Rho-related GTP-binding protein

Overview
NameRho-related GTP-binding protein
Smed IDSMED30026534
Length (bp)1215
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rho-related GTP-binding protein (SMED30026534) t-SNE clustered cells

Violin plots show distribution of expression levels for Rho-related GTP-binding protein (SMED30026534) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rho-related GTP-binding protein (SMED30026534) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rho-related GTP-binding protein (SMED30026534) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026534

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30026534SMESG000022390.1 dd_Smed_v4_578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30026534SMESG000022390.1 dd_Smed_v4_578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30026534SMESG000022390.1 dd_Smed_v4_578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026534SMESG000022390.1 dd_Smed_v4_578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026534SMESG000022390.1 dd_Smed_v4_578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30026534SMESG000022390.1 dd_Smed_v4_578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30026534SMESG000022390.1 dd_Smed_v4_578_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30026534SMESG000022390.1 dd_Smed_v6_578_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026534SMESG000022390.1 dd_Smed_v6_578_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026534SMESG000022390.1 dd_Smed_v4_578_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rho-related GTP-binding protein vs. Ensembl Human
Match: RHOA (ras homolog family member A [Source:HGNC Symbol;Acc:HGNC:667])

HSP 1 Score: 303.523 bits (776), Expect = 1.234e-102
Identity = 147/171 (85.96%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RIGA+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Human
Match: RHOC (ras homolog family member C [Source:HGNC Symbol;Acc:HGNC:669])

HSP 1 Score: 297.745 bits (761), Expect = 2.511e-100
Identity = 142/171 (83.04%), Postives = 155/171 (90.64%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY+ADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLR D+ +R++  K K E V+ E+G+ MA+RI A+ Y+ECSAKTK+GVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Human
Match: RHOC (ras homolog family member C [Source:HGNC Symbol;Acc:HGNC:669])

HSP 1 Score: 296.59 bits (758), Expect = 6.754e-100
Identity = 142/171 (83.04%), Postives = 155/171 (90.64%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY+ADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLR D+ +R++  K K E V+ E+G+ MA+RI A+ Y+ECSAKTK+GVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Human
Match: RHOC (ras homolog family member C [Source:HGNC Symbol;Acc:HGNC:669])

HSP 1 Score: 296.59 bits (758), Expect = 6.754e-100
Identity = 142/171 (83.04%), Postives = 155/171 (90.64%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY+ADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLR D+ +R++  K K E V+ E+G+ MA+RI A+ Y+ECSAKTK+GVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Human
Match: RHOC (ras homolog family member C [Source:HGNC Symbol;Acc:HGNC:669])

HSP 1 Score: 296.59 bits (758), Expect = 6.754e-100
Identity = 142/171 (83.04%), Postives = 155/171 (90.64%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY+ADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLR D+ +R++  K K E V+ E+G+ MA+RI A+ Y+ECSAKTK+GVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Celegans
Match: rho-1 (Ras-like GTP-binding protein rhoA [Source:UniProtKB/Swiss-Prot;Acc:Q22038])

HSP 1 Score: 295.434 bits (755), Expect = 7.560e-100
Identity = 142/171 (83.04%), Postives = 156/171 (91.23%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSS-RKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFP+VYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEV+HFC NVPIILVGNK+DLR+D  + R+  K K E VK E G+A+A++IGA+AY+ECSAKTKDG+REVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPDVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVRHFCPNVPIILVGNKRDLRSDPQTVRELAKMKQEPVKPEQGRAIAEQIGAFAYLECSAKTKDGIREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Celegans
Match: ced-10 (Ras-related protein ced-10 [Source:UniProtKB/Swiss-Prot;Acc:Q03206])

HSP 1 Score: 195.282 bits (495), Expect = 1.009e-60
Identity = 90/166 (54.22%), Postives = 118/166 (71.08%), Query Frame = 1
Query:  127 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRND-DSSRKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
            K V+VGDGA GKTCLLI ++ + FP  Y+PTVF+NY A++ VD + + L LWDTAGQEDYDRLRPLSYP TDV L+CF++++  S EN+  KW PEV H C N PIILVG K DLR D D+  +  + +++ V    G  MA  I A  Y+ECSA T+ G+++VF+
Sbjct:    5 KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAGQEDYDRLRPLSYPQTDVFLVCFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTVERLRERRLQPVSQTQGYVMAKEIKAVKYLECSALTQRGLKQVFD 170          
BLAST of Rho-related GTP-binding protein vs. Ensembl Celegans
Match: mig-2 (Rac-like GTPase [Source:UniProtKB/TrEMBL;Acc:G5EBV3])

HSP 1 Score: 186.037 bits (471), Expect = 4.700e-57
Identity = 90/175 (51.43%), Postives = 118/175 (67.43%), Query Frame = 1
Query:  106 MSTSIRK-KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRK--DGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
            MS+  R+ K V+VGDG  GKTC+LI ++ D FP  YVPTVF+NY A + +D   V L LWDTAGQEDYDRLRPLSYP TDV ++CFS+ S  S +N+  KW PE++  C + P+ILVG K DLR++    +    + K  I K + G  MA +I A  Y+ECSA T+ G+ +VFE
Sbjct:    1 MSSPSRQIKCVVVGDGTVGKTCMLISYTTDSFPVQYVPTVFDNYSAQMSLDGNVVNLGLWDTAGQEDYDRLRPLSYPQTDVFILCFSVVSPVSFDNVASKWIPEIRQHCPDAPVILVGTKLDLRDEAEPMRALQAEGKSPISKTQ-GMKMAQKIKAVKYLECSALTQQGLTQVFE 174          
BLAST of Rho-related GTP-binding protein vs. Ensembl Celegans
Match: cdc-42 (Cell division control protein 42 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q05062])

HSP 1 Score: 181.415 bits (459), Expect = 2.795e-55
Identity = 85/166 (51.20%), Postives = 113/166 (68.07%), Query Frame = 1
Query:  127 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSS-RKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
            K V+VGDGA GKTCLLI ++ ++FP  YVPTVF+NY   + +  +   L L+DTAGQEDYDRLRPLSYP TDV L+CFS+ +  S EN+ EKW PE+ H C   P +LVG + DLR+D     K  KNK + V  + G+ +A  + A  Y+ECSA T+ G++ VF+
Sbjct:    5 KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVAPASFENVREKWVPEISHHCSKTPFLLVGTQVDLRDDPGMLEKLAKNKQKPVSTDVGEKLAKELKAVKYVECSALTQKGLKNVFD 170          
BLAST of Rho-related GTP-binding protein vs. Ensembl Celegans
Match: rac-2 (Ras-related protein rac-2 [Source:UniProtKB/Swiss-Prot;Acc:Q94124])

