cytochrome c oxidase subunit II

Overview
Namecytochrome c oxidase subunit II (YP_008592434.1)
Smed IDSMED30026531
Length (bp)879
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cytochrome c oxidase subunit II (SMED30026531) t-SNE clustered cells

Violin plots show distribution of expression levels for cytochrome c oxidase subunit II (SMED30026531) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cytochrome c oxidase subunit II (SMED30026531) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cytochrome c oxidase subunit II (SMED30026531) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026531

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30026531SMESG000029046.1 Contig39635newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026531SMESG000029046.1 Contig39635uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30026531 dd_Smed_v4_297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30026531 dd_Smed_v4_297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30026531 dd_Smed_v4_297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026531 dd_Smed_v4_297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026531 dd_Smed_v4_297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026531 dd_Smed_v4_297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026531 dd_Smed_v4_297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30026531 dd_Smed_v4_297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026531 dd_Smed_v4_297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30026531 dd_Smed_v4_297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30026531 dd_Smed_v4_297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30026531 dd_Smed_v6_297_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cytochrome c oxidase subunit II vs. Ensembl Human
Match: MT-CO2 (mitochondrially encoded cytochrome c oxidase II [Source:HGNC Symbol;Acc:HGNC:7421])

HSP 1 Score: 115.931 bits (289), Expect = 1.301e-30
Identity = 66/194 (34.02%), Postives = 105/194 (54.12%), Query Frame = 1
Query:  157 ENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDSAGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECV 738
            +  +ME+V T +P I++ ++++PS   LY + ++   P  T+K +GHQW+       + Y YT++      G+I                  NS+     F      +     R ++VD  ++L      R +I++ DV H +A+P +GLK DAIPGR+NQ  F + R G + GQCSE+CGANH+FMPIV+E +
Sbjct:   57 DAQEMETVWTILPAIILVLIALPSLRILYMTDEVND-PSLTIKSIGHQWY-------WTYEYTDY-----GGLIF-----------------NSYMLPPLF------LEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELI 214          
BLAST of cytochrome c oxidase subunit II vs. Ensembl Celegans
Match: ctc-2 (Cytochrome c oxidase subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:P24894])

HSP 1 Score: 78.5666 bits (192), Expect = 5.678e-17
Identity = 59/194 (30.41%), Postives = 90/194 (46.39%), Query Frame = 1
Query:  193 PGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDSAGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYVDGK 774
            P I++ +  +PS   LY    +      TVKV GHQW+       + Y Y++         I GL+              +S+  MK+ D  S   P    R + VD   ++      RF I++ DV H +A+  + +K+DA+ G ++   +     G F GQCSE+CGANH+FMPI +E      FK +  G 
Sbjct:   71 PTIILLMQMVPSLSLLYYYGLMNLDSNLTVKVTGHQWY-------WSYEYSD---------IPGLE-------------FDSY--MKSLDQLSLGEP----RLLEVDNRCVIPCDTNIRFCITSADVIHAWALNSLSVKLDAMSGILSTFSYSFPMVGVFYGQCSEICGANHSFMPIALEVTLLDNFKSWCFGT 229          
BLAST of cytochrome c oxidase subunit II vs. Ensembl Fly
Match: mt:CoII (gene:FBgn0013675 transcript:FBtr0100863)

HSP 1 Score: 98.2117 bits (243), Expect = 3.218e-24
Identity = 63/210 (30.00%), Postives = 103/210 (49.05%), Query Frame = 1
Query:  145 RDLLENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDSAGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYVDGK 774
            R LL    +E + T +P I++  +++PS   LY   +I   P  T+K +GHQW+       + Y Y++                             ++ E  ++   ++ +     R ++VD  ++L      R L++A DV H + +P +G+K+D  PGR+NQ  F+  R G F GQCSE+CGANH+FMPIV+E V    F  ++   
Sbjct:   53 RFLLHGQLIEMIWTILPAIILLFIALPSLRLLYLLDEINE-PSVTLKSIGHQWY-------WSYEYSDF----------------------------NNIEFDSYMIPTNELMTDGFRLLDVDNRVVLPMNSQIRILVTAADVIHSWTVPALGVKVDGTPGRLNQTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNYFIKWISSN 226          
BLAST of cytochrome c oxidase subunit II vs. Ensembl Zebrafish
Match: mt-co2 (cytochrome c oxidase subunit II [Source:NCBI gene;Acc:140540])

