   +GEI T+  LDRE   N+T+ ++A+D+G P   A  N TIYV D NDN P+W+ P   +   H          +NI+  +    LI+KL+A D D  +   V Y +  N   +F LN+ TGEL  +   L +G + L   A DNG PP  N+ S+ + +  +   A +N++III +I IT  IS+FLI+AIICVRR+PR+      + G +N    P  +  H    W +HT+E    P      DN S ++ P    SS            PHP  +T Q I+N        Y+ ++ +S+ Y +   S    +  N+ R+       +         S G +    E+D DSADSGKG SE D  L     LG         PH S  +          P Q  ++N    G              +  R A P   N C C++LPED V+Q  Q+N    S+
Sbjct:    2 EESPIDMVIGNIVHL-----HPSFNKASYFIKSPFLKLSDKGDLMLSSRIDLETICAQHEMCCEEVECILKTTIMAKDKSSDQSESINIHVSVSDKNDNWPKFVKPKQTVNVAENEPIGFYLYLDRALDADATSANRVHQYIFKEPTGTFNLDQSRLPSIGLIVKKPLDYEVKSQYFATLEACDTNKQCNTQA-LEIHVLDQNDNYPSFSQQEYQIEILENFPVGQQIIAVEAIDKDSDLFNKIIYGFHELSDNN-IRNTFIITENTGSIKLQKKLSAKVR-QKYKFKVFAADKMAMAFHKA--VANIFIKVKDLNDNSPKITSLSGNS-------KIEINETDPPRELFTLQVTDDDIGVNANVSCQLLQQYINDFRLDAVGNEIYSLSSIRSFDYENEREIKAEIECYDHGSPRNVAHKSLNVHVKDINEFAPRFEKDFQKLKLLENREQGHNILQVSASDRDGSAVLKYSFTGEPNDYFTIDPHTGQIKSGIRRLDREMVERIEINIIVTDAIENPKTGQCTVIIEVLDENDNPPTFIDISGVFNISENLSSYSKVRGRIAATDKDKDEINNKVLFQLQHTFDSQNRRISEPIFKVT-ESGEILTVKKLDREINHNYTVEIRAFDTGLPMLSAHKNFTIYVEDQNDNDPDWVTPLSSHGGIH---------TVNITANSPPGYLIIKLQATDPDYGENSNVTYSVMNNNKLLFILNQVTGEL-RVARLLPIGQFQLFLRASDNGRPPRHNETSLFIFINGD-EVATLNMSIIIVLIGITGFISIFLIIAIICVRRRPRYNN--TDTMGSQNSFEPPKTSNHHVTGTWGHHTDEGSYYPSGNFLSDNTSVLYFPNEIDSSVPMNTFVSKSNVPHP-LITYQNIDNC-------YYPNMSNSSGY-LRNCSTLGNSQTNIVRIPANSNCCDM-------TSAGSVGRFNEMDDDSADSGKGGSEDDNGLHQMPLLG---------PHNSFESNGKSRLYTTMPYQNRTLNNGRMG--------------SRARGALPHTINHCPCYILPEDSVVQSIQNNSNCHSS 998          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000051413.1 (SMESG000051413.1)

HSP 1 Score: 427.557 bits (1098), Expect = 1.021e-130
Identity = 325/989 (32.86%), Postives = 513/989 (51.87%), Query Frame = 1
Query:  328 ANQIFNLSINEETPINSVVGNIQNFLSNNFYPN---VDYSVTYDNKYFSIIXXXXXXKEV--IDLEKXXXXXXXXXXXXXVIKFEVIILGSYS--KNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFT--IDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELK---EDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQT-----NGDNMFGLNETTGELITLVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQ--DNGRFANINLTIIIGMIAITVSISVFLIVAIICVRRQPRFQKYIPPSSGVKNDSGNPYCNPKHWNYHTEENPLPPDNESFVFLPPSYCSSPHPDQLTMQVINNSRPASRMDYHLSLPSSNTYNIIESSNGSQTAQNVERLNGTLRSNNGFYGTN-----IPNSMGIIING---QELDGDSADSGKGASEVDLRLQHQFNLGNRN 3213
            ++Q     + EE     ++GN+  F+++    +    ++ V+  +KYF I N    V+ V  IDL+ +C     C +    +    +++  YS  K+SF + +E+KD++DN P F  +KQI+ + E   + + I I+GA+DKDFS  N+ K+Y+F D + TF   +   + + L + + +S++YE + +Y   L+ C+ +     +  I++Q+ DENDN P F ++ Y   I ES+P+GK+ILKV A D D   FNKT Y   S  N   +   F I  ++G + LK  L + N+ S + F + A D L   F   +D  +V I +ED+NDN P I +L G + +      I+I EN P + L  + VSD+D   N  V+C L+   +DL  LE+       Y + +   +DYE   LI+    C D G P+L   + I+I I DVNE+ P  +NN    S +EN P    ++++ A+D+DK A L YS+D     +F+I+++TG I  S V  D+EM    +F+V + D   NP TA + V + ILD NDN P F + +L F +QE +   +KL  ++ A D D D++N+ + +  +  Y++K+    + +F +  + GEIET+V +DREK  N+T+T+ A D G+P +    N TI V D+NDN P W+ P  +N     + F       NIS  A    ++ +LKA+DQD++D G++ Y + +      G+    LNET+G L     PL  G  +LK +A D+G PPL N A++ ++VQ  ++  F+ +N+ IIIGM++IT  IS+FLI+AI  +RR P                 NP   P+H+ +  +      DN     L  SY                      +DY+         +  ES        +V   NG L SN   Y  +      P  +     G    E+DG+SADSGKG S++D+  Q      + N