HSP 1 Score: 177.178 bits (448), Expect = 9.936e-54
Identity = 81/166 (48.80%), Postives = 114/166 (68.67%), Query Frame = 1
Query:  127 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRND-DSSRKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
            K V+VGDGA GKTCLL+ ++ + FP  Y+ TVF+ Y  ++ VD + + L+LWDTAGQ+DYD+ R LS+P TDV L+CF++++  S EN+  KW PEV H C N PIILVG K DLR D D+  +  + +++ V    G  MA  I A  Y+ECSA T+ G+++VF+
Sbjct:    5 KCVVVGDGAVGKTCLLLSYTTNAFPGEYILTVFDTYSTNVMVDGRPINLSLWDTAGQDDYDQFRHLSFPQTDVFLVCFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTIERLRERRLQPVSHTQGYVMAKEIKAVKYLECSALTQIGLKQVFD 170          
BLAST of Rho-related GTP-binding protein vs. Ensembl Fly
Match: Rho1 (gene:FBgn0014020 transcript:FBtr0087212)

HSP 1 Score: 299.671 bits (766), Expect = 1.783e-101
Identity = 144/172 (83.72%), Postives = 159/172 (92.44%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFET 624
            T+IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFS+DS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND ++ +D  K K E VK ++G+AMA++I A+AY+ECSAK+K+GVR+VFET
Sbjct:    2 TTIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFET 173          
BLAST of Rho-related GTP-binding protein vs. Ensembl Fly
Match: Rho1 (gene:FBgn0014020 transcript:FBtr0087213)

HSP 1 Score: 299.671 bits (766), Expect = 1.783e-101
Identity = 144/172 (83.72%), Postives = 159/172 (92.44%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFET 624
            T+IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFS+DS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND ++ +D  K K E VK ++G+AMA++I A+AY+ECSAK+K+GVR+VFET
Sbjct:    2 TTIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFET 173          
BLAST of Rho-related GTP-binding protein vs. Ensembl Fly
Match: Rho1 (gene:FBgn0014020 transcript:FBtr0087216)

HSP 1 Score: 299.671 bits (766), Expect = 1.783e-101
Identity = 144/172 (83.72%), Postives = 159/172 (92.44%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFET 624
            T+IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFS+DS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND ++ +D  K K E VK ++G+AMA++I A+AY+ECSAK+K+GVR+VFET
Sbjct:    2 TTIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFET 173          
BLAST of Rho-related GTP-binding protein vs. Ensembl Fly
Match: Rho1 (gene:FBgn0014020 transcript:FBtr0087214)

HSP 1 Score: 299.671 bits (766), Expect = 1.783e-101
Identity = 144/172 (83.72%), Postives = 159/172 (92.44%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFET 624
            T+IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFS+DS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND ++ +D  K K E VK ++G+AMA++I A+AY+ECSAK+K+GVR+VFET
Sbjct:    2 TTIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFET 173          
BLAST of Rho-related GTP-binding protein vs. Ensembl Fly
Match: Rho1 (gene:FBgn0014020 transcript:FBtr0087211)

HSP 1 Score: 299.671 bits (766), Expect = 1.783e-101
Identity = 144/172 (83.72%), Postives = 159/172 (92.44%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFET 624
            T+IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFS+DS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND ++ +D  K K E VK ++G+AMA++I A+AY+ECSAK+K+GVR+VFET
Sbjct:    2 TTIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFET 173          
BLAST of Rho-related GTP-binding protein vs. Ensembl Zebrafish
Match: rhoab (ras homolog gene family, member Ab [Source:NCBI gene;Acc:100006041])

HSP 1 Score: 305.064 bits (780), Expect = 1.968e-103
Identity = 148/171 (86.55%), Postives = 158/171 (92.40%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSK VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RIGA+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKAEEGRDMANRIGAFGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Zebrafish
Match: rhoab (ras homolog gene family, member Ab [Source:NCBI gene;Acc:100006041])

HSP 1 Score: 305.064 bits (780), Expect = 1.968e-103
Identity = 148/171 (86.55%), Postives = 158/171 (92.40%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSK VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RIGA+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKAEEGRDMANRIGAFGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Zebrafish
Match: rhoab (ras homolog gene family, member Ab [Source:NCBI gene;Acc:100006041])

HSP 1 Score: 305.064 bits (780), Expect = 1.968e-103
Identity = 148/171 (86.55%), Postives = 158/171 (92.40%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSK VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RIGA+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKAEEGRDMANRIGAFGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Zebrafish
Match: rhoac (ras homolog gene family, member Ac [Source:NCBI gene;Acc:406659])

HSP 1 Score: 303.138 bits (775), Expect = 1.353e-102
Identity = 147/171 (85.96%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSK VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RI A+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRINAFGYLECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Zebrafish
Match: rhoaa (ras homolog gene family, member Aa [Source:NCBI gene;Acc:406411])

HSP 1 Score: 301.597 bits (771), Expect = 5.886e-102
Identity = 146/171 (85.38%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSK VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RI A+ Y+ECSAKTK+GVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELQKMKQEPVKPEEGRDMANRINAFGYLECSAKTKEGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Xenopus
Match: plek (pleckstrin [Source:Xenbase;Acc:XB-GENE-484214])

HSP 1 Score: 304.679 bits (779), Expect = 4.702e-103
Identity = 148/171 (86.55%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSK VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RI AY Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKPEEGRDMANRISAYGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Xenopus
Match: plek (pleckstrin [Source:Xenbase;Acc:XB-GENE-484214])

HSP 1 Score: 304.294 bits (778), Expect = 7.313e-103
Identity = 148/171 (86.55%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSK VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RI AY Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKPEEGRDMANRISAYGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Xenopus
Match: plek (pleckstrin [Source:Xenbase;Acc:XB-GENE-484214])

HSP 1 Score: 303.138 bits (775), Expect = 1.301e-102
Identity = 148/171 (86.55%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSK VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RI AY Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKPEEGRDMANRISAYGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Xenopus
Match: cnn3 (calponin 3, acidic [Source:Xenbase;Acc:XB-GENE-951266])