HSP 1 Score: 117.087 bits (292), Expect = 3.833e-31
Identity = 71/213 (33.33%), Postives = 110/213 (51.64%), Query Frame = 1
Query:  139 TYRDLLENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPD---SAG--RNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGY 762
            T + +L++ ++E V T +P I++ ++++PS   LY   +I   P  T+K VGHQW+       + Y YT++                                 +  +F S+ VP    + G  R +  D  +++      R L+SA DV H +A+P +G+K+DA+PGR+NQ  F   R G F GQCSE+CGANH+FMPIVVE V    F+ +
Sbjct:   51 TNKFILDSQEIEIVWTVLPAIILILIALPSLRILYLMDEIND-PHVTIKAVGHQWY-------WSYEYTDY---------------------------------ENLEFDSYMVPTQDLTPGGFRLLETDHRMVVPKESPIRILVSAEDVLHSWAVPSLGIKMDAVPGRLNQTAFIVSRPGVFYGQCSEICGANHSFMPIVVEAVPLEFFENW 222          
BLAST of cytochrome c oxidase subunit II vs. Ensembl Xenopus
Match: dap3 (death associated protein 3 [Source:Xenbase;Acc:XB-GENE-997724])

HSP 1 Score: 118.627 bits (296), Expect = 1.338e-31
Identity = 70/213 (32.86%), Postives = 106/213 (49.77%), Query Frame = 1
Query:  139 TYRDLLENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDS-----AGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGY 762
            T  + ++  ++E V T +P I++ ++++PS   LY   ++   P  TVK +GHQW+       + Y YTN+                                 +   F S+ +P S       R + VD  +++      R L++A DV H +A+P  G+K DAIPGR+NQ  F + R G F GQCSE+CGANH+FMPIVVE V    F+ +
Sbjct:   51 TNTNSMDAQEIEMVWTIMPAIILIMIALPSLRILYLMDEVND-PHLTVKTIGHQWY-------WSYEYTNY---------------------------------EDLSFDSYMIPTSDLTPGQFRLLEVDNRMVVPMESPIRLLVTAEDVLHSWALPSFGVKTDAIPGRLNQTSFIATRPGVFYGQCSEICGANHSFMPIVVEAVPLNDFENW 222          
BLAST of cytochrome c oxidase subunit II vs. Ensembl Mouse
Match: mt-Co2 (mitochondrially encoded cytochrome c oxidase II [Source:MGI Symbol;Acc:MGI:102503])

