Serine palmitoyltransferase 2

Overview
NameSerine palmitoyltransferase 2
Smed IDSMED30026527
Length (bp)2010
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine palmitoyltransferase 2 (SMED30026527) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine palmitoyltransferase 2 (SMED30026527) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine palmitoyltransferase 2 (SMED30026527) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine palmitoyltransferase 2 (SMED30026527) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026527

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30026527h1SMcG0005306 dd_Smed_v4_4337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026527h1SMcG0005306 dd_Smed_v4_4337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026527h1SMcG0005306 dd_Smed_v4_4337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30026527h1SMcG0005306 dd_Smed_v4_4337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30026527h1SMcG0005306 dd_Smed_v4_4337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026527h1SMcG0005306 dd_Smed_v4_4337_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Human
Match: SPTLC2 (serine palmitoyltransferase long chain base subunit 2 [Source:HGNC Symbol;Acc:HGNC:11278])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 284/483 (58.80%), Postives = 359/483 (74.33%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSK-VINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            F E FE+ P L AV+TY  Y VL L G +RDFLR W  EK + AT   +   FV LYQD+E FYTRNLY RIRD WNRPICSVPGA + +++R S D NW+FK+     K VIN GSYNYLGFA+NTG+C +A    + +YG GV S RQE GN   H ELE LVA F G E+A+ + MGFATNS+N+P LV K C ++SDELNH SL+LG RLSGA IR FKHN+M +LEK ++ A+++G PRTRRP+KKIL++VEGIYSMEGSIV LP+++ LKKKY  ++YLDEAHSIGALGP G+GV++YF ++P+D+DV MGTFTKSFG+SGGYI G K LI+++R +SHS++Y   +     +QIITSM  I G+   + G + ++QL  N  YFR  L + GFI++GN+DSPVVPL++  P K+ AF RE L R IG VVVGFPAT II +RARFC+SA+HTKE++D  LK IDEV  L+ + YSR
Sbjct:   59 FNEAFEETPMLVAVLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENFYTRNLYMRIRDNWNRPICSVPGARVDIMERQSHDYNWSFKYTGNIIKGVINMGSYNYLGFARNTGSCQEAAAKVLEEYGAGVCSTRQEIGNLDKHEELEELVARFLGVEAAMAYGMGFATNSMNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQSLEKLLKDAIVYGQPRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPTGRGVVEYFGLDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMKCIMGQDGTSLGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSR 541          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Human
Match: SPTLC3 (serine palmitoyltransferase long chain base subunit 3 [Source:HGNC Symbol;Acc:HGNC:16253])

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 268/507 (52.86%), Postives = 353/507 (69.63%), Query Frame = 2
Query:   23 KKLPMNAKPHRNGYVVIKKTNEHIFFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            K+   N KPH    +++         E FE+AP    V TY  Y +  L G +RDFLR W  EK  AA    +   FVPLYQD+E FYTRNLY RIRD WNRPICS PG    L++R+S+D NWTF+   +    VIN GSYN+LG A         +++ +  YG GV S R E G    H ELE LVA F   E+A+VF MGFATNS+N+P LV K C ++SDELNHTSL+LG RLSGA IR FKHN+  +LEK +R AVI+G PRTRR +KKIL++VEG+YSMEGSIVHLPQI+ LKKKY  ++Y+DEAHSIGA+GP G+GV ++F ++P ++DV MGTFTKSFG+SGGYIAG K L++++R +SHS++Y + M     +QII S+ +I G     +G+++++QL  N  YFR  L + GFI++GN+++ VVPL++  P K+AAF+R  L + IG VVVGFPAT +  ARARFCVSA+HT+EM+D  L+ +DE+  L+ + YSR
Sbjct:   36 KEAQQNGKPHFYDKLIV---------ESFEEAPLHVMVFTYMGYGIGTLFGYLRDFLRNWGIEKCNAAVERKEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPICSAPGPLFDLMERVSDDYNWTFRFTGRVIKDVINMGSYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVFGMGFATNSMNIPALVGKGCLILSDELNHTSLVLGARLSGATIRIFKHNNTQSLEKLLRDAVIYGQPRTRRAWKKILILVEGVYSMEGSIVHLPQIIALKKKYKAYLYIDEAHSIGAVGPTGRGVTEFFGLDPHEVDVLMGTFTKSFGASGGYIAGRKDLVDYLRVHSHSAVYASSMSPPIAEQIIRSLKLIMGLDGTTQGLQRVQQLAKNTRYFRQRLQEMGFIIYGNENASVVPLLLYMPGKVAAFARHMLEKKIGVVVVGFPATPLAEARARFCVSAAHTREMLDTVLEALDEMGDLLQLKYSR 533          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Human
Match: SPTLC2 (serine palmitoyltransferase long chain base subunit 2 [Source:HGNC Symbol;Acc:HGNC:11278])

HSP 1 Score: 437.187 bits (1123), Expect = 5.323e-148
Identity = 218/366 (59.56%), Postives = 275/366 (75.14%), Query Frame = 2
Query:  113 DAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSK-VINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQ 1207
            + P L AV+TY  Y VL L G +RDFLR W  EK + AT   +   FV LYQD+E FYTRNLY RIRD WNRPICSVPGA + +++R S D NW+FK+     K VIN GSYNYLGFA+NTG+C +A    + +YG GV S RQE GN   H ELE LVA F G E+A+ + MGFATNS+N+P LV K C ++SDELNH SL+LG RLSGA IR FKHN+M +LEK ++ A+++G PRTRRP+KKIL++VEGIYSMEGSIV LP+++ LKKKY  ++YLDEAHSIGALGP G+GV++YF ++P+D+DV MGTFTKSFG+SGGYI G K LI+++R +SHS++Y   +     +QIITSM  I G+ 
Sbjct:    2 ETPMLVAVLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENFYTRNLYMRIRDNWNRPICSVPGARVDIMERQSHDYNWSFKYTGNIIKGVINMGSYNYLGFARNTGSCQEAAAKVLEEYGAGVCSTRQEIGNLDKHEELEELVARFLGVEAAMAYGMGFATNSMNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQSLEKLLKDAIVYGQPRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPTGRGVVEYFGLDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMKCIMGQD 367          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Human
Match: SPTLC3 (serine palmitoyltransferase long chain base subunit 3 [Source:HGNC Symbol;Acc:HGNC:16253])

HSP 1 Score: 157.532 bits (397), Expect = 1.127e-43
Identity = 82/181 (45.30%), Postives = 102/181 (56.35%), Query Frame = 2
Query:   23 KKLPMNAKPHRNGYVVIKKTNEHIFFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTS 562
            K+   N KPH    +++         E FE+AP    V TY  Y +  L G +RDFLR W  EK  AA    +   FVPLYQD+E FYTRNLY RIRD WNRPICS PG    L++R+S+D NWTF+   +    VIN GSYN+LG A         +++ +  YG GV S R E G  TS
Sbjct:    9 KEAQQNGKPHFYDKLIV---------ESFEEAPLHVMVFTYMGYGIGTLFGYLRDFLRNWGIEKCNAAVERKEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPICSAPGPLFDLMERVSDDYNWTFRFTGRVIKDVINMGSYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGEFTS 180          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Human
Match: GCAT (glycine C-acetyltransferase [Source:HGNC Symbol;Acc:HGNC:4188])

HSP 1 Score: 160.229 bits (404), Expect = 4.245e-42
Identity = 102/371 (27.49%), Postives = 182/371 (49.06%), Query Frame = 2
Query:  407 LKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSAL 1519
            L  TS ++NF + NYLG + +       ++ ++ ++G G+ S R  CG  + H  LE  +A F  +E AI++P  +  N+     L+  +  V+SDELNH S+I GIRL  AH  R++H DM++LE ++++A         +  +  LV  +G +SM+G I  L +I  L  +Y   +++DE H+ G LGP G+G  +   +  +   +         G+SGGY  G   L+  +R+ +   ++   +P         ++ ++ G          ++ +      FR+ +   GF + G    P+ P+++      +  + + L RGI  +   +P      AR R  +SA H++E ID+ ++   EV  L
Sbjct:   87 LSFTSGILNFCANNYLGLSSHPEVIQAGLQ-ALEEFGAGLSSVRFICGTQSIHKNLEAKIARFHQREDAILYPSCYDANAGLFEALLTPEDAVLSDELNHASIIDGIRLCKAHKYRYRHLDMADLEAKLQEA---------QKHRLRLVATDGAFSMDGDIAPLQEICCLASRYGALVFMDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPGPLVSLLRQRARPYLFSNSLPPAVVGCASKALDLLMGSN------TIVQSMAAKTQRFRSKMEAAGFTISG-ASHPICPVMLGDARLASRMADDMLKRGIFVIGFSYPVVPKGKARIRVQISAVHSEEDIDRCVEAFVEVGRL 440          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Celegans
Match: sptl-2 (Serine palmitoyltransferase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20375])

HSP 1 Score: 492.656 bits (1267), Expect = 6.668e-168
Identity = 244/479 (50.94%), Postives = 334/479 (69.73%), Query Frame = 2
Query:  104 QFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            +FE    L  +  Y  ++ L +   +R+++ R+ F K+ ++    K   FVPL+ D+EAFY RN Y ++RD + RPICSVPGAT+ LVDR+S D NWT+++  T + VIN GSYNYLGFAQ+ G CA+   +SI + GL   +   E G   S  +LE+LVA F G E AI F MGFATNS+N P LV+K   +ISD+ NH SLILG RLSGA  + F+HNDM +LE+ +R A+ +G+P+T RP+KKIL++VEGIYSMEGSI +LP I+ LKKKY  ++YLDEAHSIGA+G  GKGV++Y+  +PKD+D+ MGTFTKSFG++GGYIAG KR ++ +R  S +  Y +PM     QQI TSMSII GK    +G ++I++L  N HYFR  L + GFIV+G+ DSPVVP++I  PT    + RE L+R IG VVV FPAT +   R RFC+SA+HTKE +D+ L+ ++ + ++    +S+
Sbjct:   68 EFEKIDRLTTIKVYIAWLALFVFAHIREYVTRFGFVKDLSSKENAKMKDFVPLFSDFEAFYQRNCYIKVRDVFERPICSVPGATVDLVDRVSHDGNWTYEYPGTRTNVINVGSYNYLGFAQSAGPCAEQSASSIDREGLSCCTTVHERGRSVSQAKLEKLVAEFLGVEDAICFSMGFATNSMNAPCLVDKHSLIISDKYNHASLILGCRLSGASTKVFEHNDMESLERILRDAIAYGNPKTHRPYKKILIIVEGIYSMEGSICNLPGIIALKKKYQAYLYLDEAHSIGAMGKTGKGVVEYWGCDPKDVDILMGTFTKSFGAAGGYIAGSKRTVDHLRAASPTGYYSSPMSPPIAQQIYTSMSIIMGKDGTKDGAQRIERLARNSHYFRMKLKQNGFIVYGSNDSPVVPMLIYFPTMCGFYGREMLARNIGCVVVSFPATHMTEGRVRFCISAAHTKEQLDEVLETVNLLGSMSRSKFSK 546          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Celegans
Match: sptl-2 (Serine palmitoyltransferase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20375])