Sbjct:   24 SSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVS--SKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKDLDDNFPLFLDDKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYN---VKSIFNIEKESGVISLKQSLSI-NKKSRYLFTVYAIDALSVTFK--KDYADVEIEIEDVNDNYPIISLLHGYMPDP---YAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDL--LEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARF-------NISKEAAIGSIVAQLKALDQDQDDFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGMLSITALISIFLIIAIFFIRRSP-----------------NP---PRHYRHSNQNIRKECDNN----LKSSY-------------------KDLVDYN---------DKKESVFTDSDCHHVYYRNGNLDSNLAMYSQSPVEGVCPTYVRFATPGSYLHEMDGESADSGKGTSDLDVAHQSSMKASSTN 938          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000051413.1 (SMESG000051413.1)

HSP 1 Score: 427.172 bits (1097), Expect = 1.490e-130
Identity = 324/980 (33.06%), Postives = 511/980 (52.14%), Query Frame = 1
Query:  328 ANQIFNLSINEETPINSVVGNIQNFLSNNFYPN---VDYSVTYDNKYFSIIXXXXXXKEV--IDLEKXXXXXXXXXXXXXVIKFEVIILGSYS--KNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIKIEGAIDKDFSAKNRVKSYKFEDSTKTFT--IDNSNLEDLKLFLQKSIDYEKQNLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFPVGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILKSQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIKVLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELK---EDLQSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIEIHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSIDRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANVLVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMNNFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITVKAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETPAINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQT-----NGDNMFGLNETTGELITLVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQ--DNGRFANINLTIIIGMIAITVSISVFLIVAIICVRRQPRFQKYIPPSSGVKNDSGNPYCNPKHWNYHTEENPLPPDNESFVFLPPSYCSSPHPDQLTMQVINNSRPASRMDYHLSLPSSNTYNIIESSNGSQTAQNVERLNGTLRSNNGFYGTN-----IPNSMGIIING---QELDGDSADSGKGASEVDLRLQ 3186
            ++Q     + EE     ++GN+  F+++    +    ++ V+  +KYF I N    V+ V  IDL+ +C     C +    +    +++  YS  K+SF + +E+KD++DN P F  +KQI+ + E   + + I I+GA+DKDFS  N+ K+Y+F D + TF   +   + + L + + +S++YE + +Y   L+ C+ +     +  I++Q+ DENDN P F ++ Y   I ES+P+GK+ILKV A D D   FNKT Y   S  N   +   F I  ++G + LK  L + N+ S + F + A D L   F   +D  +V I +ED+NDN P I +L G + +      I+I EN P + L  + VSD+D   N  V+C L+   +DL  LE+       Y + +   +DYE   LI+    C D G P+L   + I+I I DVNE+ P  +NN    S +EN P    ++++ A+D+DK A L YS+D     +F+I+++TG I  S V  D+EM    +F+V + D   NP TA + V + ILD NDN P F + +L F +QE +   +KL  ++ A D D D++N+ + +  +  Y++K+    + +F +  + GEIET+V +DREK  N+T+T+ A D G+P +    N TI V D+NDN P W+ P  +N     + F       NIS  A    ++ +LKA+DQD++D G++ Y + +      G+    LNET+G L     PL  G  +LK +A D+G PPL N A++ ++VQ  ++  F+ +N+ IIIGM++IT  IS+FLI+AI  +RR P                 NP   P+H+ +  +      DN     L  SY                      +DY+         +  ES        +V   NG L SN   Y  +      P  +     G    E+DG+SADSGKG S++D+  Q