HSP 1 Score: 116.701 bits (291), Expect = 5.858e-31
Identity = 70/213 (32.86%), Postives = 111/213 (52.11%), Query Frame = 1
Query:  139 TYRDLLENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDS-----AGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGY 762
            T+   ++  ++E++ T +P +++ ++++PS   LY   +I   P  TVK +GHQW+       + Y YT++            +D+               C      F S+ +P +       R + VD  ++L   +  R LIS+ DV H +A+P +GLK DAIPGR+NQ    S R G F GQCSE+CG+NH+FMPIV+E V    F+ +
Sbjct:   51 THTSTMDAQEVETIWTILPAVILIMIALPSLRILYMMDEINN-PVLTVKTMGHQWY-------WSYEYTDY------------EDL---------------C------FDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENW 222          
BLAST of cytochrome c oxidase subunit II vs. UniProt/SwissProt
Match: sp|P12701|COX2_PARLI (Cytochrome c oxidase subunit 2 OS=Paracentrotus lividus OX=7656 GN=COII PE=3 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.228e-33
Identity = 73/214 (34.11%), Postives = 111/214 (51.87%), Query Frame = 1
Query:  139 TYRDLLENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDS-----AGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYV 765
            T R  LE  ++E++ T VP  ++  +++PS   LY   ++   P  T+K +GHQW+       + Y YT++                                    +F S+ VP S       R + VD  LIL  +   R L+S+ DV H +A+P +G+K+DA+PGR+NQ  F++ RAG F GQCSE+CGANH+FMPI++E V    F+ +V
Sbjct:   51 TNRFFLEGQELETIWTVVPAFILIFIALPSLQLLYLMDEVNN-PFLTIKAIGHQWY-------WSYEYTDY---------------------------------NDLEFDSYMVPTSDVSLGNPRLLEVDNRLILPMQNPIRVLVSSADVLHSWAVPSLGVKMDAVPGRLNQTTFFAARAGLFYGQCSEICGANHSFMPILIESVPFSNFENWV 223          
BLAST of cytochrome c oxidase subunit II vs. UniProt/SwissProt
Match: sp|O79673|COX2_PELSU (Cytochrome c oxidase subunit 2 OS=Pelomedusa subrufa OX=44522 GN=MT-CO2 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.525e-33
Identity = 69/209 (33.01%), Postives = 104/209 (49.76%), Query Frame = 1
Query:  139 TYRDLLENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDSAGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYV 765
            T+ +     + E V T +P I++  +++PS   LY   +I   P  T+K +GHQW+       + Y YT++                               E  ++   +  +P    R + VD  ++     Y R LISA DV H +AIP +GLK DA+PGR+NQ  F  ++AG F GQCSE+CGANH+FMP+VVE +    F  ++
Sbjct:   51 THTNTANAQQAEMVWTILPAIILITIALPSLQILYMMDEINK-PHMTIKAIGHQWY-------WTYEYTDY----------------------------KELEFNSYMIQTQDLPLGHMRLLEVDHRMVTPLESYIRMLISADDVLHSWAIPSLGLKTDAVPGRINQAVFIIMQAGIFYGQCSEICGANHSFMPVVVESLPMNHFDLWL 223          
BLAST of cytochrome c oxidase subunit II vs. UniProt/SwissProt
Match: sp|Q37411|COX2_PATPE (Cytochrome c oxidase subunit 2 OS=Patiria pectinifera OX=7594 GN=COII PE=3 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 5.472e-33
Identity = 72/216 (33.33%), Postives = 110/216 (50.93%), Query Frame = 1
Query:  139 TYRDLLENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDS-----AGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYVDG 771
            T R  LE   +E+V T +P +++  +++PS   LY   ++   P  T+K +GHQW+       + Y Y ++                                 +  +F S+ +P S       R + VD  L L A+   R L+S+ DV H +AIP +G+K+DA+PGR+NQ  F+  R G F GQCSE+CGANH+FMPIV+E V+   F+ +V  
Sbjct:   51 TNRFFLEGQGLETVWTIIPAVILIFIALPSLQLLYLMDEVNN-PYLTIKAIGHQWY-------WSYEYADY---------------------------------RELEFDSYMIPTSDLTSGNPRLLEVDNRLTLPAQTPIRVLVSSADVLHSWAIPSLGIKMDAVPGRLNQVNFFISRCGLFYGQCSEICGANHSFMPIVIESVNFSTFETWVSN 225          
BLAST of cytochrome c oxidase subunit II vs. UniProt/SwissProt
Match: sp|Q37545|COX2_LUMTE (Cytochrome c oxidase subunit 2 OS=Lumbricus terrestris OX=6398 GN=COII PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 7.978e-33
Identity = 63/209 (30.14%), Postives = 112/209 (53.59%), Query Frame = 1
Query:  145 RDLLENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDSAGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYVDG 771
            R ++E   +E++ T +P +++ ++++PS   LY + +++  P  TVK +GHQW+       + Y YT+ +                            + EM ++   +  +     R + VD  +++  ++  R LI+A DV H + +P +G+K+DA+PGR+NQ  F + + G F GQCSE+CGANH+FMPI VE +++  F  +V  
Sbjct:   53 RYIMEAQTVETIWTILPALILLVLALPSLRILYITDEVSQ-PSITVKTIGHQWY-------WSYEYTDFL----------------------------NVEMDSYMLPTSDLLPGDYRLLEVDNRMVVPMQLEIRMLITAADVIHSWTVPALGVKVDAVPGRLNQIGFTTTQPGVFYGQCSEICGANHSFMPIAVEAINTKSFMSWVSN 225          
BLAST of cytochrome c oxidase subunit II vs. UniProt/SwissProt
Match: sp|P50689|COX2_GEOCP (Cytochrome c oxidase subunit 2 OS=Georychus capensis OX=10177 GN=MT-CO2 PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.080e-32
Identity = 70/216 (32.41%), Postives = 107/216 (49.54%), Query Frame = 1
Query:  139 TYRDLLENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDS-----AGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYVDG 771
            T+   ++  ++E+V T +P I++ ++++PS   LY   +I   P  TVK +GHQW+       + Y YT++                                 +  +F S+ VP +       R + VD  ++L      R LIS+ DV H + +P +GLK DAIPGR+NQ    S R G F GQCSE+CG+NH+FMPIV+E V    F+ +   
Sbjct:   51 THTSTMDAQEVETVWTILPAIILIMIALPSLRILYMMDEINN-PLLTVKTMGHQWY-------WTYEYTDY---------------------------------EELNFDSYMVPTTDLNPGELRLLEVDNRVVLPMETPIRMLISSEDVLHSWTVPSMGLKTDAIPGRLNQATLTSSRPGLFYGQCSEICGSNHSFMPIVIEMVPLKSFENWTTS 225          
BLAST of cytochrome c oxidase subunit II vs. TrEMBL
Match: T1PUY9 (Cytochrome c oxidase subunit 2 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=COX2 PE=3 SV=1)