HSP 1 Score: 302.753 bits (774), Expect = 2.853e-102
Identity = 146/171 (85.38%), Postives = 156/171 (91.23%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY+ADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK EDG+ MA+RI A+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKPEDGREMANRINAFGYLECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Xenopus
Match: nsd3 (nuclear receptor binding SET domain protein 3 [Source:Xenbase;Acc:XB-GENE-5992933])

HSP 1 Score: 300.442 bits (768), Expect = 2.360e-101
Identity = 144/171 (84.21%), Postives = 156/171 (91.23%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLI+FSKDQFPEVYVPTVFENYVADIEVDSK VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E V+ E+G+ MA+RI A+ Y+ECSAKT DGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIMFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVRAEEGRDMANRISAFGYLECSAKTNDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Mouse
Match: Rhoa (ras homolog family member A [Source:MGI Symbol;Acc:MGI:1096342])

HSP 1 Score: 303.523 bits (776), Expect = 9.342e-103
Identity = 147/171 (85.96%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RIGA+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Mouse
Match: Rhoc (ras homolog family member C [Source:MGI Symbol;Acc:MGI:106028])

HSP 1 Score: 296.59 bits (758), Expect = 4.637e-100
Identity = 142/171 (83.04%), Postives = 155/171 (90.64%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY+ADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLR D+ +R++  K K E V+ E+G+ MA+RI A+ Y+ECSAKTK+GVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Mouse
Match: Rhoc (ras homolog family member C [Source:MGI Symbol;Acc:MGI:106028])

HSP 1 Score: 296.59 bits (758), Expect = 4.637e-100
Identity = 142/171 (83.04%), Postives = 155/171 (90.64%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY+ADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLR D+ +R++  K K E V+ E+G+ MA+RI A+ Y+ECSAKTK+GVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Mouse
Match: Rhoc (ras homolog family member C [Source:MGI Symbol;Acc:MGI:106028])

HSP 1 Score: 296.59 bits (758), Expect = 4.637e-100
Identity = 142/171 (83.04%), Postives = 155/171 (90.64%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY+ADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLR D+ +R++  K K E V+ E+G+ MA+RI A+ Y+ECSAKTK+GVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Mouse
Match: Rhoa (ras homolog family member A [Source:MGI Symbol;Acc:MGI:1096342])

HSP 1 Score: 288.886 bits (738), Expect = 2.358e-97
Identity = 140/164 (85.37%), Postives = 150/164 (91.46%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKD 600
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RIGA+ Y+ECSAKTKD
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKD 165          
BLAST of Rho-related GTP-binding protein vs. UniProt/SwissProt
Match: sp|Q6DHM9|RHOAB_DANRE (Rho-related GTP-binding protein RhoA-B OS=Danio rerio OX=7955 GN=rhoab PE=1 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 1.485e-102
Identity = 148/171 (86.55%), Postives = 158/171 (92.40%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSK VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RIGA+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKAEEGRDMANRIGAFGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. UniProt/SwissProt
Match: sp|Q5REY6|RHOA_PONAB (Transforming protein RhoA OS=Pongo abelii OX=9601 GN=RHOA PE=2 SV=2)

HSP 1 Score: 303.523 bits (776), Expect = 5.924e-102
Identity = 147/171 (85.96%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RIGA+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. UniProt/SwissProt
Match: sp|P61586|RHOA_HUMAN (Transforming protein RhoA OS=Homo sapiens OX=9606 GN=RHOA PE=1 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 5.924e-102
Identity = 147/171 (85.96%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RIGA+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. UniProt/SwissProt
Match: sp|P61585|RHOA_BOVIN (Transforming protein RhoA OS=Bos taurus OX=9913 GN=RHOA PE=1 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 5.924e-102
Identity = 147/171 (85.96%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RIGA+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. UniProt/SwissProt
Match: sp|P61589|RHOA_RAT (Transforming protein RhoA OS=Rattus norvegicus OX=10116 GN=Rhoa PE=1 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 6.535e-102
Identity = 147/171 (85.96%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RIGA+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. TrEMBL
Match: A0A3P8P756 (Uncharacterized protein OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 1.393e-101
Identity = 149/171 (87.13%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD+K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFS+DS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRNDD +R++  K K E VK+EDGK MA+RI AY Y ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDAKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDDHTRRELAKMKQEPVKYEDGKEMANRISAYGYQECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. TrEMBL
Match: A0A3B4GB56 (Uncharacterized protein OS=Pundamilia nyererei OX=303518 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 1.393e-101
Identity = 149/171 (87.13%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD+K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFS+DS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRNDD +R++  K K E VK+EDGK MA+RI AY Y ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDAKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDDHTRRELAKMKQEPVKYEDGKEMANRISAYGYQECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. TrEMBL
Match: A0A3Q4N396 (Uncharacterized protein OS=Neolamprologus brichardi OX=32507 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 1.393e-101
Identity = 149/171 (87.13%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD+K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFS+DS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRNDD +R++  K K E VK+EDGK MA+RI AY Y ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDAKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDDHTRRELAKMKQEPVKYEDGKEMANRISAYGYQECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. TrEMBL
Match: G3P6B8 (Uncharacterized protein OS=Gasterosteus aculeatus OX=69293 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 1.471e-101
Identity = 150/171 (87.72%), Postives = 156/171 (91.23%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFS+DS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRNDD +R++  K K E VKFEDGK MA+RI AY Y ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDDHTRRELAKMKQEPVKFEDGKEMANRISAYGYQECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. TrEMBL
Match: A0A1I8IUD2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005898g1 PE=4 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 1.676e-101
Identity = 149/172 (86.63%), Postives = 159/172 (92.44%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFET 624
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCF+IDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R +  K + E+VK EDG+AMA+RIGA +YIECSAKTKDGVREVFET
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFAIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEKTRHELAKMRQELVKPEDGRAMAERIGASSYIECSAKTKDGVREVFET 173          
BLAST of Rho-related GTP-binding protein vs. Ensembl Cavefish
Match: rhoab (rho-related GTP-binding protein RhoA-B [Source:NCBI gene;Acc:103027457])

HSP 1 Score: 306.605 bits (784), Expect = 5.086e-104
Identity = 148/171 (86.55%), Postives = 158/171 (92.40%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSK VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RIGA+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKAEEGRDMANRIGAFGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Cavefish
Match: ENSAMXT00000034694.1 (transforming protein RhoA-like [Source:NCBI gene;Acc:103029431])

HSP 1 Score: 300.056 bits (767), Expect = 1.600e-101
Identity = 146/171 (85.38%), Postives = 156/171 (91.23%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RI A+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIYAFGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Cavefish
Match: rhoaa (rho-related GTP-binding protein RhoA-A [Source:NCBI gene;Acc:103028705])