HSP 1 Score: 492.271 bits (1266), Expect = 1.845e-167
Identity = 244/479 (50.94%), Postives = 334/479 (69.73%), Query Frame = 2
Query:  104 QFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            +FE    L  +  Y  ++ L +   +R+++ R+ F K+ ++    K   FVPL+ D+EAFY RN Y ++RD + RPICSVPGAT+ LVDR+S D NWT+++  T + VIN GSYNYLGFAQ+ G CA+   +SI + GL   +   E G   S  +LE+LVA F G E AI F MGFATNS+N P LV+K   +ISD+ NH SLILG RLSGA  + F+HNDM +LE+ +R A+ +G+P+T RP+KKIL++VEGIYSMEGSI +LP I+ LKKKY  ++YLDEAHSIGA+G  GKGV++Y+  +PKD+D+ MGTFTKSFG++GGYIAG KR ++ +R  S +  Y +PM     QQI TSMSII GK    +G ++I++L  N HYFR  L + GFIV+G+ DSPVVP++I  PT    + RE L+R IG VVV FPAT +   R RFC+SA+HTKE +D+ L+ ++ + ++    +S+
Sbjct:   96 EFEKIDRLTTIKVYIAWLALFVFAHIREYVTRFGFVKDLSSKENAKMKDFVPLFSDFEAFYQRNCYIKVRDVFERPICSVPGATVDLVDRVSHDGNWTYEYPGTRTNVINVGSYNYLGFAQSAGPCAEQSASSIDREGLSCCTTVHERGRSVSQAKLEKLVAEFLGVEDAICFSMGFATNSMNAPCLVDKHSLIISDKYNHASLILGCRLSGASTKVFEHNDMESLERILRDAIAYGNPKTHRPYKKILIIVEGIYSMEGSICNLPGIIALKKKYQAYLYLDEAHSIGAMGKTGKGVVEYWGCDPKDVDILMGTFTKSFGAAGGYIAGSKRTVDHLRAASPTGYYSSPMSPPIAQQIYTSMSIIMGKDGTKDGAQRIERLARNSHYFRMKLKQNGFIVYGSNDSPVVPMLIYFPTMCGFYGREMLARNIGCVVVSFPATHMTEGRVRFCISAAHTKEQLDEVLETVNLLGSMSRSKFSK 574          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Celegans
Match: sptl-3 (Serine palmitoyltransferase 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XVI6])

HSP 1 Score: 429.869 bits (1104), Expect = 4.937e-144
Identity = 216/454 (47.58%), Postives = 299/454 (65.86%), Query Frame = 2
Query:  155 IVLNLIGRM-RDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVS 1513
            I + L+G M      +W   K   +    +  SF PL   ++A YT ++YR+  D  NRPI  VPGA ++L DR ++D+ WT K+  T S+VIN GSYNYLGF+  +G CA+A    I KYG+  G  RQE GNH +H  +E  +A +   E AIVFPMGFATNS+N+P LV+K   ++SD LNH SL+ G RLSGAH   F+HND S+ E+++R A+    P+T   + K+L+++EGIYSMEG+IV+LP  + +KKKYN +++LDEAHSIGA+GP G+GV +Y+  NP+DID+ MGT TKSF S+GGY+ G K++I+ +R  S  + YG  M      Q+  ++ I+ GK   + G +K  QL  N  YFR  L K+GF+V+GN DSPVVPL+    TK+  FSR  L   IG V VG+PAT ++ AR RFC+SA HTKE +D  L+ +++V 
Sbjct:   45 ITMMLVGAMVATLFDKWGIVKTKRSKGDPRMESFQPLGNSFDATYTDHIYRQSTDVVNRPISGVPGAIVRLKDRYTDDHGWTQKYTGTESEVINLGSYNYLGFSHRSGVCAEAAAAHIDKYGINCGGSRQEIGNHVAHKSVESTIAQYLNVEDAIVFPMGFATNSMNIPSLVDKGSLILSDRLNHASLVTGCRLSGAHTVVFRHNDASDCERKLRDALCGVSPKTGEKYNKVLIIIEGIYSMEGTIVNLPAFIAVKKKYNCYLFLDEAHSIGAVGPSGRGVAEYWGCNPRDIDIMMGTLTKSFASAGGYMGGSKKVIDHIRRYSAGTCYGVTMSPPLIAQVERAVLIMSGKDGTDIGRQKAIQLLENSRYFRKELRKRGFLVYGNNDSPVVPLMTFYITKVVEFSRRMLKHNIGIVAVGYPATPLLEARVRFCLSADHTKEHLDYILEAVEQVG 498          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Celegans
Match: sptl-3 (Serine palmitoyltransferase 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XVI6])

HSP 1 Score: 429.869 bits (1104), Expect = 4.937e-144
Identity = 216/454 (47.58%), Postives = 299/454 (65.86%), Query Frame = 2
Query:  155 IVLNLIGRM-RDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVS 1513
            I + L+G M      +W   K   +    +  SF PL   ++A YT ++YR+  D  NRPI  VPGA ++L DR ++D+ WT K+  T S+VIN GSYNYLGF+  +G CA+A    I KYG+  G  RQE GNH +H  +E  +A +   E AIVFPMGFATNS+N+P LV+K   ++SD LNH SL+ G RLSGAH   F+HND S+ E+++R A+    P+T   + K+L+++EGIYSMEG+IV+LP  + +KKKYN +++LDEAHSIGA+GP G+GV +Y+  NP+DID+ MGT TKSF S+GGY+ G K++I+ +R  S  + YG  M      Q+  ++ I+ GK   + G +K  QL  N  YFR  L K+GF+V+GN DSPVVPL+    TK+  FSR  L   IG V VG+PAT ++ AR RFC+SA HTKE +D  L+ +++V 
Sbjct:   45 ITMMLVGAMVATLFDKWGIVKTKRSKGDPRMESFQPLGNSFDATYTDHIYRQSTDVVNRPISGVPGAIVRLKDRYTDDHGWTQKYTGTESEVINLGSYNYLGFSHRSGVCAEAAAAHIDKYGINCGGSRQEIGNHVAHKSVESTIAQYLNVEDAIVFPMGFATNSMNIPSLVDKGSLILSDRLNHASLVTGCRLSGAHTVVFRHNDASDCERKLRDALCGVSPKTGEKYNKVLIIIEGIYSMEGTIVNLPAFIAVKKKYNCYLFLDEAHSIGAVGPSGRGVAEYWGCNPRDIDIMMGTLTKSFASAGGYMGGSKKVIDHIRRYSAGTCYGVTMSPPLIAQVERAVLIMSGKDGTDIGRQKAIQLLENSRYFRKELRKRGFLVYGNNDSPVVPLMTFYITKVVEFSRRMLKHNIGIVAVGYPATPLLEARVRFCLSADHTKEHLDYILEAVEQVG 498          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Celegans
Match: sptl-3 (Serine palmitoyltransferase 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XVI6])

HSP 1 Score: 429.869 bits (1104), Expect = 5.620e-144
Identity = 216/454 (47.58%), Postives = 299/454 (65.86%), Query Frame = 2
Query:  155 IVLNLIGRM-RDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVS 1513
            I + L+G M      +W   K   +    +  SF PL   ++A YT ++YR+  D  NRPI  VPGA ++L DR ++D+ WT K+  T S+VIN GSYNYLGF+  +G CA+A    I KYG+  G  RQE GNH +H  +E  +A +   E AIVFPMGFATNS+N+P LV+K   ++SD LNH SL+ G RLSGAH   F+HND S+ E+++R A+    P+T   + K+L+++EGIYSMEG+IV+LP  + +KKKYN +++LDEAHSIGA+GP G+GV +Y+  NP+DID+ MGT TKSF S+GGY+ G K++I+ +R  S  + YG  M      Q+  ++ I+ GK   + G +K  QL  N  YFR  L K+GF+V+GN DSPVVPL+    TK+  FSR  L   IG V VG+PAT ++ AR RFC+SA HTKE +D  L+ +++V 
Sbjct:   54 ITMMLVGAMVATLFDKWGIVKTKRSKGDPRMESFQPLGNSFDATYTDHIYRQSTDVVNRPISGVPGAIVRLKDRYTDDHGWTQKYTGTESEVINLGSYNYLGFSHRSGVCAEAAAAHIDKYGINCGGSRQEIGNHVAHKSVESTIAQYLNVEDAIVFPMGFATNSMNIPSLVDKGSLILSDRLNHASLVTGCRLSGAHTVVFRHNDASDCERKLRDALCGVSPKTGEKYNKVLIIIEGIYSMEGTIVNLPAFIAVKKKYNCYLFLDEAHSIGAVGPSGRGVAEYWGCNPRDIDIMMGTLTKSFASAGGYMGGSKKVIDHIRRYSAGTCYGVTMSPPLIAQVERAVLIMSGKDGTDIGRQKAIQLLENSRYFRKELRKRGFLVYGNNDSPVVPLMTFYITKVVEFSRRMLKHNIGIVAVGYPATPLLEARVRFCLSADHTKEHLDYILEAVEQVG 507          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Fly
Match: lace (gene:FBgn0002524 transcript:FBtr0343735)