HSP 1 Score: 540.806 bits (1392), Expect = 0.000e+0
Identity = 285/292 (97.60%), Postives = 285/292 (97.60%), Query Frame = 1
Query:    1 LSVNLLKGFSPLYQLTESFLYXXXXXXXXXXXXXXXXXXXXRYIG*TYRDLLENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDSAGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYVDGKFFEFNTDGGLCDLHNVTHRNVLYKFNTTYEHLNY 876
            LSVNLL GFSPLYQLTESFLYFVLSVLSIVGLLVGCIIVFLRYIG TYRDLLENDKMESV TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH VPDSAGRNINVDKPLILFARVYTRFLISAYDVAH FAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYVDGKFFEFNTDGGLCDLHNVTH NVLYKFNTTYEHLNY
Sbjct:    1 LSVNLLNGFSPLYQLTESFLYFVLSVLSIVGLLVGCIIVFLRYIGWTYRDLLENDKMESVWTYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWFWHYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSHWVPDSAGRNINVDKPLILFARVYTRFLISAYDVAHSFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYVDGKFFEFNTDGGLCDLHNVTHSNVLYKFNTTYEHLNY 292          
BLAST of cytochrome c oxidase subunit II vs. TrEMBL
Match: A0A0B4VJ57 (Cytochrome c oxidase subunit 2 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=COX2 PE=3 SV=1)