Sbjct:   24 SSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVS--SKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKDLDDNFPLFLDDKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYN---VKSIFNIEKESGVISLKQSLSI-NKKSRYLFTVYAIDALSVTFK--KDYADVEIEIEDVNDNYPIISLLHGYMPDP---YAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDL--LEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARF-------NISKEAAIGSIVAQLKALDQDQDDFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGMLSITALISIFLIIAIFFIRRSP-----------------NP---PRHYRHSNQNIRKECDNN----LKSSY-------------------KDLVDYN---------DKKESVFTDSDCHHVYYRNGNLDSNLAMYSQSPVEGVCPTYVRFATPGSYLHEMDGESADSGKGTSDLDVAHQ 929          
The following BLAST results are available for this feature:
BLAST of Protocadherin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11Y6.047e-5928.25protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH97.083e-5930.51protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH11Y2.049e-5828.25protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y2.049e-5828.25protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH92.208e-5830.51protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
back to top
BLAST of Protocadherin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-11.072e-3226.31FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-11.418e-3226.49FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-16.270e-2924.79CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-13.575e-2725.23Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-13.575e-2725.23Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds2.864e-6129.26gene:FBgn0284247 transcript:FBtr0078045[more]
ds2.864e-6129.26gene:FBgn0284247 transcript:FBtr0343249[more]
ft1.140e-4225.10gene:FBgn0001075 transcript:FBtr0077478[more]
stan1.029e-3927.40gene:FBgn0024836 transcript:FBtr0330601[more]
stan1.053e-3927.40gene:FBgn0024836 transcript:FBtr0339463[more]
back to top
BLAST of Protocadherin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh111.628e-5726.83protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh111.789e-5726.79protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh1a1.863e-5729.06protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a1.918e-5729.22protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
CR847522.11.101e-5630.01pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:487... [more]
back to top
BLAST of Protocadherin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000047798.11.802e-5927.79protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047804.11.945e-5927.79protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047801.11.956e-5927.79protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