HSP 1 Score: 462.996 bits (1190), Expect = 9.391e-156
Identity = 240/490 (48.98%), Postives = 328/490 (66.94%), Query Frame = 2
Query:   86 EHIFFEQFEDAPYLHAVITYCCYIVLNLIGRMRD--FLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTR-RPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLP 1546
            EH     FE+ P   A +TY  + +L ++G +    F+ +   EK            +V LY  +E+FY+R +YRRI+DCWNRPICSVPG  + L DR+++D  W+FK   T ++ +N GSYNYLGFA  TG CAD  E S    GL   S R E G++    ELE L A + G E AIVF MGFATN+LNLP L+     VISDE NH S+ILG+RLSGA  + FKHN+M +LE+ +R+ V +G+P+   +P+ K++++VEGI+SMEGSIV LP+++ LKKKY  ++YLDEAHS+GA+G  G+GV DYFN++PK++D+ MGTFTKSFGS+GGY+AG K+LI+F+R NSH+  Y A +     QQI+TSM  I G+   + G KKI QL  N  YFR  L + G I +G++DSPVVP+++   +K+ A  R   +R I  V  GFPAT I+  R RFC+SA+HTKE +D  L+ IDE++  + + YSR P
Sbjct:  108 EHFQKTSFEEVPLHTACLTYLGFYLLMILGYINQLLFVPKVATEKG--------RDGYVALYDAFESFYSRYVYRRIKDCWNRPICSVPGDELTLKDRVTDDYGWSFKFTGTETRCLNLGSYNYLGFAAATGQCADDSEESARSSGLAYCSSRCELGDNEQLQELEALTARYFGVEDAIVFGMGFATNALNLPSLLGPNSLVISDEKNHASIILGLRLSGATTKVFKHNNMRDLERVLRQGVCYGNPKKGGQPWDKVMILVEGIFSMEGSIVRLPEVIALKKKYKAYLYLDEAHSVGAMGSRGRGVTDYFNVDPKEVDILMGTFTKSFGSAGGYLAGSKKLIDFLRTNSHAHCYAASISPPIAQQILTSMKTIMGEDGTDIGRKKIHQLARNTRYFRRRLAQLGVITYGHEDSPVVPMLVYLFSKIGAVVRTLTTRHIAAVGAGFPATPIMEGRIRFCLSAAHTKEQLDFALEAIDEIADDLGLKYSRKP 589          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Fly
Match: lace (gene:FBgn0002524 transcript:FBtr0080738)

HSP 1 Score: 462.996 bits (1190), Expect = 9.391e-156
Identity = 240/490 (48.98%), Postives = 328/490 (66.94%), Query Frame = 2
Query:   86 EHIFFEQFEDAPYLHAVITYCCYIVLNLIGRMRD--FLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTR-RPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLP 1546
            EH     FE+ P   A +TY  + +L ++G +    F+ +   EK            +V LY  +E+FY+R +YRRI+DCWNRPICSVPG  + L DR+++D  W+FK   T ++ +N GSYNYLGFA  TG CAD  E S    GL   S R E G++    ELE L A + G E AIVF MGFATN+LNLP L+     VISDE NH S+ILG+RLSGA  + FKHN+M +LE+ +R+ V +G+P+   +P+ K++++VEGI+SMEGSIV LP+++ LKKKY  ++YLDEAHS+GA+G  G+GV DYFN++PK++D+ MGTFTKSFGS+GGY+AG K+LI+F+R NSH+  Y A +     QQI+TSM  I G+   + G KKI QL  N  YFR  L + G I +G++DSPVVP+++   +K+ A  R   +R I  V  GFPAT I+  R RFC+SA+HTKE +D  L+ IDE++  + + YSR P
Sbjct:  108 EHFQKTSFEEVPLHTACLTYLGFYLLMILGYINQLLFVPKVATEKG--------RDGYVALYDAFESFYSRYVYRRIKDCWNRPICSVPGDELTLKDRVTDDYGWSFKFTGTETRCLNLGSYNYLGFAAATGQCADDSEESARSSGLAYCSSRCELGDNEQLQELEALTARYFGVEDAIVFGMGFATNALNLPSLLGPNSLVISDEKNHASIILGLRLSGATTKVFKHNNMRDLERVLRQGVCYGNPKKGGQPWDKVMILVEGIFSMEGSIVRLPEVIALKKKYKAYLYLDEAHSVGAMGSRGRGVTDYFNVDPKEVDILMGTFTKSFGSAGGYLAGSKKLIDFLRTNSHAHCYAASISPPIAQQILTSMKTIMGEDGTDIGRKKIHQLARNTRYFRRRLAQLGVITYGHEDSPVVPMLVYLFSKIGAVVRTLTTRHIAAVGAGFPATPIMEGRIRFCLSAAHTKEQLDFALEAIDEIADDLGLKYSRKP 589          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Fly
Match: CG10361 (gene:FBgn0036208 transcript:FBtr0076084)

HSP 1 Score: 182.956 bits (463), Expect = 5.938e-51
Identity = 120/413 (29.06%), Postives = 210/413 (50.85%), Query Frame = 2
Query:  284 YTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLK-TTSKVINFGSYNYLGFAQNTGACADAVENS---ISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEV 1510
            Y+     ++R+     +  +  A     +RI   +  T   ++ +  K++NF + NYLG A N     + VE+S   + +YG G+ S R  CG    H +LE+ +A F G+E  I++   F  N+     ++  +  V SDELNH S+I GIRL  A  +R++H D+ +LE+Q++ +      R +      L+  +G++SM+G+I  L +IVEL +KYN  +++DE H+ G  G  G+G  +Y N+  +   +         G+SGGY  G   LI F+R+ S   ++   +P       +  M ++       +  +  ++++ N   FR A+ K GF + G ++ P+ P+++      + F+ E L+RGI  +   +P      AR R  +SA+HT+  ID+ +    EV
Sbjct:   18 YSAAAQAQLREILGTQLAGIKDAGTFKAERIITSSQSTQITVQGSDKKILNFCANNYLGLANNP----EIVEHSQKLLEQYGAGLSSVRFICGTQDIHKQLEKKIAQFHGREDTILYASCFDANAGIFEAILTPEDAVFSDELNHASIIDGIRLCKAKKQRYRHRDLGDLEEQLKAS----DARLK------LIATDGVFSMDGNIAPLARIVELARKYNALVFVDECHATGFFGATGRGTEEYDNVMGEVDIINSTLGKALGGASGGYTTGPAELISFLRQKSRPYLFSNTLPPAVVAVGLKVMDMLL------QSSELTQRVQSNTQRFRQAMTKAGFTIAG-ENHPICPVMLGDARLASQFADEMLTRGIYVIGFSYPVVPQGKARIRVQISAAHTEAEIDRAINAFIEV 409          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Fly
Match: Spt-I (gene:FBgn0086532 transcript:FBtr0087731)

HSP 1 Score: 141.739 bits (356), Expect = 8.073e-36
Identity = 106/381 (27.82%), Postives = 180/381 (47.24%), Query Frame = 2
Query:  428 INFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFK-KILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVF------GNKDSPVVPLIICTPTK--------LAAFSRECLSRGIGTVVVGFPAT---TIILARARFCVSASHTKEMIDQTLKVIDEVSA 1516
            +N GS+NYLGF ++     +A + S+ KYG+G   PR   G    H +LE  +A F G E AIV+  GF+T +  +P    +   +  DE  + ++  G+  S + I  FKHND+ +LE+ + +         ++  K +  +V EGIY   G I  LP +V L++KY   +++DE+ S G LG  G GV ++FN++  ++D+       S  + GG+  G   + E  R +    I+ A +P +  Q  I+++   E          +  Q+   +      LH+K F+ F      G++ SPV  L +  P +        L   + +C++RG+  V   +        +    R  V+       ID   +VI+ VS+
Sbjct:   97 LNLGSHNYLGFLEDQEILEEACK-SLRKYGVGSCGPRGFYGTMDVHLDLEDRIAKFMGLEEAIVYSYGFSTVASAIPAYAKRGDLIFVDEAVNFAIQKGLDASRSTIVFFKHNDVEDLERLLIEQEKRDQKNPKKAAKTRRFLVAEGIYMNTGEICPLPDLVALRQKYKLRLFIDESISFGTLGQGGHGVTEHFNVDRDEVDLISAGMEGSMATVGGFCVGSHFIAEHQRLSGLGYIFSASLPPMLTQAAISALDRFE----------REPQIFEQLQAKSKTLHQK-FLRFSKLTLRGDEVSPVKHLYLAQPAENFDKELKLLTELADKCIARGVAVVQAAYLQNRERQPVRPSIRIAVNRLLESSEIDNAFEVIESVSS 465          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Fly
Match: Spt-I (gene:FBgn0086532 transcript:FBtr0087729)

HSP 1 Score: 141.739 bits (356), Expect = 8.073e-36
Identity = 106/381 (27.82%), Postives = 180/381 (47.24%), Query Frame = 2
Query:  428 INFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFK-KILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVF------GNKDSPVVPLIICTPTK--------LAAFSRECLSRGIGTVVVGFPAT---TIILARARFCVSASHTKEMIDQTLKVIDEVSA 1516
            +N GS+NYLGF ++     +A + S+ KYG+G   PR   G    H +LE  +A F G E AIV+  GF+T +  +P    +   +  DE  + ++  G+  S + I  FKHND+ +LE+ + +         ++  K +  +V EGIY   G I  LP +V L++KY   +++DE+ S G LG  G GV ++FN++  ++D+       S  + GG+  G   + E  R +    I+ A +P +  Q  I+++   E          +  Q+   +      LH+K F+ F      G++ SPV  L +  P +        L   + +C++RG+  V   +        +    R  V+       ID   +VI+ VS+
Sbjct:   97 LNLGSHNYLGFLEDQEILEEACK-SLRKYGVGSCGPRGFYGTMDVHLDLEDRIAKFMGLEEAIVYSYGFSTVASAIPAYAKRGDLIFVDEAVNFAIQKGLDASRSTIVFFKHNDVEDLERLLIEQEKRDQKNPKKAAKTRRFLVAEGIYMNTGEICPLPDLVALRQKYKLRLFIDESISFGTLGQGGHGVTEHFNVDRDEVDLISAGMEGSMATVGGFCVGSHFIAEHQRLSGLGYIFSASLPPMLTQAAISALDRFE----------REPQIFEQLQAKSKTLHQK-FLRFSKLTLRGDEVSPVKHLYLAQPAENFDKELKLLTELADKCIARGVAVVQAAYLQNRERQPVRPSIRIAVNRLLESSEIDNAFEVIESVSS 465          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Zebrafish
Match: sptlc2b (serine palmitoyltransferase, long chain base subunit 2b [Source:ZFIN;Acc:ZDB-GENE-080305-8])