HSP 1 Score: 300.056 bits (767), Expect = 1.823e-101
Identity = 146/171 (85.38%), Postives = 155/171 (90.64%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RI A  Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKAEEGRDMANRIYAAGYLECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Cavefish
Match: rhocb (rho-related GTP-binding protein RhoA-D [Source:NCBI gene;Acc:103031338])

HSP 1 Score: 300.056 bits (767), Expect = 1.850e-101
Identity = 144/171 (84.21%), Postives = 156/171 (91.23%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY+ADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RI A+ Y+ECSAKTK+GVREVFE
Sbjct:    4 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKEGVREVFE 174          
BLAST of Rho-related GTP-binding protein vs. Ensembl Cavefish
Match: rhocb (rho-related GTP-binding protein RhoA-D [Source:NCBI gene;Acc:103031338])

HSP 1 Score: 299.286 bits (765), Expect = 3.075e-101
Identity = 144/171 (84.21%), Postives = 156/171 (91.23%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY+ADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK E+G+ MA+RI A+ Y+ECSAKTK+GVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKEGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001838.1 (pep scaffold:Pmarinus_7.0:GL478831:173097:182385:-1 gene:ENSPMAG00000001664.1 transcript:ENSPMAT00000001838.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 303.523 bits (776), Expect = 1.625e-103
Identity = 147/171 (85.96%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+S+R++  K K E VK E+G+ MA+RI A+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDESTRRELAKMKQEPVKSEEGRDMANRINAFGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004439.1 (pep scaffold:Pmarinus_7.0:GL476335:1598569:1600956:1 gene:ENSPMAG00000004041.1 transcript:ENSPMAT00000004439.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 301.597 bits (771), Expect = 9.688e-103
Identity = 145/171 (84.80%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRNDD+++++  K K E V+ E+G+ MA+RI A+ Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDDNTKRELAKMKQEPVRVEEGRDMANRINAFGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002754.1 (pep scaffold:Pmarinus_7.0:GL476453:253767:255265:1 gene:ENSPMAG00000002511.1 transcript:ENSPMAT00000002754.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 274.633 bits (701), Expect = 3.878e-92
Identity = 130/171 (76.02%), Postives = 149/171 (87.13%), Query Frame = 1
Query:  115 SIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFET 624
            + RKKLV+VGDGACGKTCLL+VFSKD+FP+VYVPTVFE YVADIEVD + VELALWDTAGQEDYDRLRPLSYPDTDVILMCFS+DS DSLEN+PEKW PEV+HFC NVPI+LV NKKDLR D+S  ++  + K E +K EDG+ MA RI A+ Y+ECSA+TKDGVR VFET
Sbjct:    5 TTRKKLVVVGDGACGKTCLLMVFSKDKFPDVYVPTVFETYVADIEVDGRQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENVPEKWVPEVQHFCPNVPIVLVANKKDLRGDESVLQELARIKREPLKPEDGRTMASRIQAFDYVECSAQTKDGVRLVFET 175          
BLAST of Rho-related GTP-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006108.1 (pep scaffold:Pmarinus_7.0:GL480344:135:8553:-1 gene:ENSPMAG00000005525.1 transcript:ENSPMAT00000006108.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 250.366 bits (638), Expect = 1.813e-83
Identity = 118/129 (91.47%), Postives = 124/129 (96.12%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD 498
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+++R++
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDENTRRE 130          
BLAST of Rho-related GTP-binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008827.1 (pep scaffold:Pmarinus_7.0:GL480655:11470:16574:-1 gene:ENSPMAG00000007986.1 transcript:ENSPMAT00000008827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 248.825 bits (634), Expect = 4.035e-82
Identity = 128/176 (72.73%), Postives = 141/176 (80.11%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKS-----VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K      VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNK+DLR+DD++R++  K K   V  +    + + +  +  I  S+     VREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQSVVNQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKRDLRHDDATRRELAKMKQNEVNEKTLDVIQNDVSLFKRIRRSSTL---VREVFE 174          
BLAST of Rho-related GTP-binding protein vs. Ensembl Yeast
Match: RHO1 (GTP-binding protein of the rho subfamily of Ras-like proteins; involved in establishment of cell polarity; regulates protein kinase C (Pkc1p) and the cell wall synthesizing enzyme 1,3-beta-glucan synthase (Fks1p and Gsc2p) [Source:SGD;Acc:S000006369])

HSP 1 Score: 259.61 bits (662), Expect = 3.119e-86
Identity = 126/179 (70.39%), Postives = 145/179 (81.01%), Query Frame = 1
Query:  100 QNMSTSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSS----RKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFET 624
            Q +  SIR+KLVIVGDGACGKTCLLIVFSK QFPEVYVPTVFENYVAD+EVD + VELALWDTAGQEDYDRLRPLSYPD++V+L+CFSID  DSLEN+ EKW  EV HFCQ VPIILVG K DLRND  +    R++G+     V  ++G+++AD+IGA  Y ECSAKT  GVREVFE 
Sbjct:    3 QQVGNSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQP---VTSQEGQSVADQIGATGYYECSAKTGYGVREVFEA 178          
BLAST of Rho-related GTP-binding protein vs. Ensembl Yeast
Match: RHO3 (Non-essential small GTPase of the Rho/Rac family of Ras-like proteins; involved in the establishment of cell polarity; GTPase activity positively regulated by the GTPase activating protein (GAP) Rgd1p [Source:SGD;Acc:S000001380])

HSP 1 Score: 197.978 bits (502), Expect = 6.975e-62
Identity = 98/189 (51.85%), Postives = 123/189 (65.08%), Query Frame = 1
Query:  118 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRN---------------DDSSRKDGKNKV-------EIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVF 618
            I +K+VI+GDGACGKT LL VF++  FPEVY PTVFENY+ DI VDSK + L+LWDTAGQE++DRLR LSY DT  I++CFSIDS DSLEN+  KW  E+   C+ V ++LV  K DLRN               D+S   D  N +        ++ +E+G AMA +IGA  Y+ECSAK   GV E F
Sbjct:   15 IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFVDSKHITLSLWDTAGQEEFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHCEGVKLVLVALKCDLRNNENESNAITPNNIQQDNSVSNDNGNNINSTSNGKNLISYEEGLAMAKKIGALRYLECSAKLNKGVNEAF 203          
BLAST of Rho-related GTP-binding protein vs. Ensembl Yeast
Match: RHO2 (Non-essential small GTPase of the Rho/Rac family of Ras-like proteins; involved in the establishment of cell polarity and in microtubule assembly [Source:SGD;Acc:S000005034])