vapa7.476e-5729.94VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000027070.14.011e-5126.24pep primary_assembly:Xenopus_tropicalis_v9.1:3:190... [more]
back to top
BLAST of Protocadherin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh94.940e-5830.23protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh11x1.084e-5728.43protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.369e-5728.43protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.369e-5728.43protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.408e-5728.43protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24292|DS_DROME3.363e-6029.26Protein dachsous OS=Drosophila melanogaster OX=722... [more]
sp|Q9BZA8|PC11Y_HUMAN2.904e-5828.25Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q9HC56|PCDH9_HUMAN1.060e-5730.51Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q6X862|PC11X_GORGO1.092e-5728.25Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q6WYY1|PC11X_PANPA1.034e-5628.02Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
back to top
BLAST of Protocadherin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6UEM32.440e-10129.51Protocadherin OS=Echinococcus granulosus OX=6210 G... [more]
A0A068WWV15.519e-10029.63Protocadherin 9 OS=Echinococcus granulosus OX=6210... [more]
A0A087VXD33.265e-9831.66Protocadherin 9 OS=Echinococcus multilocularis OX=... [more]
A0A4Z2DTR83.658e-9230.16Protocadherin-1 isoform 1 OS=Schistosoma japonicum... [more]
A0A3Q0KTJ19.485e-9229.66Putative cadherin OS=Schistosoma mansoni OX=6183 P... [more]
back to top
BLAST of Protocadherin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh118.633e-6026.86protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh111.601e-5926.86protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh1a8.152e-5829.59protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a1.061e-5729.40protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh92.189e-5730.45protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
back to top
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh111.166e-4627.63protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
si:ch211-199f5.11.139e-4228.34protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000010725.13.351e-4126.67pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000008517.11.236e-4026.88pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000004042.15.853e-4024.22pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461897.259e-6130.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404705.079e-4930.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354123.956e-4628.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303642.891e-4526.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482372.577e-4428.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a7.838e-6029.20protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a2.484e-5928.92protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh93.239e-5729.61protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh91.488e-5629.61protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh92.025e-5629.61protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