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 292/484 (60.33%), Postives = 359/484 (74.17%), Query Frame = 2
Query:   92 IFFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            +F E FE+ P L AV+TY  Y +L + G +RDFLR W FEK + A    +   FVPLYQD+E FYTRNLY RIRD WNRPICSVPGA M LV+R++ D NWTF+H  K    VIN GSYNYLGFA+N+G CADA   S  KYG+GV S RQE GN   H ELE+LVA F G ES++VF MGFATNS+N+P L  K C ++SDELNH SL+LG RLSG+ IR FKHN+M +LEK +R A++ G PRT RP+KKIL+VVEGIYSMEGSIV LP+I+ LKKKY  ++YLDEAHSIGALG  G+GV+DYF ++P D+D+ MGTFTKSFG++GGYI G K LI+++R +SHS++Y   M     QQIITSM  I G+     G ++++QL  N  YFR  LH+ GFI++GN DSPVVPL++  P K+ AF RE L R IGTVVVGFPAT II +RARFCVSA+HT+EM+D  L  I EV  L+ + YSR
Sbjct:   57 LFVESFEETPLLVAVLTYMGYGILTIFGYLRDFLRDWKFEKCHLAREREEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPICSVPGAKMDLVERVTPDYNWTFEHTGKVLKDVINMGSYNYLGFAENSGTCADAAAYSTVKYGVGVSSTRQEIGNLDKHEELEKLVARFLGVESSMVFGMGFATNSMNIPALTGKGCLILSDELNHASLVLGARLSGSTIRVFKHNNMQSLEKMLRDAIVHGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEIIALKKKYKAYLYLDEAHSIGALGTRGRGVVDYFGLDPSDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRLHSHSAVYATSMSPPVTQQIITSMKCIMGEDGTTLGQERLRQLSENTTYFRRRLHEMGFIIYGNNDSPVVPLMLYMPAKIGAFGREMLKRNIGTVVVGFPATPIIESRARFCVSAAHTREMLDTALNAISEVGDLLQLKYSR 540          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Zebrafish
Match: sptlc2a (serine palmitoyltransferase, long chain base subunit 2a [Source:ZFIN;Acc:ZDB-GENE-050522-23])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 281/491 (57.23%), Postives = 359/491 (73.12%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR---LPVPD 1555
            F E FE+ P L AV+TY  Y +L + G +RDF+R W  EK + A    +   FVPLYQD+E FYTRNLY RIRD WNRPICSVPGA   LV+R S D NWTF++  +    VIN GSYNYLGFA+NTG+CA A      K+G+GV S RQE GN   H +LE+LVA+F   ESA+ F MGFATNS+N+P L  K C ++SDELNH SL+LG RLSG+ IR FKHN+M +LEK +R A++ G PRT RP+KKIL++VEGIYSMEGSI+ LP+++ LKKKY  ++YLDEAHSIGALGP G+GV++YF ++P+D+D+ MGTFTKSFG++GGYI G K LI+++R +SHS++Y + M A   +QIITSM  I G+     G  +I++L  N  YFR  L + GFI++GN DSPVVP+++  P K+ AF RE L R IG VVVGFPAT II +RARFC+SA+H+KEM+D+ L VI EV  L+ + YSR   LP  D
Sbjct:   55 FIESFEETPMLVAVLTYMGYGILTIFGYLRDFMREWKIEKCHIAREREEQKDFVPLYQDFENFYTRNLYMRIRDSWNRPICSVPGAKFDLVERSSNDYNWTFEYTGRVVKDVINLGSYNYLGFAENTGSCATAAGEVTVKFGVGVASTRQEMGNLDRHEKLEKLVASFLRVESAMAFGMGFATNSMNIPALAGKGCLILSDELNHASLVLGARLSGSTIRVFKHNNMQSLEKLLRDAIVHGQPRTHRPWKKILILVEGIYSMEGSIIRLPEVIALKKKYKAYLYLDEAHSIGALGPGGRGVVEYFGLDPRDVDIMMGTFTKSFGAAGGYIGGRKDLIDYLRTHSHSAVYASSMSAPVVEQIITSMKCIMGEDGTTIGRSRIQRLAENTVYFRRRLREMGFIIYGNNDSPVVPMMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCISAAHSKEMLDRALDVISEVGDLLQLKYSRHKVLPSLD 545          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Zebrafish
Match: sptlc3 (serine palmitoyltransferase, long chain base subunit 3 [Source:ZFIN;Acc:ZDB-GENE-041210-281])

HSP 1 Score: 538.88 bits (1387), Expect = 0.000e+0
Identity = 270/485 (55.67%), Postives = 351/485 (72.37%), Query Frame = 2
Query:  101 EQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLPVP 1552
            + FE+AP   AV+TY  Y ++ L G  RDFLR    EK + A    +   FVPLYQD+E FY RNLY R+RD WNRPICS+PG    L++R+S+D NWTF+   +T   VIN GSYNYLGFA+N       V     +YG+GV S RQE GN + H ELE LVA F G ESA+ F MGFATNS+N+P LV K C ++SDELNHTSLILG RLSGA IR FKHN+M +LEK +++A+  G PRT R +KKIL++VEGIYSMEGS+V LP+I+ LKKKY  ++YLDEAHSIGA+GP G+GV ++F ++PK+IDV MGTFTKSFG++GGYIAG K L++++R +SHS++Y   M     +QII ++  I G     EG ++++QL  N HYFR+ L + GFI++GNKDSPV+PL++  P K+ AFSR  L R IG VVVGFPATTI  ARARFCVSA+HT++M+++ L+ +DE+   I + +SR   P
Sbjct:   54 DSFEEAPMYVAVLTYMGYGIVILFGYFRDFLRAVGLEKCHQAQEREEQKDFVPLYQDFENFYKRNLYMRVRDNWNRPICSLPGPVFDLMERVSDDYNWTFRLTGRTIENVINMGSYNYLGFAENNVDFLKTVAEKTRQYGVGVCSTRQELGNFSIHEELEHLVADFLGVESAMAFGMGFATNSMNIPALVGKGCLILSDELNHTSLILGARLSGATIRVFKHNNMQSLEKLLKEAICSGQPRTHRSWKKILIMVEGIYSMEGSLVRLPEIIALKKKYKAYLYLDEAHSIGAVGPTGRGVTEHFGVDPKEIDVLMGTFTKSFGATGGYIAGKKELVDYLRCHSHSAVYATAMSPPVVEQIIRAIKCIMGVDGTTEGQRRVRQLAENTHYFRSRLKEMGFIIYGNKDSPVIPLLLYQPGKVGAFSRAMLKRKIGVVVVGFPATTITEARARFCVSAAHTRDMLNKVLQSLDELGDYIRVKFSRHRRP 538          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Zebrafish
Match: sptlc3 (serine palmitoyltransferase, long chain base subunit 3 [Source:ZFIN;Acc:ZDB-GENE-041210-281])

HSP 1 Score: 538.88 bits (1387), Expect = 0.000e+0
Identity = 270/485 (55.67%), Postives = 351/485 (72.37%), Query Frame = 2
Query:  101 EQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLPVP 1552
            + FE+AP   AV+TY  Y ++ L G  RDFLR    EK + A    +   FVPLYQD+E FY RNLY R+RD WNRPICS+PG    L++R+S+D NWTF+   +T   VIN GSYNYLGFA+N       V     +YG+GV S RQE GN + H ELE LVA F G ESA+ F MGFATNS+N+P LV K C ++SDELNHTSLILG RLSGA IR FKHN+M +LEK +++A+  G PRT R +KKIL++VEGIYSMEGS+V LP+I+ LKKKY  ++YLDEAHSIGA+GP G+GV ++F ++PK+IDV MGTFTKSFG++GGYIAG K L++++R +SHS++Y   M     +QII ++  I G     EG ++++QL  N HYFR+ L + GFI++GNKDSPV+PL++  P K+ AFSR  L R IG VVVGFPATTI  ARARFCVSA+HT++M+++ L+ +DE+   I + +SR   P
Sbjct:   54 DSFEEAPMYVAVLTYMGYGIVILFGYFRDFLRAVGLEKCHQAQEREEQKDFVPLYQDFENFYKRNLYMRVRDNWNRPICSLPGPVFDLMERVSDDYNWTFRLTGRTIENVINMGSYNYLGFAENNVDFLKTVAEKTRQYGVGVCSTRQELGNFSIHEELEHLVADFLGVESAMAFGMGFATNSMNIPALVGKGCLILSDELNHTSLILGARLSGATIRVFKHNNMQSLEKLLKEAICSGQPRTHRSWKKILIMVEGIYSMEGSLVRLPEIIALKKKYKAYLYLDEAHSIGAVGPTGRGVTEHFGVDPKEIDVLMGTFTKSFGATGGYIAGKKELVDYLRCHSHSAVYATAMSPPVVEQIIRAIKCIMGVDGTTEGQRRVRQLAENTHYFRSRLKEMGFIIYGNKDSPVIPLLLYQPGKVGAFSRAMLKRKIGVVVVGFPATTITEARARFCVSAAHTRDMLNKVLQSLDELGDYIRVKFSRHRRP 538          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Zebrafish
Match: sptlc2a (serine palmitoyltransferase, long chain base subunit 2a [Source:ZFIN;Acc:ZDB-GENE-050522-23])

HSP 1 Score: 184.496 bits (467), Expect = 1.945e-53
Identity = 88/158 (55.70%), Postives = 106/158 (67.09%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSH 565
            F E FE+ P L AV+TY  Y +L + G +RDF+R W  EK + A    +   FVPLYQD+E FYTRNLY RIRD WNRPICSVPGA   LV+R S D NWTF++  +    VIN GSYNYLGFA+NTG+CA A      K+G+GV S RQE   H+ H
Sbjct:   55 FIESFEETPMLVAVLTYMGYGILTIFGYLRDFMREWKIEKCHIAREREEQKDFVPLYQDFENFYTRNLYMRIRDSWNRPICSVPGAKFDLVERSSNDYNWTFEYTGRVVKDVINLGSYNYLGFAENTGSCATAAGEVTVKFGVGVASTRQEMDFHSYH 212          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Xenopus
Match: wdr93 (WD repeat domain 93 [Source:Xenbase;Acc:XB-GENE-6462910])