HSP 1 Score: 186.037 bits (471), Expect = 8.354e-58
Identity = 91/169 (53.85%), Postives = 118/169 (69.82%), Query Frame = 1
Query:  115 SIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
            ++R+KLVI+GDGACGKT LL VF+  +FPE Y PTVFENYV D  VD   V L LWDTAGQE+Y+RLRP SY   D+IL+ F++D+ +SL N   KW  E   +C + PI+LVG KKDLR +   +++  +  E+V  ED K +A  IGA  Y+ECSA T +GV +VFE
Sbjct:    5 AVRRKLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDCRVDGIKVSLTLWDTAGQEEYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYCPDAPIVLVGLKKDLRQEAHFKENATD--EMVPIEDAKQVARAIGAKKYMECSALTGEGVDDVFE 171          
BLAST of Rho-related GTP-binding protein vs. Ensembl Yeast
Match: RHO4 (Non-essential small GTPase; member of the Rho/Rac subfamily of Ras-like proteins; likely to be involved in the establishment of cell polarity; has long N-terminal extension that plays an important role in Rho4p function and is shared with Rho4 homologs in other yeasts and filamentous fungi [Source:SGD;Acc:S000001763])

HSP 1 Score: 187.193 bits (474), Expect = 5.061e-57
Identity = 87/167 (52.10%), Postives = 122/167 (73.05%), Query Frame = 1
Query:  127 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIE-VDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFET 624
            K+V+VGDGA GKTCLLI + +  FP  Y+PT+FENYV +IE  + + +ELALWDTAGQE+Y RLRPLSY + DV+++C+S+ S  SL+N+ + W PEVKHFC + PI+LVG K DL   D       N  ++V+    +++A R+GA+A+I+CSA+ K+ + EVFET
Sbjct:   74 KIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEGPNGQIIELALWDTAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTPIMLVGLKSDLYEAD-------NLSDLVEPSSAESLAKRLGAFAHIQCSARLKENIDEVFET 233          
BLAST of Rho-related GTP-binding protein vs. Ensembl Yeast
Match: CDC42 (Small rho-like GTPase; essential for establishment and maintenance of cell polarity; plays a role late in cell fusion via activation of key cell fusion regulator Fus2p; mutants have defects in the organization of actin and septins; human homolog CDC42 can complement yeast cdc42 mutant [Source:SGD;Acc:S000004219])

HSP 1 Score: 179.104 bits (453), Expect = 3.711e-55
Identity = 85/166 (51.20%), Postives = 112/166 (67.47%), Query Frame = 1
Query:  127 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDS-SRKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
            K V+VGDGA GKTCLLI ++ +QFP  YVPTVF+NY   + +  +   L L+DTAGQEDYDRLRPLSYP TDV L+CFS+ S  S EN+ EKW PEV H C  VP ++VG + DLR+D     K  + ++  +  E G  +A  + A  Y+ECSA T+ G++ VF+
Sbjct:    5 KCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFD 170          
BLAST of Rho-related GTP-binding protein vs. Ensembl Nematostella
Match: EDO39465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9Y5])

HSP 1 Score: 305.834 bits (782), Expect = 3.374e-104
Identity = 148/172 (86.05%), Postives = 159/172 (92.44%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFET 624
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLR D++++++  K K E VK E+G+AMAD+I AYAY+ECSAKTKDGVREVFET
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRMDENTKRELQKMKQEPVKIEEGRAMADKISAYAYLECSAKTKDGVREVFET 173          
BLAST of Rho-related GTP-binding protein vs. Ensembl Nematostella
Match: EDO38536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCK6])

HSP 1 Score: 195.667 bits (496), Expect = 4.667e-61
Identity = 93/166 (56.02%), Postives = 118/166 (71.08%), Query Frame = 1
Query:  127 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRND-DSSRKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
            K V+VGDGA GKTCLLI ++ + FP  Y+PTVF+NY A++ VD K + L LWDTAGQEDYDRLRPLSYP TDV L+CFS+ S  S EN+  KW PEV H C N PI+LVG K DLR+D ++  K  + K+  + +  G  MA  IGA  Y+ECSA T+ G++ VF+
Sbjct:    5 KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLISPASYENVRAKWYPEVSHHCPNTPIVLVGTKLDLRDDKETIDKLKEKKLGPIGYTQGLQMAKEIGAVKYLECSALTQKGLKTVFD 170          
BLAST of Rho-related GTP-binding protein vs. Ensembl Nematostella
Match: EDO35019 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMN7])

HSP 1 Score: 189.119 bits (479), Expect = 1.371e-58
Identity = 90/166 (54.22%), Postives = 113/166 (68.07%), Query Frame = 1
Query:  127 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRND-DSSRKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
            K V+VGDGA GKTC+LI ++ + FP  Y+PTVF+NY A++ VD + + L LWDTAGQEDYDRLRPLSYP TDV L+CFS+ S  S EN+  KW PEV H C   PIILVG K DLR D +   K  + K+  +    G  MA  I A  Y+ECSA T+ G++ VF+
Sbjct:    5 KCVVVGDGAVGKTCMLISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSVISPASFENVRAKWYPEVSHHCPGTPIILVGTKTDLREDKEMIEKLKEKKLNPLSTSHGLQMAKEIKAAKYLECSALTQKGLKTVFD 170          
BLAST of Rho-related GTP-binding protein vs. Ensembl Nematostella
Match: EDO37472 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFJ1])

HSP 1 Score: 183.726 bits (465), Expect = 1.844e-56
Identity = 85/166 (51.20%), Postives = 113/166 (68.07%), Query Frame = 1
Query:  127 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSS-RKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
            K V+VGDGA GKTCLLI ++ ++FP  YVPTVF+NY   + +  +   L L+DTAGQEDYDRLRPLSYP TDV L+CFS+ S  S EN+ EKW PE+ H C   P +LVG + DLR+D  +  K  KNK + +  E  + +A  + A  Y+ECSA T+ G++ VF+
Sbjct:    5 KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQVDLRDDQGTIEKLSKNKQKPIAVEAAEKLARELRAVKYVECSALTQKGLKNVFD 170          
BLAST of Rho-related GTP-binding protein vs. Ensembl Nematostella
Match: EDO42207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S215])