back to top
BLAST of Protocadherin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076551.10.000e+0100.00SMESG000076551.1[more]
SMESG000033639.12.933e-14833.67SMESG000033639.1[more]
SMESG000033639.12.096e-14633.65SMESG000033639.1[more]
SMESG000051413.11.021e-13032.86SMESG000051413.1[more]
SMESG000051413.11.490e-13033.06SMESG000051413.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026540 ID=SMED30026540|Name=Protocadherin|organism=Schmidtea mediterranea sexual|type=transcript|length=3804bp
CTCTTAATTCGCAATAATCAATTGTTGACTAGCCATTCAATTTTACACAG
CAAAAGTAACAGCAAAAATAACAATAACTACACCAATACACCGTAGAGAT
TGCATTAGACATAAATTATATATACAAATACAAAATTTCCAACACCAAAT
ACTTAGTTAGCGAATATTGTCGAATAGTGCTACAATTGTGATTTTACTTA
ATTATTTTTCATATCGGATTTGATTTCGTCAATAATATTGCACCAAATCA
GCGTCAAGATAATGGTTTCAGTATCTTTGAAGAAGTTATTTTTTATACCA
ATATCGATTTTCATTTTCAATTGTCACGCTAATCAAATTTTCAATTTAAG
CATAAACGAGGAGACTCCAATTAATTCTGTTGTAGGCAATATTCAAAATT
TCTTGTCGAACAATTTTTATCCGAACGTTGATTATTCAGTCACTTATGAT
AATAAATACTTTTCAATAATTAACAATAATGTTGTCGTGAAAGAAGTAAT
TGATCTGGAAAAACTATGCGATGATGGTCTTTGTTGTGGAGAAGATTTAT
GTGTTATTAAGTTCGAAGTAATTATACTTGGCAGTTATTCTAAAAATTCA
TTCATTATATCGATTGAAATTAAAGATATCAACGACAATAAGCCATATTT
TAGAACGAATAAACAGATTGTTAGCATTCCAGAAAATTCTGACTTAGTTT
CTATAATAAAAATTGAAGGTGCTATTGATAAAGATTTTTCAGCGAAAAAT
CGTGTGAAAAGCTACAAGTTCGAAGACAGCACAAAAACTTTCACTATTGA
CAATTCGAACCTCGAAGACTTAAAATTATTTTTACAAAAATCTATCGATT
ATGAAAAACAAAATCTCTACACTGGAACTTTGCAAGCTTGCGAAGACAGC
ACAGGTTGTTCGACCCAGTGCCAAATCGTTATCCAAATTGATGATGAGAA
TGACAACATTCCGAAATTCAGTAAAGAAAGCTATGAAAAAACAATTGTAG
AAAGTTTTCCAGTCGGCAAAGAGATTTTGAAAGTTGAAGCCATTGACATA
GATGGGCCGAAATTCAATAAAACCGAATACAAAATCGTCAGCAAAGGAAA
CCGGAATTTGATCAGTCGATATTTCAAAATCTCTCCCGACACTGGCAGCT
TAATTCTCAAATCTCAACTCGATTTGTCGAATCGTATTTCGGTATTCAAG
TTTCAAATTAGTGCAAGCGATAAATTGAAATCGAAATTTACCAGTGTCGA
AGACAGAACAAATGTTATAATCCATGTTGAGGACATCAATGACAATAAAC
CGACAATCAAAGTATTGGCGGGCAATGTTGTGGAAAGGAGCATGTTTTTG
ACGATTAAAATCAAGGAAAATGAGCCAGCTCAAAAATTGATCGGTTTATC
GGTCAGTGATCGAGATCTGAAAGAAAATGGACGGGTAAGCTGTGAATTGA
AAGAAGATCTTCAATCGTTGGAATTAAAAGATGTGGGTGGAGGGTTTTAT
GACTTGTGGAGTACACATCCATACGATTATGAGAAGGAAGATCTTATTAA
AACTTTATTTGAATGTCAGGATCATGGAAAGCCATCTCTGAAAGAATATC
GAACGATTGAAATTCATATTGAAGATGTCAATGAATATCCTCCGGGTTTC
CAAAATAATGAATACTTAGGTTCGTTGCGAGAAAACACTCCCCCTGGTTC
ACCAGTACTCACAGTGCGAGCGACTGATCGAGACAAATCAGCAGAATTGA
TCTATTCAATCGACCGGAAAGTTTTGAAACACTTTTCAATTGACAATAAA
ACCGGACTGATTTCAACGTCATTTGTCCCGTTTGACCGAGAAATGACTTC
AATAAAACAATTTGAAGTCAATGTCAAAGACGACAAGACAAATCCAAAAA
CCGCCAATGTGTTAGTGAAAATCGAAATTCTTGATGTCAACGACAACGAT
CCGGTTTTTCTGTTGAGTAGTTTGCAGTTTTTCGTCCAGGAAAATGTGAA
AATCAAAACCAAACTCGAAGGAAAATTGAATGCGACAGATCGAGACTGTG
ATCAGATGAATAATTTTGTCAAATATGAATTCATGACTCTGTATGATCAT
AAATTGATAAGACACATGAAACCGGTTTTTCAGATCAGACCCACAACTGG
AGAAATTGAAACTCTCGTAGTTTTGGATCGAGAAAAATATCCGAATTGGA
CAATTACTGTTAAAGCGTATGACAGTGGTAGTCCTACTCGGTTTGCATTT
GCTAACGCAACGATTTACGTCCGAGATTTGAATGACAATCAGCCGGAATG
GATTTATCCTCGGCCAATTAATTTCCAACGACATATTTCACCATTTATTT
ATGAAACCCCCGCTATAAATATATCAGATATCGCAGAGAAACACAAGTTA
ATACTGAAATTAAAAGCAATAGATCAAGACGAAAACGATGCTGGACGGGT