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 289/487 (59.34%), Postives = 362/487 (74.33%), Query Frame = 2
Query:   83 NEHIFFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            N+  F E FE+ P L AV+TY  Y +L L G +RDFLR W  EK + AT  ++   FVPLYQD+E FYTRNLY RIRD WNRP+CSVPG  + +++R ++D NWTFK   +    VIN GSYNYLGFAQNTG CADA   S+++YG G+ S RQE GN   H ELE LVA F G E+A+ + MGFATNS+N+P LV K C ++SDELNH+SL+LG RLSGA IR FKHN+M +LEK +R A++ G PRT RP+KKIL+VVEGIYSMEGSIV LP+++ LKKKY  ++YLDEAHSIGALGP+G+GV+DYF ++P+D+D+ MGTFTKSFGS+GGYI G K LIE++R +SHS+ Y   M     QQII+SM  I G+     G K+++QL  N  YFR  L + GFI++GN DSPVVPL++  P K+ AF RE L R IG VVVGFPAT II +RARFCVSA+HTKEM+D  L+ I+EV  L+ + YSR
Sbjct:    1 NKKPFNEAFEETPMLVAVLTYMGYGILTLFGYLRDFLRTWKIEKCHIATERVEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPVCSVPGERIDVMERFTDDYNWTFKFTGRVIKGVINMGSYNYLGFAQNTGFCADASAKSLNQYGAGMCSTRQEIGNMEKHEELEHLVARFLGVEAAMTYGMGFATNSMNIPALVGKGCLILSDELNHSSLVLGARLSGATIRIFKHNNMQSLEKLLRDAIVQGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPNGRGVVDYFGLDPRDVDIMMGTFTKSFGSAGGYIGGSKVLIEYLRAHSHSAAYATSMSLPVVQQIISSMKCIMGEDGTTLGQKRVEQLAENTRYFRRRLTEMGFIIYGNSDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCVSAAHTKEMLDAALREINEVGDLLQLKYSR 487          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Xenopus
Match: wdr93 (WD repeat domain 93 [Source:Xenbase;Acc:XB-GENE-6462910])

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 288/483 (59.63%), Postives = 360/483 (74.53%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            F E FE+ P L AV+TY  Y +L L G +RDFLR W  EK + AT  ++   FVPLYQD+E FYTRNLY RIRD WNRP+CSVPG  + +++R ++D NWTFK   +    VIN GSYNYLGFAQNTG CADA   S+++YG G+ S RQE GN   H ELE LVA F G E+A+ + MGFATNS+N+P LV K C ++SDELNH+SL+LG RLSGA IR FKHN+M +LEK +R A++ G PRT RP+KKIL+VVEGIYSMEGSIV LP+++ LKKKY  ++YLDEAHSIGALGP+G+GV+DYF ++P+D+D+ MGTFTKSFGS+GGYI G K LIE++R +SHS+ Y   M     QQII+SM  I G+     G K+++QL  N  YFR  L + GFI++GN DSPVVPL++  P K+ AF RE L R IG VVVGFPAT II +RARFCVSA+HTKEM+D  L+ I+EV  L+ + YSR
Sbjct:   29 FNEAFEETPMLVAVLTYMGYGILTLFGYLRDFLRTWKIEKCHIATERVEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPVCSVPGERIDVMERFTDDYNWTFKFTGRVIKGVINMGSYNYLGFAQNTGFCADASAKSLNQYGAGMCSTRQEIGNMEKHEELEHLVARFLGVEAAMTYGMGFATNSMNIPALVGKGCLILSDELNHSSLVLGARLSGATIRIFKHNNMQSLEKLLRDAIVQGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPNGRGVVDYFGLDPRDVDIMMGTFTKSFGSAGGYIGGSKVLIEYLRAHSHSAAYATSMSLPVVQQIISSMKCIMGEDGTTLGQKRVEQLAENTRYFRRRLTEMGFIIYGNSDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCVSAAHTKEMLDAALREINEVGDLLQLKYSR 511          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Xenopus
Match: wdr93 (WD repeat domain 93 [Source:Xenbase;Acc:XB-GENE-6462910])

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 288/483 (59.63%), Postives = 360/483 (74.53%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            F E FE+ P L AV+TY  Y +L L G +RDFLR W  EK + AT  ++   FVPLYQD+E FYTRNLY RIRD WNRP+CSVPG  + +++R ++D NWTFK   +    VIN GSYNYLGFAQNTG CADA   S+++YG G+ S RQE GN   H ELE LVA F G E+A+ + MGFATNS+N+P LV K C ++SDELNH+SL+LG RLSGA IR FKHN+M +LEK +R A++ G PRT RP+KKIL+VVEGIYSMEGSIV LP+++ LKKKY  ++YLDEAHSIGALGP+G+GV+DYF ++P+D+D+ MGTFTKSFGS+GGYI G K LIE++R +SHS+ Y   M     QQII+SM  I G+     G K+++QL  N  YFR  L + GFI++GN DSPVVPL++  P K+ AF RE L R IG VVVGFPAT II +RARFCVSA+HTKEM+D  L+ I+EV  L+ + YSR
Sbjct:    9 FNEAFEETPMLVAVLTYMGYGILTLFGYLRDFLRTWKIEKCHIATERVEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPVCSVPGERIDVMERFTDDYNWTFKFTGRVIKGVINMGSYNYLGFAQNTGFCADASAKSLNQYGAGMCSTRQEIGNMEKHEELEHLVARFLGVEAAMTYGMGFATNSMNIPALVGKGCLILSDELNHSSLVLGARLSGATIRIFKHNNMQSLEKLLRDAIVQGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPNGRGVVDYFGLDPRDVDIMMGTFTKSFGSAGGYIGGSKVLIEYLRAHSHSAAYATSMSLPVVQQIISSMKCIMGEDGTTLGQKRVEQLAENTRYFRRRLTEMGFIIYGNSDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCVSAAHTKEMLDAALREINEVGDLLQLKYSR 491          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Xenopus
Match: wdr93 (WD repeat domain 93 [Source:Xenbase;Acc:XB-GENE-6462910])

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 288/483 (59.63%), Postives = 360/483 (74.53%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            F E FE+ P L AV+TY  Y +L L G +RDFLR W  EK + AT  ++   FVPLYQD+E FYTRNLY RIRD WNRP+CSVPG  + +++R ++D NWTFK   +    VIN GSYNYLGFAQNTG CADA   S+++YG G+ S RQE GN   H ELE LVA F G E+A+ + MGFATNS+N+P LV K C ++SDELNH+SL+LG RLSGA IR FKHN+M +LEK +R A++ G PRT RP+KKIL+VVEGIYSMEGSIV LP+++ LKKKY  ++YLDEAHSIGALGP+G+GV+DYF ++P+D+D+ MGTFTKSFGS+GGYI G K LIE++R +SHS+ Y   M     QQII+SM  I G+     G K+++QL  N  YFR  L + GFI++GN DSPVVPL++  P K+ AF RE L R IG VVVGFPAT II +RARFCVSA+HTKEM+D  L+ I+EV  L+ + YSR
Sbjct:    4 FNEAFEETPMLVAVLTYMGYGILTLFGYLRDFLRTWKIEKCHIATERVEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPVCSVPGERIDVMERFTDDYNWTFKFTGRVIKGVINMGSYNYLGFAQNTGFCADASAKSLNQYGAGMCSTRQEIGNMEKHEELEHLVARFLGVEAAMTYGMGFATNSMNIPALVGKGCLILSDELNHSSLVLGARLSGATIRIFKHNNMQSLEKLLRDAIVQGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPNGRGVVDYFGLDPRDVDIMMGTFTKSFGSAGGYIGGSKVLIEYLRAHSHSAAYATSMSLPVVQQIISSMKCIMGEDGTTLGQKRVEQLAENTRYFRRRLTEMGFIIYGNSDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCVSAAHTKEMLDAALREINEVGDLLQLKYSR 486          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Xenopus
Match: wdr93 (WD repeat domain 93 [Source:Xenbase;Acc:XB-GENE-6462910])

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 288/483 (59.63%), Postives = 360/483 (74.53%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            F E FE+ P L AV+TY  Y +L L G +RDFLR W  EK + AT  ++   FVPLYQD+E FYTRNLY RIRD WNRP+CSVPG  + +++R ++D NWTFK   +    VIN GSYNYLGFAQNTG CADA   S+++YG G+ S RQE GN   H ELE LVA F G E+A+ + MGFATNS+N+P LV K C ++SDELNH+SL+LG RLSGA IR FKHN+M +LEK +R A++ G PRT RP+KKIL+VVEGIYSMEGSIV LP+++ LKKKY  ++YLDEAHSIGALGP+G+GV+DYF ++P+D+D+ MGTFTKSFGS+GGYI G K LIE++R +SHS+ Y   M     QQII+SM  I G+     G K+++QL  N  YFR  L + GFI++GN DSPVVPL++  P K+ AF RE L R IG VVVGFPAT II +RARFCVSA+HTKEM+D  L+ I+EV  L+ + YSR
Sbjct:   52 FNEAFEETPMLVAVLTYMGYGILTLFGYLRDFLRTWKIEKCHIATERVEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPVCSVPGERIDVMERFTDDYNWTFKFTGRVIKGVINMGSYNYLGFAQNTGFCADASAKSLNQYGAGMCSTRQEIGNMEKHEELEHLVARFLGVEAAMTYGMGFATNSMNIPALVGKGCLILSDELNHSSLVLGARLSGATIRIFKHNNMQSLEKLLRDAIVQGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPNGRGVVDYFGLDPRDVDIMMGTFTKSFGSAGGYIGGSKVLIEYLRAHSHSAAYATSMSLPVVQQIISSMKCIMGEDGTTLGQKRVEQLAENTRYFRRRLTEMGFIIYGNSDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCVSAAHTKEMLDAALREINEVGDLLQLKYSR 534          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Mouse
Match: Sptlc2 (serine palmitoyltransferase, long chain base subunit 2 [Source:MGI Symbol;Acc:MGI:108074])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 287/483 (59.42%), Postives = 360/483 (74.53%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSK-VINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            F E FE+ P L AV+TY  Y VL L G +RDFLR W  EK + AT   +   FV LYQD+E FYTRNLY RIRD WNRPICSVPGA + +++R S D NW+FK+     K VIN GSYNYLGFA+NTG+C +A    + +YG GV S RQE GN   H ELE+LVA F G E+A+ + MGFATNS+N+P LV K C ++SDELNH SL+LG RLSGA IR FKHN+M +LEK ++ A+++G PRTRRP+KKIL++VEGIYSMEGSIV LP+++ LKKKY  ++YLDEAHSIGALGP G+GV+DYF ++P+D+DV MGTFTKSFG+SGGYI G K LI+++R +SHS++Y   M     +QIITSM  I G+   + G + I+QL  N  YFR  L + GFI++GN+DSPVVPL++  P K+ AF RE L R IG VVVGFPAT II +RARFC+SA+HTKE++D  LK IDEV  L+ + YSR
Sbjct:   57 FNEAFEETPMLVAVLTYVGYGVLTLFGYLRDFLRHWRIEKCHHATEREEQKDFVSLYQDFENFYTRNLYMRIRDNWNRPICSVPGAKVDIMERKSHDYNWSFKYTGNIIKGVINMGSYNYLGFARNTGSCQEAAAEVLKEYGAGVCSTRQEIGNLDKHEELEKLVARFLGVEAAMTYGMGFATNSMNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQSLEKLLKDAIVYGQPRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVDYFGLDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSMSPPVMEQIITSMKCIMGQDGTSLGKECIQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSR 539          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Mouse
Match: Sptlc3 (serine palmitoyltransferase, long chain base subunit 3 [Source:MGI Symbol;Acc:MGI:2444678])