HSP 1 Score: 150.214 bits (378), Expect = 2.780e-43
Identity = 77/168 (45.83%), Postives = 110/168 (65.48%), Query Frame = 1
Query:  127 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKDGKNKV--EIVKFEDGKAMADRIGAYAYIECSAKTKD-GVREVFE 621
            K+++VGD  CGKT LL  + ++QF E Y  TVF +    +EVD + +EL LWDT+G EDYD +RPLSY + D++L+CF I    + ++I EKW  EV   C N P++LVG K+DLR++ +      +KV  + V   +G+ +ADRI A  YIECS+KT D  + +VFE
Sbjct:   13 KVILVGDSECGKTALLNAYVRNQFNEKYEATVFNSLSTAVEVDGERIELTLWDTSGHEDYDHVRPLSYNNVDIVLICFDISRPKTADSILEKWIIEVCDLCPNKPVLLVGCKQDLRSEVNIVSKLASKVCQQPVTSLEGRKLADRICALDYIECSSKTMDFQLEKVFE 180          
BLAST of Rho-related GTP-binding protein vs. Ensembl Medaka
Match: ENSORLT00000033500.1 (transforming protein RhoA-like [Source:NCBI gene;Acc:101158607])

HSP 1 Score: 305.064 bits (780), Expect = 1.712e-103
Identity = 146/171 (85.38%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
            ++IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD + VELALWDTAGQEDYDRLRPLSYPDTDVILMCFS+DS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLR+D+ +R++  K K E VKFEDG+ MA+RI AY Y ECSAKTKDGVREVFE
Sbjct:    2 SAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGRQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRHDEHARRELAKMKQEPVKFEDGREMANRISAYGYQECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Medaka
Match: ENSORLT00000023517.2 (transforming protein RhoA [Source:NCBI gene;Acc:101173444])

HSP 1 Score: 303.523 bits (776), Expect = 8.041e-103
Identity = 148/171 (86.55%), Postives = 156/171 (91.23%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK EDG+ MA+RIGA  Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEDGRDMANRIGASGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Medaka
Match: ENSORLT00000024724.2 (transforming protein RhoA [Source:NCBI gene;Acc:101173444])

HSP 1 Score: 302.753 bits (774), Expect = 1.391e-102
Identity = 148/171 (86.55%), Postives = 156/171 (91.23%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRND+ +R++  K K E VK EDG+ MA+RIGA  Y+ECSAKTKDGVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEDGRDMANRIGASGYMECSAKTKDGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Medaka
Match: rhocb (rho-related GTP-binding protein RhoA-C [Source:NCBI gene;Acc:101155194])

HSP 1 Score: 301.982 bits (772), Expect = 2.579e-102
Identity = 144/171 (84.21%), Postives = 157/171 (91.81%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             ++RKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY+ADIEVD + VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRNDD +R++ GK K E V+FE+G+ MA RI A+ Y+ECSAKTKDGVR+VFE
Sbjct:    2 AALRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGRQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDDHTRRELGKMKQEPVRFEEGRDMASRIDAFGYLECSAKTKDGVRDVFE 172          
BLAST of Rho-related GTP-binding protein vs. Ensembl Medaka
Match: ENSORLT00000033387.1 (rho-related GTP-binding protein RhoA-B [Source:NCBI gene;Acc:101167618])

HSP 1 Score: 301.212 bits (770), Expect = 5.774e-102
Identity = 146/171 (85.38%), Postives = 155/171 (90.64%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
             +IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS DSLENIPEKWTPEVKHFC NVPIILVGNKKDLRNDD +R++  K K E VK E+G+ MA RI A+ Y+ECSAKTK+GVREVFE
Sbjct:    2 AAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDDHTRRELAKMKQEPVKSEEGRDMAGRIAAFGYMECSAKTKEGVREVFE 172          
BLAST of Rho-related GTP-binding protein vs. Planmine SMEST
Match: SMESG000022390.1 (SMESG000022390.1)

HSP 1 Score: 357.066 bits (915), Expect = 4.733e-124
Identity = 173/173 (100.00%), Postives = 173/173 (100.00%), Query Frame = 1
Query:  106 MSTSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFET 624
            MSTSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFET
Sbjct:    1 MSTSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFET 173          
BLAST of Rho-related GTP-binding protein vs. Planmine SMEST
Match: SMESG000001635.1 (SMESG000001635.1)

HSP 1 Score: 297.745 bits (761), Expect = 9.997e-101
Identity = 144/172 (83.72%), Postives = 156/172 (90.70%), Query Frame = 1
Query:  112 TSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKD-GKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFET 624
            ++IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD+K VELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDS+DSLENI EKW PEVKHFC NVPIILVGNKKDLRND+ +R +  K + E+VK+EDG   AD+I A  Y+ECSAKTKDGVREVFET
Sbjct:    2 SAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDNKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSTDSLENIVEKWYPEVKHFCPNVPIILVGNKKDLRNDERARHELAKMRQELVKYEDGLLTADKINAVKYLECSAKTKDGVREVFET 173          
BLAST of Rho-related GTP-binding protein vs. Planmine SMEST
Match: SMESG000024961.1 (SMESG000024961.1)

HSP 1 Score: 197.978 bits (502), Expect = 9.113e-62
Identity = 92/166 (55.42%), Postives = 119/166 (71.69%), Query Frame = 1
Query:  127 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKDGKNKVEI-VKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
            K V+VGDGA GKTCLLI ++ + FP  Y+PTVF+NY A++ VD+K V L LWDTAGQEDYDRLRPLSYP TDV L+CFS+ +S S EN+  KW PE+ H C N PIILVG K DLR +  + + GK++    + +  G  +A  IGA  Y+ECSA T+ G++ VF+
Sbjct:    5 KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDNKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLINSSSYENVRAKWYPEITHHCPNTPIILVGTKLDLRENHMNGEAGKDRRNTPISYPQGLVLAKEIGAVKYLECSALTQKGLKSVFD 170          
BLAST of Rho-related GTP-binding protein vs. Planmine SMEST
Match: SMESG000068769.1 (SMESG000068769.1)

HSP 1 Score: 191.815 bits (486), Expect = 1.540e-59
Identity = 89/167 (53.29%), Postives = 116/167 (69.46%), Query Frame = 1
Query:  118 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVF 618
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ ++K + L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +      N  + V   +GK +A +I A  + ECSAK    V+E+F
Sbjct:    2 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTN------NSDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIF 162          
BLAST of Rho-related GTP-binding protein vs. Planmine SMEST
Match: SMESG000005010.1 (SMESG000005010.1)