GTGTTATTACCTTCAAACGAATGGAGACAATATGTTTGGATTGAATGAAA
CAACAGGAGAATTAATAACGCTTGTCAGTCCTCTTAAACTTGGAACTTAT
GTCCTGAAATTTACAGCTAGAGATAACGGAGTTCCCCCCTTATCCAATGA
TGCATCTATCACAGTTCATGTTCAAGATAATGGAAGATTTGCAAACATTA
ATTTAACAATAATCATCGGAATGATAGCTATCACTGTATCAATATCTGTA
TTTCTGATTGTTGCAATTATCTGTGTTCGACGTCAGCCAAGATTCCAAAA
ATATATTCCCCCTTCGTCGGGCGTCAAAAATGACAGCGGAAATCCATATT
GTAATCCAAAACATTGGAATTACCACACAGAAGAAAACCCATTGCCGCCT
GACAATGAGAGCTTTGTCTTTTTACCACCTTCCTATTGTTCTAGTCCACA
TCCTGATCAGTTGACGATGCAAGTTATCAACAATTCAAGACCGGCTTCAA
GAATGGACTACCATTTGTCACTTCCATCTTCTAACACATACAATATCATT
GAGAGTTCTAATGGATCCCAAACTGCACAAAATGTCGAAAGGTTGAATGG
AACACTACGATCCAATAATGGGTTTTACGGAACAAATATACCTAATTCAA
TGGGTATTATAATAAATGGGCAAGAATTAGATGGTGATAGTGCTGACAGT
GGTAAAGGAGCCAGTGAAGTAGATTTAAGGCTTCAGCATCAATTTAATTT
AGGAAATCGAAACTATCCGACAATGCCATTTCCTCATTATTCTACCGCAA
CAACTTCATTTGGGCATTATAATAATGTATCACCTAACCAATACTATTCA
ATTAACACTAATCCCAGAGGATTAGATTCAAGATTTCTAACTGTAAACCC
ATCCCATTTACCAACAGGTAGACGTGTAGCATCTCCATCTAATTCCAATT
GTAAATGCTTTATGTTACCCGAGGATGATGTGATCCAGATCAATCAGGAT
AATGGGTATTCAATGAGCACATTTTCAAATAGACCCAAGGCAATCAATCA
TGACAAAAGCTGTATTTACAATGTAGAAGAATTATCGCCGACTGTCGTTG
GGAATTTCTATGAAGATTATAATTATTGCGAATCTTCAGCACCCTTGAAA
GATTTTTCTATAATCGATCCGAATGAAGCTTCTTTGGAAAACCGGGACAT
AGATCAATCTTTTAATGATTTGACCGAAAATAATCACAACAAAAATCTGT
ACGCATCACTTGATAAAAATAATCCCGAAAAGAATTATTATCCCATTGGC
TTGGAGGCCAAGTGATATAGTTTTTGTGATACTTTTCTATATTCCATATT
TGTA
back to top

protein sequence of SMED30026540-orf-1

>SMED30026540-orf-1 ID=SMED30026540-orf-1|Name=SMED30026540-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1168bp
MVSVSLKKLFFIPISIFIFNCHANQIFNLSINEETPINSVVGNIQNFLSN
NFYPNVDYSVTYDNKYFSIINNNVVVKEVIDLEKLCDDGLCCGEDLCVIK
FEVIILGSYSKNSFIISIEIKDINDNKPYFRTNKQIVSIPENSDLVSIIK
IEGAIDKDFSAKNRVKSYKFEDSTKTFTIDNSNLEDLKLFLQKSIDYEKQ
NLYTGTLQACEDSTGCSTQCQIVIQIDDENDNIPKFSKESYEKTIVESFP
VGKEILKVEAIDIDGPKFNKTEYKIVSKGNRNLISRYFKISPDTGSLILK
SQLDLSNRISVFKFQISASDKLKSKFTSVEDRTNVIIHVEDINDNKPTIK
VLAGNVVERSMFLTIKIKENEPAQKLIGLSVSDRDLKENGRVSCELKEDL
QSLELKDVGGGFYDLWSTHPYDYEKEDLIKTLFECQDHGKPSLKEYRTIE
IHIEDVNEYPPGFQNNEYLGSLRENTPPGSPVLTVRATDRDKSAELIYSI
DRKVLKHFSIDNKTGLISTSFVPFDREMTSIKQFEVNVKDDKTNPKTANV
LVKIEILDVNDNDPVFLLSSLQFFVQENVKIKTKLEGKLNATDRDCDQMN
NFVKYEFMTLYDHKLIRHMKPVFQIRPTTGEIETLVVLDREKYPNWTITV
KAYDSGSPTRFAFANATIYVRDLNDNQPEWIYPRPINFQRHISPFIYETP
AINISDIAEKHKLILKLKAIDQDENDAGRVCYYLQTNGDNMFGLNETTGE
LITLVSPLKLGTYVLKFTARDNGVPPLSNDASITVHVQDNGRFANINLTI
IIGMIAITVSISVFLIVAIICVRRQPRFQKYIPPSSGVKNDSGNPYCNPK
HWNYHTEENPLPPDNESFVFLPPSYCSSPHPDQLTMQVINNSRPASRMDY
HLSLPSSNTYNIIESSNGSQTAQNVERLNGTLRSNNGFYGTNIPNSMGII
INGQELDGDSADSGKGASEVDLRLQHQFNLGNRNYPTMPFPHYSTATTSF
GHYNNVSPNQYYSINTNPRGLDSRFLTVNPSHLPTGRRVASPSNSNCKCF
MLPEDDVIQINQDNGYSMSTFSNRPKAINHDKSCIYNVEELSPTVVGNFY
EDYNYCESSAPLKDFSIIDPNEASLENRDIDQSFNDLTENNHNKNLYASL
DKNNPEKNYYPIGLEAK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 463..492
score: 39.32
coord: 628..654
score: 28.06
coord: 286..305
score: 28.44
coord: 545..564
score: 39.46
coord: 662..679
score: 37.7
coord: 564..577
score: 36.24
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 717..792
e-value: 5.4E-6