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 283/292 (96.92%), Postives = 284/292 (97.26%), Query Frame = 1
Query:    1 LSVNLLKGFSPLYQLTESFLYXXXXXXXXXXXXXXXXXXXXRYIG*TYRDLLENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDSAGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYVDGKFFEFNTDGGLCDLHNVTHRNVLYKFNTTYEHLNY 876
            LSVNLL GFSPLYQLTESFLYFVLSVLSIVGLLVGCIIVFLRYIG TYRDLLENDKMESV TYVPG+VIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH VPDSAGRNINVDKPLILFARVYTRFLISAYDVAH FAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYVDGKFFEFNTDGGLCDLHNVTH NVLYKFNTTYEH NY
Sbjct:    1 LSVNLLNGFSPLYQLTESFLYFVLSVLSIVGLLVGCIIVFLRYIGWTYRDLLENDKMESVWTYVPGVVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWFWHYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSHWVPDSAGRNINVDKPLILFARVYTRFLISAYDVAHSFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYVDGKFFEFNTDGGLCDLHNVTHSNVLYKFNTTYEHWNY 292          
BLAST of cytochrome c oxidase subunit II vs. TrEMBL
Match: A0A0E3ZDR5 (Cytochrome c oxidase subunit 2 (Fragment) OS=Obama sp. MAP-2014 OX=1520506 GN=cox2 PE=3 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.948e-36
Identity = 80/202 (39.60%), Postives = 106/202 (52.48%), Query Frame = 1
Query:  139 TYRDLLENDKMESV*TYVPGIVIGIMSIPSFYGLYQ-SCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*--VPDSAGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVEC 735
             Y D+LE   +E V T  PG+V+  +  PS YGLY        LP  TV VVG QWF  Y  S ++ +  N I                              E+K F + S+         RN++V+ PL++ +    RFL SA DV H FA+P++G K+D +PGR+NQG+ Y    GKF GQCSE+CGANH+FMPI VEC
Sbjct:   47 VYNDMLEAKTIELVWTIAPGLVLIFLISPSLYGLYLLDLSTLVLPDHTVNVVGRQWFWQYKFSMFIESVLNLI-----------------------------NEIKIFFYDSYLGGYNIKTLRNLDVESPLVIRSNELVRFLFSASDVIHCFALPELGFKLDCVPGRLNQGFLYISHVGKFYGQCSEICGANHSFMPIQVEC 219          
BLAST of cytochrome c oxidase subunit II vs. TrEMBL
Match: G9ISL4 (Cytochrome c oxidase subunit 2 OS=Chrysaora sp. EK-2011 OX=1104535 GN=cox2 PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 5.629e-34
Identity = 78/219 (35.62%), Postives = 112/219 (51.14%), Query Frame = 1
Query:  142 YRDLLENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VP-----DSAGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYVDGKFFE 783
            Y+ L+E   +E V T +P +++  ++ PS   LY   +I   P  T+K+VGHQW+       + Y Y+++                               E +  DF S+ VP     D   R + VD  LIL  + + R LI+  DV H FA+P +G+KIDAIPGR+NQ   +  R+G F GQCSE+CG NH+FMPIVV  V   KF  +++ K  E
Sbjct:   68 YKFLVEGTLIEIVWTLIPAVILVFIAFPSLRLLYLMDEIME-PAITIKIVGHQWY-------WSYEYSDY-------------------------------ESENLDFDSYMVPTTDLEDGDNRLLEVDNSLILPIQTHIRILITGADVIHSFAVPTLGVKIDAIPGRLNQTNMFIKRSGLFFGQCSEICGTNHSFMPIVVRGVSLDKFINWIETKISE 247          
BLAST of cytochrome c oxidase subunit II vs. TrEMBL
Match: I6XA40 (Cytochrome c oxidase subunit 2 OS=Madrepora oculata OX=213639 GN=COX2 PE=3 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 7.566e-33
Identity = 77/213 (36.15%), Postives = 114/213 (53.52%), Query Frame = 1
Query:  145 RDLLENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDS-----AGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYVD 768
            R L++   +E V T  P I++  +++PS   LY   ++ A P  T+KVVGHQW+       + Y Y+++                               E +T  F S+ VP S       R + VD+ L++  + +TRFL++  DV H FA+P +GLKIDA+PGR+NQ   +  R G F GQCSE+CGANH+FMPIVV+ V   ++  Y+D
Sbjct:   84 RQLVDGTFLEIVWTIFPAIILIFIALPSLKLLYLMDEVVA-PVLTIKVVGHQWY-------WSYEYSDY-------------------------------EGETLGFDSYMVPTSDLVSGGSRLLEVDQKLLIPVQTHTRFLVTGADVLHSFAVPSLGLKIDAVPGRLNQTGVFIKRPGVFFGQCSEICGANHSFMPIVVKGVSIKEYVQYLD 257          
BLAST of cytochrome c oxidase subunit II vs. Ensembl Sea Lamprey
Match: COX2 (cytochrome c oxidase subunit II [Source:NCBI gene;Acc:807803])