HSP 1 Score: 192.2 bits (487), Expect = 1.801e-59
Identity = 88/167 (52.69%), Postives = 119/167 (71.26%), Query Frame = 1
Query:  127 KLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKDGKNKVEI--VKFEDGKAMADRIGAYAYIECSAKTKDGVREVFE 621
            K V+VGDGA GKTC+LI ++ D FP  +VPTVF+N  A++ ++   + L LWDTAGQE+YDRLRPLSYP+TDV L+CFS+ + DS  N+ EKW  EV HF +  PIILVG K DLR + +  ++ KN++    V ++ G A+   IGA  YIECSA+T+  +R+VFE
Sbjct:    5 KCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFE 171          
The following BLAST results are available for this feature:
BLAST of Rho-related GTP-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RHOA1.234e-10285.96ras homolog family member A [Source:HGNC Symbol;Ac... [more]
RHOC2.511e-10083.04ras homolog family member C [Source:HGNC Symbol;Ac... [more]
RHOC6.754e-10083.04ras homolog family member C [Source:HGNC Symbol;Ac... [more]
RHOC6.754e-10083.04ras homolog family member C [Source:HGNC Symbol;Ac... [more]
RHOC6.754e-10083.04ras homolog family member C [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Rho-related GTP-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rho-17.560e-10083.04Ras-like GTP-binding protein rhoA [Source:UniProt... [more]
ced-101.009e-6054.22Ras-related protein ced-10 [Source:UniProtKB/Swis... [more]
mig-24.700e-5751.43Rac-like GTPase [Source:UniProtKB/TrEMBL;Acc:G5EB... [more]
cdc-422.795e-5551.20Cell division control protein 42 homolog [Source:... [more]
rac-29.936e-5448.80Ras-related protein rac-2 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Rho-related GTP-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rho11.783e-10183.72gene:FBgn0014020 transcript:FBtr0087212[more]
Rho11.783e-10183.72gene:FBgn0014020 transcript:FBtr0087213[more]
Rho11.783e-10183.72gene:FBgn0014020 transcript:FBtr0087216[more]
Rho11.783e-10183.72gene:FBgn0014020 transcript:FBtr0087214[more]
Rho11.783e-10183.72gene:FBgn0014020 transcript:FBtr0087211[more]
back to top
BLAST of Rho-related GTP-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhoab1.968e-10386.55ras homolog gene family, member Ab [Source:NCBI ge... [more]
rhoab1.968e-10386.55ras homolog gene family, member Ab [Source:NCBI ge... [more]
rhoab1.968e-10386.55ras homolog gene family, member Ab [Source:NCBI ge... [more]
rhoac1.353e-10285.96ras homolog gene family, member Ac [Source:NCBI ge... [more]
rhoaa5.886e-10285.38ras homolog gene family, member Aa [Source:NCBI ge... [more]
back to top
BLAST of Rho-related GTP-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plek4.702e-10386.55pleckstrin [Source:Xenbase;Acc:XB-GENE-484214][more]
plek7.313e-10386.55pleckstrin [Source:Xenbase;Acc:XB-GENE-484214][more]
plek1.301e-10286.55pleckstrin [Source:Xenbase;Acc:XB-GENE-484214][more]
cnn32.853e-10285.38calponin 3, acidic [Source:Xenbase;Acc:XB-GENE-951... [more]
nsd32.360e-10184.21nuclear receptor binding SET domain protein 3 [Sou... [more]
back to top
BLAST of Rho-related GTP-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rhoa9.342e-10385.96ras homolog family member A [Source:MGI Symbol;Acc... [more]
Rhoc4.637e-10083.04ras homolog family member C [Source:MGI Symbol;Acc... [more]
Rhoc4.637e-10083.04ras homolog family member C [Source:MGI Symbol;Acc... [more]
Rhoc4.637e-10083.04ras homolog family member C [Source:MGI Symbol;Acc... [more]
Rhoa2.358e-9785.37ras homolog family member A [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Rho-related GTP-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DHM9|RHOAB_DANRE1.485e-10286.55Rho-related GTP-binding protein RhoA-B OS=Danio re... [more]
sp|Q5REY6|RHOA_PONAB5.924e-10285.96Transforming protein RhoA OS=Pongo abelii OX=9601 ... [more]
sp|P61586|RHOA_HUMAN5.924e-10285.96Transforming protein RhoA OS=Homo sapiens OX=9606 ... [more]
sp|P61585|RHOA_BOVIN5.924e-10285.96Transforming protein RhoA OS=Bos taurus OX=9913 GN... [more]
sp|P61589|RHOA_RAT6.535e-10285.96Transforming protein RhoA OS=Rattus norvegicus OX=... [more]
back to top
BLAST of Rho-related GTP-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P8P7561.393e-10187.13Uncharacterized protein OS=Astatotilapia callipter... [more]
A0A3B4GB561.393e-10187.13Uncharacterized protein OS=Pundamilia nyererei OX=... [more]
A0A3Q4N3961.393e-10187.13Uncharacterized protein OS=Neolamprologus brichard... [more]
G3P6B81.471e-10187.72Uncharacterized protein OS=Gasterosteus aculeatus ... [more]
A0A1I8IUD21.676e-10186.63Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Rho-related GTP-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhoab5.086e-10486.55rho-related GTP-binding protein RhoA-B [Source:NCB... [more]
ENSAMXT00000034694.11.600e-10185.38transforming protein RhoA-like [Source:NCBI gene;A... [more]
rhoaa1.823e-10185.38rho-related GTP-binding protein RhoA-A [Source:NCB... [more]
rhocb1.850e-10184.21rho-related GTP-binding protein RhoA-D [Source:NCB... [more]
rhocb3.075e-10184.21rho-related GTP-binding protein RhoA-D [Source:NCB... [more]
back to top
BLAST of Rho-related GTP-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001838.11.625e-10385.96pep scaffold:Pmarinus_7.0:GL478831:173097:182385:-... [more]
ENSPMAT00000004439.19.688e-10384.80pep scaffold:Pmarinus_7.0:GL476335:1598569:1600956... [more]
ENSPMAT00000002754.13.878e-9276.02pep scaffold:Pmarinus_7.0:GL476453:253767:255265:1... [more]
ENSPMAT00000006108.11.813e-8391.47pep scaffold:Pmarinus_7.0:GL480344:135:8553:-1 gen... [more]
ENSPMAT00000008827.14.035e-8272.73pep scaffold:Pmarinus_7.0:GL480655:11470:16574:-1 ... [more]
back to top
BLAST of Rho-related GTP-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RHO13.119e-8670.39GTP-binding protein of the rho subfamily of Ras-li... [more]
RHO36.975e-6251.85Non-essential small GTPase of the Rho/Rac family o... [more]
RHO28.354e-5853.85Non-essential small GTPase of the Rho/Rac family o... [more]
RHO45.061e-5752.10Non-essential small GTPase; member of the Rho/Rac ... [more]
CDC423.711e-5551.20Small rho-like GTPase; essential for establishment... [more]
back to top
BLAST of Rho-related GTP-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO394653.374e-10486.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385364.667e-6156.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350191.371e-5854.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374721.844e-5651.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422072.780e-4345.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rho-related GTP-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033500.11.712e-10385.38transforming protein RhoA-like [Source:NCBI gene;A... [more]
ENSORLT00000023517.28.041e-10386.55transforming protein RhoA [Source:NCBI gene;Acc:10... [more]
ENSORLT00000024724.21.391e-10286.55transforming protein RhoA [Source:NCBI gene;Acc:10... [more]
rhocb2.579e-10284.21rho-related GTP-binding protein RhoA-C [Source:NCB... [more]
ENSORLT00000033387.15.774e-10285.38rho-related GTP-binding protein RhoA-B [Source:NCB... [more]
back to top
BLAST of Rho-related GTP-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022390.14.733e-124100.00SMESG000022390.1[more]
SMESG000001635.19.997e-10183.72SMESG000001635.1[more]
SMESG000024961.19.113e-6255.42SMESG000024961.1[more]
SMESG000068769.11.540e-5953.29SMESG000068769.1[more]
SMESG000005010.11.801e-5952.69SMESG000005010.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026534 ID=SMED30026534|Name=Rho-related GTP-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1215bp
AAAATATATCTTTATTGAACATAAATATTTACTATCAACAATTTCACTTA
TTTATAGTATCTTTTTACATATTAAAGGAAGTTATCTTAAAAAGTTTTTC
AAAACATGTCAACATCTATTAGAAAGAAACTTGTAATTGTTGGTGACGGT
GCATGTGGTAAAACATGCCTTTTAATTGTATTCAGCAAAGATCAGTTTCC
TGAAGTTTATGTTCCTACAGTGTTTGAAAATTACGTAGCTGATATTGAAG
TGGATTCAAAATCTGTTGAATTAGCTTTGTGGGATACAGCTGGACAGGAA
GATTATGACAGATTAAGACCGTTATCATATCCAGATACTGATGTTATATT
AATGTGCTTTAGCATCGATTCCTCAGACAGTCTTGAAAACATTCCAGAGA
AGTGGACACCGGAAGTTAAACATTTTTGTCAAAACGTTCCTATTATTCTG
GTTGGTAATAAAAAGGATCTTCGTAATGATGACAGTAGTCGCAAAGACGG
CAAAAACAAAGTCGAAATTGTAAAATTTGAAGACGGAAAAGCAATGGCAG
ACCGAATCGGTGCCTATGCTTACATTGAATGTTCTGCGAAAACAAAGGAC
GGAGTTCGAGAAGTTTTCGAGACTGCAACTAAAGCAGCTCTACAATCTAA
GAAAAAGAAGAAAAATATTAAATGTGATTTATTATAAAAGAATGATTTAA
TGAAGTTCTGACATTTAATAAATTAAAGTATTCGAATTTATCTAAGTCGA
AGCTATGTGAGTTTAAATTTGAATCATTCCTGGTTTCTTTTTTACTTTTA
TATTGAATAAATTCTGATGTTATTGCTTAATAAAATTTGAATCACTAATT
TGCATGTCATTTAAAATTTCCTAGCATAATTTGGTCTTTATTCATTCCAA
TGTCTATTCTGTGTTTTCTAGACAATATTGAATATTTGTAACATCGATTT
CGAAATGTTGAATTTTTTTGATAATTTAAATTATTTGTTAAGTATTTTTG
ATTTATTATTAGTAATTAGTTTAGGAATTCGATTATAGTATTAATCATGC
TAATTGATTGGTTTTTGCGAACAATTATTATCTCTCAATTGATTAATACA
ACACTATTGAGATAATTGATTTGCATGCATTTTCTAGTAATCGGAATTTG
ATCAAATGTTAATATTATCACAATAGATATTTCAATTACGATTCTATTTT
GTTATTCAAGCGAGG
back to top