score: 35.9
coord: 485..564
e-value: 1.3E-17
score: 74.5
coord: 589..678
e-value: 2.5E-17
score: 73.6
coord: 152..234
e-value: 1.5E-6
score: 37.7
coord: 258..347
e-value: 2.2E-13
score: 60.5
coord: 379..461
e-value: 6.3E-9
score: 45.7
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 573..670
e-value: 1.0E-9
score: 38.7
coord: 706..788
e-value: 2.2E-11
score: 44.1
coord: 468..557
e-value: 1.0E-11
score: 45.1
coord: 244..340
e-value: 5.0E-9
score: 36.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 696..790
e-value: 2.7E-13
score: 52.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 27..123
e-value: 1.3E-8
score: 36.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 459..561
e-value: 5.9E-24
score: 86.7
coord: 562..681
e-value: 3.0E-22
score: 81.2
coord: 124..231
e-value: 9.1E-15
score: 57.1
coord: 232..346
e-value: 2.3E-23
score: 84.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 347..458
e-value: 1.3E-13
score: 53.4
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 539..907
coord: 11..566
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 567..680
score: 20.81
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 359..463
score: 11.624
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 696..789
score: 12.874
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 237..349
score: 21.16
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 131..236
score: 16.25
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 464..566
score: 21.336
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 23..130
score: 10.462
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 570..676
e-value: 2.53206E-20
score: 84.6725
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 364..458
e-value: 3.61711E-7
score: 47.3082
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 467..562
e-value: 1.37653E-24
score: 96.9989
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 713..789
e-value: 7.85168E-16
score: 71.9609
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 240..345
e-value: 5.21434E-19
score: 81.2057
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 26..126
e-value: 9.79622E-4
score: 37.6782
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 137..232
e-value: 9.41533E-11
score: 57.7086
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.462
NoneNo IPR availableTMHMMTMhelixcoord: 800..822
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 554..564
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 668..678
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 224..234
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 337..347
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 118..128
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 342..456
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 451..582
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 674..789
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 554..686
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 224..351
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 124..236