HSP 1 Score: 118.242 bits (295), Expect = 2.596e-32
Identity = 65/203 (32.02%), Postives = 105/203 (51.72%), Query Frame = 1
Query:  154 LENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDSAGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGY 762
            L++ ++E V T +P IV+  +++PS   LY + +I+  P  T+K VGHQW+       + Y YT++                               E  ++   ++ +     R ++VD  +++      R LI++ DV H + IP +G K+DA+PGR+NQ  F + R G F GQCSE+CGANH+FMPI +E V    F+ +
Sbjct:   56 LDSQEVEIVWTVMPAIVLITIALPSLRILYLTDEISN-PHLTIKAVGHQWY-------WSYEYTDY----------------------------HQMEFDSYMIPTNELEPGGIRLLDVDHRIVVPMESPVRMLITSEDVIHSWTIPSLGTKVDAVPGRLNQATFITTRPGLFFGQCSEICGANHSFMPIALEAVPLSNFENW 222          
BLAST of cytochrome c oxidase subunit II vs. Ensembl Yeast
Match: COX2 (Subunit II of cytochrome c oxidase (Complex IV); Complex IV is the terminal member of the mitochondrial inner membrane electron transport chain; one of three mitochondrially-encoded subunits [Source:SGD;Acc:S000007281])

HSP 1 Score: 103.605 bits (257), Expect = 7.292e-27
Identity = 64/216 (29.63%), Postives = 104/216 (48.15%), Query Frame = 1
Query:  142 YRDLLENDKMESV*TYVPGIVIGIMSIPSFYGLYQSCQIAALPKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDS-----AGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGYVDGK 774
            Y+ +     +E + T  P +++ I++ PSF  LY  C     P  T+K +G+QW+       + Y Y++ I                     D+         +T +F S+ +PD        R ++ D  +++    + RF+++A DV H FAIP +G+K+DA PGR+NQ      R G F G CSE+CG  H  MPI +E V   KF  +++ +
Sbjct:   72 YKYIKHGQTIEVIWTIFPAVILLIIAFPSFILLYL-CDEVISPAMTIKAIGYQWY-------WKYEYSDFI--------------------NDSG--------ETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVTAADVIHDFAIPSLGIKVDATPGRLNQVSALIQREGVFYGACSELCGTGHANMPIKIEAVSLPKFLEWLNEQ 251          
BLAST of cytochrome c oxidase subunit II vs. Ensembl Medaka
Match: COX2 (cytochrome c oxidase subunit II [Source:NCBI gene;Acc:805431])