HSP 1 Score: 488.034 bits (1255), Expect = 9.267e-166
Identity = 242/480 (50.42%), Postives = 330/480 (68.75%), Query Frame = 2
Query:   98 FEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININY 1534
            FE +++AP    V+TY  Y +  L G +RDF+R W  EK  AA    +   FVPLYQD+E FY RNLY RIRD W+  +CS P   M +++++++D NWTF+H  K    +IN  SYNYLG A         V++++ KYG+GV S R E G    H ELE L+A F   E+ + F MGFATN++N+P+ V K C ++SDE NHTS+ILG RLSGA IR FKHN+  NLEK +R+A+I G P T R +KKIL+VVEG+YSMEGSIV+L QIV LKKKY  ++Y+DEAHSIG  GP G+GV + F ++P+DIDV MGTFTKSF  SGGYI G K +++++R  SHS+ Y   M  V   Q+I S+ I  G +    G+++I+QL+ N+ YFR  L + GFI++GN  SPV+P+++  P K++AFSR  L + I  VVVGFPAT++   RARF +S++HT+EM+D  L+V+DE+  L+N+ Y
Sbjct:   52 FEPYQEAPLYVYVLTYMGYGIGILFGYLRDFMRNWGIEKCNAAVEREEQKDFVPLYQDFENFYKRNLYMRIRDSWSHTVCSAPEPYMNVMEKVTDDYNWTFRHTGKVIENIINMASYNYLGLAGKYDDSMVRVKDTLEKYGVGVASTRNEMGTLDIHKELEDLMAEFLNVEAVMSFGMGFATNAMNIPVFVGKGCLILSDEFNHTSVILGSRLSGAVIRPFKHNNAENLEKLLREAIIRGQPGTGRAWKKILIVVEGVYSMEGSIVNLAQIVALKKKYKAYLYIDEAHSIGCTGPTGRGVRELFGLDPEDIDVYMGTFTKSFSGSGGYIGGKKEIVDYLRMQSHSTTYATSMSPVVAAQLIRSLKITMGYEGNIGGMERIQQLKENIKYFRRRLKEMGFIIYGNDFSPVIPVLLYMPAKVSAFSRFLLKKKISVVVVGFPATSLPEGRARFSMSSAHTREMLDTVLEVVDELGDLLNVKY 531          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Mouse
Match: Sptlc3 (serine palmitoyltransferase, long chain base subunit 3 [Source:MGI Symbol;Acc:MGI:2444678])

HSP 1 Score: 488.034 bits (1255), Expect = 9.267e-166
Identity = 242/480 (50.42%), Postives = 330/480 (68.75%), Query Frame = 2
Query:   98 FEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININY 1534
            FE +++AP    V+TY  Y +  L G +RDF+R W  EK  AA    +   FVPLYQD+E FY RNLY RIRD W+  +CS P   M +++++++D NWTF+H  K    +IN  SYNYLG A         V++++ KYG+GV S R E G    H ELE L+A F   E+ + F MGFATN++N+P+ V K C ++SDE NHTS+ILG RLSGA IR FKHN+  NLEK +R+A+I G P T R +KKIL+VVEG+YSMEGSIV+L QIV LKKKY  ++Y+DEAHSIG  GP G+GV + F ++P+DIDV MGTFTKSF  SGGYI G K +++++R  SHS+ Y   M  V   Q+I S+ I  G +    G+++I+QL+ N+ YFR  L + GFI++GN  SPV+P+++  P K++AFSR  L + I  VVVGFPAT++   RARF +S++HT+EM+D  L+V+DE+  L+N+ Y
Sbjct:   52 FEPYQEAPLYVYVLTYMGYGIGILFGYLRDFMRNWGIEKCNAAVEREEQKDFVPLYQDFENFYKRNLYMRIRDSWSHTVCSAPEPYMNVMEKVTDDYNWTFRHTGKVIENIINMASYNYLGLAGKYDDSMVRVKDTLEKYGVGVASTRNEMGTLDIHKELEDLMAEFLNVEAVMSFGMGFATNAMNIPVFVGKGCLILSDEFNHTSVILGSRLSGAVIRPFKHNNAENLEKLLREAIIRGQPGTGRAWKKILIVVEGVYSMEGSIVNLAQIVALKKKYKAYLYIDEAHSIGCTGPTGRGVRELFGLDPEDIDVYMGTFTKSFSGSGGYIGGKKEIVDYLRMQSHSTTYATSMSPVVAAQLIRSLKITMGYEGNIGGMERIQQLKENIKYFRRRLKEMGFIIYGNDFSPVIPVLLYMPAKVSAFSRFLLKKKISVVVVGFPATSLPEGRARFSMSSAHTREMLDTVLEVVDELGDLLNVKY 531          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Mouse
Match: Gcat (glycine C-acetyltransferase (2-amino-3-ketobutyrate-coenzyme A ligase) [Source:MGI Symbol;Acc:MGI:1349389])

HSP 1 Score: 162.155 bits (409), Expect = 3.397e-43
Identity = 105/368 (28.53%), Postives = 181/368 (49.18%), Query Frame = 2
Query:  416 TSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSAL 1519
            +  ++NF + NYLG + +  A   A   ++ ++G G+ S R  CG  + H  LE  +A F  +E AI++P  F  N+     L+  +  V+SDELNH S+I GIRL  AH  R++H DM++LE ++++A         +  +  LV  +G +SM+G I  L  I  L  +Y   +++DE H+ G LGP G+G  +   +  +   +         G+SGGY  G + L+  +R+ S   ++   +P         ++ ++       E    I+ +      FR+ +   GF V G  D P+ P+++      +  + + L +GI  +   +P      AR R  +SA H++E ID+ ++   EV  L
Sbjct:   61 SGGILNFCANNYLGLSSHP-AVIQAGLQTLEEFGAGLSSTRFICGTQSIHKNLEAKIAHFHQREDAILYPSCFDANAGLFEALLTPEDAVLSDELNHASIIDGIRLCKAHKYRYRHLDMADLEAKLKEA---------QKHRLRLVATDGAFSMDGDIAPLQDICRLAAQYGALVFVDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPEPLVSLLRQRSRPYLFSNSLPPAVVGCASKALDLL------MESNAIIQSMAAKTRRFRSKMEAAGFTVSG-ADHPICPVMLGDARLSSQMADDMLKKGIFVIGFSYPVVPKGKARIRVQISAVHSEEDIDRCVEAFVEVGRL 411          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Mouse
Match: Gcat (glycine C-acetyltransferase (2-amino-3-ketobutyrate-coenzyme A ligase) [Source:MGI Symbol;Acc:MGI:1349389])