protein sequence of SMED30026534-orf-1

>SMED30026534-orf-1 ID=SMED30026534-orf-1|Name=SMED30026534-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=194bp
MSTSIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVD
SKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKW
TPEVKHFCQNVPIILVGNKKDLRNDDSSRKDGKNKVEIVKFEDGKAMADR
IGAYAYIECSAKTKDGVREVFETATKAALQSKKKKKNIKCDLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR003578Small_GTPase_Rho
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0007266Rho protein signal transduction
GO:0016055Wnt signaling pathway
GO:0032956regulation of actin cytoskeleton organization
GO:0035023regulation of Rho protein signal transduction
GO:0036342post-anal tail morphogenesis
GO:0040001establishment of mitotic spindle localization
GO:0042074cell migration involved in gastrulation
GO:0043066negative regulation of apoptotic process
GO:0044319wound healing, spreading of cells
GO:0048840otolith development
GO:1902766skeletal muscle satellite cell migration
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005886plasma membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 156..178
score: 36.44
coord: 7..28
score: 47.14
coord: 30..46
score: 28.5
coord: 47..69
score: 47.33
coord: 109..122
score: 58.47
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 8..181
e-value: 4.9E-24
score: 95.9
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 12..193
e-value: 0.0076
score: -7.4
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 8..181
e-value: 1.8E-20
score: 84.0
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 9..181
e-value: 2.7E-118
score: 409.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 3..193
e-value: 1.1E-67
score: 229.1
NoneNo IPR availablePANTHERPTHR24072RHO FAMILY GTPASEcoord: 4..193
NoneNo IPR availablePANTHERPTHR24072:SF100RHO-RELATED GTP-BINDING PROTEIN RHOCcoord: 4..193
NoneNo IPR availableCDDcd01870RhoA_likecoord: 6..179
e-value: 5.13959E-126
score: 350.19
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 6..171
e-value: 1.0E-40
score: 137.2
IPR001806Small GTPasePFAMPF00071Rascoord: 8..179
e-value: 5.3E-58
score: 195.2
IPR003578Small GTPase RhoPROSITEPS51420RHOcoord: 1..178
score: 26.727
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 7..179