HSP 1 Score: 101.293 bits (251), Expect = 3.052e-25
Identity = 59/165 (35.76%), Postives = 84/165 (50.91%), Query Frame = 1
Query:  268 PKQTVKVVGHQWF*HYVESFYVYTYTNHIVRRCRGIICGLKDMFMWRQRRDTSTKNSHCEMKTFDFTSH*VPDSAGRNINVDKPLILFARVYTRFLISAYDVAHRFAIPQVGLKIDAIPGRVNQGYFYSLRAGKFVGQCSEVCGANHTFMPIVVECVDSLKFKGY 762
            P  T+K +GHQW+       + Y YT++      G      D +M               + T D T         R +  D  +++      R L+SA DV H +A+P +G+K+DA+PGR+NQ  F + R G F GQCSE+CGANH+FMPIVVE V    F+ +
Sbjct:   93 PHLTIKAMGHQWY-------WSYEYTDY---EDLGF-----DSYM---------------IPTQDLTP-----GQFRLLETDHRMVIPVESPIRVLVSAEDVLHSWAVPSLGVKMDAVPGRLNQTAFITSRPGVFYGQCSEICGANHSFMPIVVEAVPLEHFENW 222          
The following BLAST results are available for this feature:
BLAST of cytochrome c oxidase subunit II vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MT-CO21.301e-3034.02mitochondrially encoded cytochrome c oxidase II [S... [more]
back to top
BLAST of cytochrome c oxidase subunit II vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ctc-25.678e-1730.41Cytochrome c oxidase subunit 2 [Source:UniProtKB/... [more]
back to top
BLAST of cytochrome c oxidase subunit II vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt:CoII3.218e-2430.00gene:FBgn0013675 transcript:FBtr0100863[more]
back to top
BLAST of cytochrome c oxidase subunit II vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt-co23.833e-3133.33cytochrome c oxidase subunit II [Source:NCBI gene;... [more]
back to top
BLAST of cytochrome c oxidase subunit II vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dap31.338e-3132.86death associated protein 3 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of cytochrome c oxidase subunit II vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt-Co25.858e-3132.86mitochondrially encoded cytochrome c oxidase II [S... [more]
back to top
BLAST of cytochrome c oxidase subunit II vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P12701|COX2_PARLI1.228e-3334.11Cytochrome c oxidase subunit 2 OS=Paracentrotus li... [more]
sp|O79673|COX2_PELSU2.525e-3333.01Cytochrome c oxidase subunit 2 OS=Pelomedusa subru... [more]
sp|Q37411|COX2_PATPE5.472e-3333.33Cytochrome c oxidase subunit 2 OS=Patiria pectinif... [more]
sp|Q37545|COX2_LUMTE7.978e-3330.14Cytochrome c oxidase subunit 2 OS=Lumbricus terres... [more]
sp|P50689|COX2_GEOCP1.080e-3232.41Cytochrome c oxidase subunit 2 OS=Georychus capens... [more]
back to top
BLAST of cytochrome c oxidase subunit II vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1PUY90.000e+097.60Cytochrome c oxidase subunit 2 (Fragment) OS=Schmi... [more]
A0A0B4VJ570.000e+096.92Cytochrome c oxidase subunit 2 (Fragment) OS=Schmi... [more]
A0A0E3ZDR51.948e-3639.60Cytochrome c oxidase subunit 2 (Fragment) OS=Obama... [more]
G9ISL45.629e-3435.62Cytochrome c oxidase subunit 2 OS=Chrysaora sp. EK... [more]
I6XA407.566e-3336.15Cytochrome c oxidase subunit 2 OS=Madrepora oculat... [more]
back to top
BLAST of cytochrome c oxidase subunit II vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cytochrome c oxidase subunit II vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
COX22.596e-3232.02cytochrome c oxidase subunit II [Source:NCBI gene;... [more]
back to top
BLAST of cytochrome c oxidase subunit II vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
COX27.292e-2729.63Subunit II of cytochrome c oxidase (Complex IV); C... [more]
back to top
BLAST of cytochrome c oxidase subunit II vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cytochrome c oxidase subunit II vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
COX23.052e-2535.76cytochrome c oxidase subunit II [Source:NCBI gene;... [more]
back to top
BLAST of cytochrome c oxidase subunit II vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30026531
GenBankYP_008592434.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026531 ID=SMED30026531|Name=cytochrome c oxidase subunit II|organism=Schmidtea mediterranea sexual|type=transcript|length=879bp
ttgagtgttaatttgttgaaaggtttctctccgttgtatcaacttactga
gtcttttttatactttgttttatctgttttgagtattgttggtttattgg
ttggttgtattatagtttttttacgttatattggttgaacttatcgtgat
ttattggagaatgataagatggaatctgtttgaacgtatgttcctggtat
agttattggtataatgtcaattcctagtttttatggtttatatcaatctt
gtcagattgctgctttgcctaagcagactgttaaggttgtaggtcatcag
tggttttgacattatgttgagtctttttatgtttatacttatacaaacca
cattgtacgtcgttgtcgtggtattatttgtggtcttaaggatatgttta
tgtggcgtcaacgtcgagatactagtactaagaactcacattgtgagatg
aagacttttgattttacttctcattgagtgcctgatagtgctggtcgtaa
cattaatgttgataagcctttaattctttttgctcgtgtttatacacgtt
tcttgatttctgcttatgatgtggcacatagatttgcaattccacaagtt
ggtttaaagattgatgctattccaggtcgtgttaatcagggttattttta
ttctttgcgtgctggtaagtttgttggtcaatgttcagaagtgtgtggtg
ctaaccatacttttatgcctattgttgtcgagtgtgttgattcgttgaag
tttaagggttatgttgatggtaagttttttgagtttaatacagatggtgg
cttgtgtgatttgcataatgtaacacatagaaatgttttgtataagttta
atactacttatgagcatttgaattattaa
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000101muscle cell
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR008972Cupredoxin
IPR002429Cyt_c_oxidase_su2_C
IPR001505Copper_CuA
Vocabulary: molecular function
TermDefinition
GO:0005507copper ion binding
GO:0004129cytochrome-c oxidase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016021integral component of membrane
GO:0070469respiratory chain
Vocabulary: biological process
TermDefinition
GO:0022900electron transport chain
GO:0055114oxidation-reduction process
GO:1902600hydrogen ion transmembrane transport