HSP 1 Score: 143.665 bits (361), Expect = 5.811e-37
Identity = 91/324 (28.09%), Postives = 159/324 (49.07%), Query Frame = 2
Query:  416 TSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRG 1387
            +  ++NF + NYLG + +  A   A   ++ ++G G+ S R  CG  + H  LE  +A F  +E AI++P  F  N+     L+  +  V+SDELNH S+I GIRL  AH  R++H DM++LE ++++A         +  +  LV  +G +SM+G I  L  I  L  +Y   +++DE H+ G LGP G+G  +   +  +   +         G+SGGY  G + L+  +R+ S   ++   +P         ++ ++       E    I+ +      FR+ +   GF V G  D P+ P+++      +  + + L +G
Sbjct:   61 SGGILNFCANNYLGLSSHP-AVIQAGLQTLEEFGAGLSSTRFICGTQSIHKNLEAKIAHFHQREDAILYPSCFDANAGLFEALLTPEDAVLSDELNHASIIDGIRLCKAHKYRYRHLDMADLEAKLKEA---------QKHRLRLVATDGAFSMDGDIAPLQDICRLAAQYGALVFVDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPEPLVSLLRQRSRPYLFSNSLPPAVVGCASKALDLL------MESNAIIQSMAAKTRRFRSKMEAAGFTVSG-ADHPICPVMLGDARLSSQMADDMLKKG 367          
BLAST of Serine palmitoyltransferase 2 vs. UniProt/SwissProt
Match: sp|Q3B7D2|SPTC2_RAT (Serine palmitoyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Sptlc2 PE=1 SV=1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 292/498 (58.63%), Postives = 366/498 (73.49%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSK-VINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR-LPVPDWCNNLPDQP 1582
            F E FE+ P L AV+TY  Y VL L G +RDFLR W  EK + AT   +   FV LYQD+E FYTRNLY RIRD WNRPICSVPGA + +++R S D NW+FK+     K VIN GSYNYLGFA+NTG+C +A    +  YG GV S RQE GN   H ELE+LVA F G E+A+ + MGFATNS+N+P LV K C ++SDELNH SL+LG RLSGA IR FKHN+M +LEK ++ A+++G PRTRRP+KKIL++VEGIYSMEGSIV LP+++ LKKKY  ++YLDEAHSIGALGP G+GV+DYF ++P+D+DV MGTFTKSFG+SGGYI G K LI+++R +SHS++Y   M     +QIITSM  I G+   + G + I+QL  N  YFR  L + GFI++GN+DSPVVPL++  P K+ AF RE L R IG VVVGFPAT II +RARFC+SA+HTKE++D  LK IDEV  L+ + YSR  P+P     L D+P
Sbjct:   57 FNEAFEETPMLVAVLTYVGYGVLTLFGYLRDFLRHWRIEKCHHATEREEQKDFVSLYQDFENFYTRNLYMRIRDNWNRPICSVPGAKVDIMERQSHDYNWSFKYTGNIIKGVINMGSYNYLGFARNTGSCQEAAAEVLKTYGAGVCSTRQEIGNLDKHEELEKLVARFLGVEAALTYGMGFATNSMNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQSLEKLLKDAIVYGQPRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVDYFGLDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSMSPPVMEQIITSMKCIMGQDGTSLGKECIQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRPLP-----LLDRP 549          
BLAST of Serine palmitoyltransferase 2 vs. UniProt/SwissProt
Match: sp|P97363|SPTC2_MOUSE (Serine palmitoyltransferase 2 OS=Mus musculus OX=10090 GN=Sptlc2 PE=1 SV=2)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 287/483 (59.42%), Postives = 360/483 (74.53%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSK-VINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            F E FE+ P L AV+TY  Y VL L G +RDFLR W  EK + AT   +   FV LYQD+E FYTRNLY RIRD WNRPICSVPGA + +++R S D NW+FK+     K VIN GSYNYLGFA+NTG+C +A    + +YG GV S RQE GN   H ELE+LVA F G E+A+ + MGFATNS+N+P LV K C ++SDELNH SL+LG RLSGA IR FKHN+M +LEK ++ A+++G PRTRRP+KKIL++VEGIYSMEGSIV LP+++ LKKKY  ++YLDEAHSIGALGP G+GV+DYF ++P+D+DV MGTFTKSFG+SGGYI G K LI+++R +SHS++Y   M     +QIITSM  I G+   + G + I+QL  N  YFR  L + GFI++GN+DSPVVPL++  P K+ AF RE L R IG VVVGFPAT II +RARFC+SA+HTKE++D  LK IDEV  L+ + YSR
Sbjct:   57 FNEAFEETPMLVAVLTYVGYGVLTLFGYLRDFLRHWRIEKCHHATEREEQKDFVSLYQDFENFYTRNLYMRIRDNWNRPICSVPGAKVDIMERKSHDYNWSFKYTGNIIKGVINMGSYNYLGFARNTGSCQEAAAEVLKEYGAGVCSTRQEIGNLDKHEELEKLVARFLGVEAAMTYGMGFATNSMNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQSLEKLLKDAIVYGQPRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVDYFGLDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSMSPPVMEQIITSMKCIMGQDGTSLGKECIQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSR 539          
BLAST of Serine palmitoyltransferase 2 vs. UniProt/SwissProt
Match: sp|O54694|SPTC2_CRIGR (Serine palmitoyltransferase 2 OS=Cricetulus griseus OX=10029 GN=SPTLC2 PE=2 SV=1)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 285/483 (59.01%), Postives = 360/483 (74.53%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSK-VINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            F E FE+ P L AV+TY  Y VL L G +RDFLR W  EK + AT   +   FV LYQD+E FYTRNLY RIRD WNRPICSVPGA + +++R S D NW+FK+     K VIN GSYNYLGFA+NTG+C +A    + +YG GV S RQE GN   H ELE+LVA F G E+A+ + MGFATNS+N+P LV K C ++SDELNH SL+LG RLSGA IR FKHN+M +LEK ++ A+++G PRTRRP+KKIL++VEGIYSMEGSIV LP+++ LKKKY  ++YLDEAHSIGALGP G+GV+DYF ++P+D+DV MGTFTKSFG+SGGYI G K LI+++R +SHS++Y   M     +QIITSM  I G+   + G + ++QL  N  YFR  L + GFI++GN+DSPVVPL++  P K+ AF RE L R +G VVVGFPAT II +RARFC+SA+HTKE++D  LK IDEV  L+ + YSR
Sbjct:   57 FNEVFEETPMLVAVLTYVGYGVLTLFGYLRDFLRHWRIEKCHHATEREEQKDFVSLYQDFENFYTRNLYMRIRDNWNRPICSVPGARVDIMERQSHDYNWSFKYTGNIIKGVINMGSYNYLGFARNTGSCQEAAAEVLKEYGAGVCSTRQEIGNLDKHEELEKLVARFLGVEAAMTYGMGFATNSMNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQSLEKLLKDAIVYGQPRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVDYFGLDPEDVDVMMGTFTKSFGASGGYIGGKKALIDYLRTHSHSAVYATSMSPPVMEQIITSMKCIMGQDGTSLGKECVQQLAENTKYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNVGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSR 539          
BLAST of Serine palmitoyltransferase 2 vs. UniProt/SwissProt
Match: sp|O15270|SPTC2_HUMAN (Serine palmitoyltransferase 2 OS=Homo sapiens OX=9606 GN=SPTLC2 PE=1 SV=1)

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 284/483 (58.80%), Postives = 359/483 (74.33%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSK-VINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            F E FE+ P L AV+TY  Y VL L G +RDFLR W  EK + AT   +   FV LYQD+E FYTRNLY RIRD WNRPICSVPGA + +++R S D NW+FK+     K VIN GSYNYLGFA+NTG+C +A    + +YG GV S RQE GN   H ELE LVA F G E+A+ + MGFATNS+N+P LV K C ++SDELNH SL+LG RLSGA IR FKHN+M +LEK ++ A+++G PRTRRP+KKIL++VEGIYSMEGSIV LP+++ LKKKY  ++YLDEAHSIGALGP G+GV++YF ++P+D+DV MGTFTKSFG+SGGYI G K LI+++R +SHS++Y   +     +QIITSM  I G+   + G + ++QL  N  YFR  L + GFI++GN+DSPVVPL++  P K+ AF RE L R IG VVVGFPAT II +RARFC+SA+HTKE++D  LK IDEV  L+ + YSR
Sbjct:   59 FNEAFEETPMLVAVLTYVGYGVLTLFGYLRDFLRYWRIEKCHHATEREEQKDFVSLYQDFENFYTRNLYMRIRDNWNRPICSVPGARVDIMERQSHDYNWSFKYTGNIIKGVINMGSYNYLGFARNTGSCQEAAAKVLEEYGAGVCSTRQEIGNLDKHEELEELVARFLGVEAAMAYGMGFATNSMNIPALVGKGCLILSDELNHASLVLGARLSGATIRIFKHNNMQSLEKLLKDAIVYGQPRTRRPWKKILILVEGIYSMEGSIVRLPEVIALKKKYKAYLYLDEAHSIGALGPTGRGVVEYFGLDPEDVDVMMGTFTKSFGASGGYIGGKKELIDYLRTHSHSAVYATSLSPPVVEQIITSMKCIMGQDGTSLGKECVQQLAENTRYFRRRLKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSR 541          
BLAST of Serine palmitoyltransferase 2 vs. UniProt/SwissProt
Match: sp|Q9NUV7|SPTC3_HUMAN (Serine palmitoyltransferase 3 OS=Homo sapiens OX=9606 GN=SPTLC3 PE=1 SV=3)

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 268/507 (52.86%), Postives = 353/507 (69.63%), Query Frame = 2
Query:   23 KKLPMNAKPHRNGYVVIKKTNEHIFFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            K+   N KPH    +++         E FE+AP    V TY  Y +  L G +RDFLR W  EK  AA    +   FVPLYQD+E FYTRNLY RIRD WNRPICS PG    L++R+S+D NWTF+   +    VIN GSYN+LG A         +++ +  YG GV S R E G    H ELE LVA F   E+A+VF MGFATNS+N+P LV K C ++SDELNHTSL+LG RLSGA IR FKHN+  +LEK +R AVI+G PRTRR +KKIL++VEG+YSMEGSIVHLPQI+ LKKKY  ++Y+DEAHSIGA+GP G+GV ++F ++P ++DV MGTFTKSFG+SGGYIAG K L++++R +SHS++Y + M     +QII S+ +I G     +G+++++QL  N  YFR  L + GFI++GN+++ VVPL++  P K+AAF+R  L + IG VVVGFPAT +  ARARFCVSA+HT+EM+D  L+ +DE+  L+ + YSR
Sbjct:   36 KEAQQNGKPHFYDKLIV---------ESFEEAPLHVMVFTYMGYGIGTLFGYLRDFLRNWGIEKCNAAVERKEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPICSAPGPLFDLMERVSDDYNWTFRFTGRVIKDVINMGSYNFLGLAAKYDESMRTIKDVLEVYGTGVASTRHEMGTLDKHKELEDLVAKFLNVEAAMVFGMGFATNSMNIPALVGKGCLILSDELNHTSLVLGARLSGATIRIFKHNNTQSLEKLLRDAVIYGQPRTRRAWKKILILVEGVYSMEGSIVHLPQIIALKKKYKAYLYIDEAHSIGAVGPTGRGVTEFFGLDPHEVDVLMGTFTKSFGASGGYIAGRKDLVDYLRVHSHSAVYASSMSPPIAEQIIRSLKLIMGLDGTTQGLQRVQQLAKNTRYFRQRLQEMGFIIYGNENASVVPLLLYMPGKVAAFARHMLEKKIGVVVVGFPATPLAEARARFCVSAAHTREMLDTVLEALDEMGDLLQLKYSR 533          
BLAST of Serine palmitoyltransferase 2 vs. TrEMBL
Match: A0A068XW60 (Serine palmitoyltransferase long chain base OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000374100 PE=3 SV=1)

HSP 1 Score: 626.706 bits (1615), Expect = 0.000e+0
Identity = 306/488 (62.70%), Postives = 383/488 (78.48%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLPVPDW 1558
            F+E FE+    +AV+TY  +++LNL+GR++DFLR+     N AA     T SFVPLY DYEAFYTRN+YRR RDCWNRPICS PG  M L+DR+S D+ WTF+   TT+KV+NFGSYNYLGFA+ TG C +A   SI KYGLGV S R E G    H ELE+LVA F GQE+AIVF MGFATN+LN+P + +K  C+ISDELNHTSLILG RLSGA IRRFKHNDM +LE+ +  AV++G PR+RRPF +I ++VEGIYSMEGSI H+P+I+ LKKKY  ++YLDEAHSIGALGP G+GV+DYF ++P DID+AMGTFTKSFGS+GGY+AG  RLI++VR  S+SSIYG  MPA  CQQI+TSM II G++C  EG +++KQL WN  YFRA LH+ G IVFGN+DSPV+P+I+  P KL AFSR CL RG+G V+VGFPAT ++ +R+RFC+SA HTKEM+D+ L+VI EV+  +++ +SRLP P W
Sbjct:   19 FYESFEEISLKNAVLTYMSFLILNLLGRLQDFLRKHGLLNNPAAKEKEVTRSFVPLYSDYEAFYTRNIYRRARDCWNRPICSTPGPEMVLMDRVSSDSCWTFEMTNTTTKVLNFGSYNYLGFAEPTGPCIEADVKSIEKYGLGVASSRLEVGTLAVHEELEKLVAEFVGQEAAIVFGMGFATNALNMPCIFDKNSCIISDELNHTSLILGCRLSGATIRRFKHNDMQDLERLLADAVVYGRPRSRRPFSRIFIIVEGIYSMEGSIAHMPEIIALKKKYKAYLYLDEAHSIGALGPRGRGVVDYFGLDPADIDIAMGTFTKSFGSAGGYLAGSARLIDYVRTQSYSSIYGGTMPAPVCQQIVTSMRIIMGRECPGEGERRLKQLAWNTRYFRAHLHQMGLIVFGNRDSPVIPIILYMPGKLVAFSRMCLERGLGVVIVGFPATALLASRSRFCISAGHTKEMLDKALRVIAEVTDELHLRWSRLPPPYW 506          
BLAST of Serine palmitoyltransferase 2 vs. TrEMBL
Match: A0A564Y756 (Aminotran_1_2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS4081 PE=3 SV=1)

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 311/490 (63.47%), Postives = 384/490 (78.37%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLPVPDWCN 1564
            F+E FE+    +AV+TY  +++LNL+GR++DFLR+     N A      T SFVPLY DYEAFYTRN+YRR RDCWNRPICS PG  M L+DR+S D+ WTF+   TTSKV+NFGSYNYLGFA+ +G C D+   SI KYGLG+ SPR E G    H ELE LVA F GQE+AIVF MGFATN+LN+P + +K  C+ISDELNHTSLILG RLSGA +RRFKHNDM +LEK +++AV++G PR+RRPF +I ++VEGIYSMEGSI H+P+I+ LKKKY  ++YLDEAHSIGALGP G+G++DYF I+PKDID+AMGTFTKSFGSSGGY+AG KR I++VR  S+SSIYG  MPA  CQQIITSM II G++C  EG +++KQL WN  YFRA LH+ G IVFGN+DSPV+PLI+  P KL AFSR CL RG+G VVVGFPAT ++ +R RFC+SA HTKEM+D+ L VI EV+  +++N S+LP P W N
Sbjct:   19 FYECFEEISLKNAVLTYMSFLILNLLGRLQDFLRKHGILDNPAYKESELTKSFVPLYSDYEAFYTRNVYRRARDCWNRPICSPPGPEMVLMDRVSYDSCWTFQMTNTTSKVLNFGSYNYLGFAEPSGPCIDSDIKSIEKYGLGIASPRLEAGTLDIHLELENLVAEFVGQEAAIVFGMGFATNALNMPRVFDKNSCIISDELNHTSLILGCRLSGATVRRFKHNDMHDLEKCLKEAVVYGRPRSRRPFSRIFIIVEGIYSMEGSIAHMPEIIALKKKYKAYVYLDEAHSIGALGPSGRGIVDYFGIDPKDIDIAMGTFTKSFGSSGGYLAGSKRFIDYVRTESYSSIYGGTMPAPVCQQIITSMKIIMGRECPGEGERRLKQLAWNTRYFRAHLHQMGLIVFGNRDSPVIPLILYMPGKLIAFSRLCLERGLGVVVVGFPATALLASRCRFCISAGHTKEMLDKALAVIKEVADELHLNCSKLPPPYWSN 508          
BLAST of Serine palmitoyltransferase 2 vs. TrEMBL
Match: A0A068X116 (Serine palmitoyltransferase long chain base OS=Echinococcus granulosus OX=6210 GN=EgrG_000374100 PE=3 SV=1)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 302/488 (61.89%), Postives = 383/488 (78.48%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLPVPDW 1558
            F+E FE+    +AV+TY  +++LNL+GR++DFLR+     + AA     T SFVPLY DYEAFYTRN+YRR RDCWNRPICS PG  M L+DR+S D+ WTF+   TT+KV+NFGSYNYLGFA+ +G C +A   SI KYGLGV S R E G    H ELE+LVA F GQE+AIVF MGFATN+LN+P + +K  C+ISDELNHTSLILG RLSGA IRRFKHNDM +LE+ +  AV++G PR+RRPF +I ++VEGIYSMEGSI H+P+I+ LKKKY  ++Y+DEAHSIGALGP G+GV+DYF ++P DID+AMGTFTKSFGS+GGY+AG  RLI++VR  S+SSIYG  MPA  CQQI+TSM II G++C  EG +++KQL WN  YFRA LH+ G I+FGN+DSPV+P+I+  P KL AFSR CL RG+G V+VGFPAT ++ +R+RFC+SA HTKEM+D+ L+VI EV+  +++ +SRLP P W
Sbjct:   19 FYESFEEISLKNAVLTYMSFLILNLLGRLQDFLRKHGLLNDPAAKEKEVTRSFVPLYSDYEAFYTRNIYRRARDCWNRPICSTPGPEMVLMDRVSSDSCWTFEMTNTTTKVLNFGSYNYLGFAEPSGPCIEADVKSIEKYGLGVASSRLEVGTLAVHEELEKLVAEFVGQEAAIVFGMGFATNALNMPCIFDKNSCIISDELNHTSLILGCRLSGATIRRFKHNDMQDLERLLADAVVYGRPRSRRPFSRIFIIVEGIYSMEGSIAHMPEIIALKKKYKAYLYVDEAHSIGALGPRGRGVVDYFGLDPADIDIAMGTFTKSFGSAGGYLAGSARLIDYVRTQSYSSIYGGTMPAPVCQQIVTSMRIIMGRECPGEGERRLKQLAWNTRYFRAHLHQMGLIIFGNRDSPVIPIILYMPGKLVAFSRMCLERGLGVVIVGFPATGLLASRSRFCISAGHTKEMLDKALRVIAEVTDELHLRWSRLPPPYW 506          
BLAST of Serine palmitoyltransferase 2 vs. TrEMBL
Match: A0A4Z2DW01 (Serine palmitoyltransferase 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_004105 PE=3 SV=1)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 292/492 (59.35%), Postives = 382/492 (77.64%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLPVPDWCNNL 1570
            F+E FE+AP   AV+TY  +++LN++GR++DFLR ++  KN+A   P +T SFVPLY  YEAFYTRNLYRR++DCWNRPICS PG+ + ++DR S D  WT     TTSKV+N GSYNYLGF    G C DA E    K+G+GV S RQE G+   H ELE LVA F GQE+AIVF MGF+TNSLNLP LV+K+CCV+SDELNHTSL+LG RL+GA +RRFKHNDM +LE+ ++  V+FG PRT RP+KKILVVVEGIYSMEGSI+HLP+++ LKKKY  ++YLDEAHSIGALG  G+GV DYF ++P+DIDV+MGTFTKSFGS GGY+AG+++LI+++R  S++ +YG  M A   QQII++M I+ GK    EG +++K L  N+ YFRA LH+   IV+GN+DSPVVP+I+  P KLAAFSR CL  G+GTVVVGFPATT++L+R RFC+S+SHT+E++D+ L +ID+V+  + + YS+  +P+W   +
Sbjct:   13 FYESFEEAPLFTAVLTYMSFLILNILGRLQDFLRFFHVLKNHAVMEPSRTKSFVPLYSSYEAFYTRNLYRRVQDCWNRPICSAPGSEIVVMDRKSPDCGWTLNLTGTTSKVLNLGSYNYLGFGDPIGPCTDATEKMTRKFGVGVASSRQEAGSLVLHKELEDLVAEFVGQEAAIVFSMGFSTNSLNLPCLVDKECCVVSDELNHTSLVLGCRLTGATVRRFKHNDMDDLERVLQDCVVFGRPRTHRPYKKILVVVEGIYSMEGSILHLPEVIALKKKYKAYLYLDEAHSIGALGQMGRGVADYFGVDPRDIDVSMGTFTKSFGSCGGYLAGNQKLIDYLRSVSYNVVYGGSMSAPIAQQIISAMRIVMGKDVPCEGERRLKCLAENIRYFRARLHEMRLIVYGNRDSPVVPIIVYMPAKLAAFSRRCLELGLGTVVVGFPATTLLLSRVRFCISSSHTRELLDRALSIIDQVAEELGLRYSKQAIPEWAKEV 504          
BLAST of Serine palmitoyltransferase 2 vs. TrEMBL
Match: A0A5J4P3Y8 (Serine palmitoyltransferase OS=Paragonimus westermani OX=34504 GN=DEA37_0014113 PE=3 SV=1)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 291/492 (59.15%), Postives = 378/492 (76.83%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLPVPDWCNNL 1570
             FEQF + P   A+ TY  +++LNL+GR++DFLR  +       + P +T SFVPLY  YEAFYTRNLYRR++DCWNRPICS PG  M ++DR+S+DN WT +   T  +V+N GSYNYLGF   TG    A E +   +G+G+ S RQE GN   H ELE LVA F GQE AIVF MGFATNSLNLP LV++ CCV+SDELNHTSL+LG RLSGA IRRFKHNDM +LE+ +  AV++G PRT RP+KKIL+VVEG+YSMEGSIVHLP+++ LKKKY  ++YLDEAHSIGALGPHG+GV+DYFN+NP++ID++MGTFTKSFGS+GGY+AG KRLI+++R  SHS++YG  MPA   QQII++M +I G++   EG ++I+QL  N  YFRA LH    IV+GN+DSPVVP+II  P KL A SR+CL  G+GTV+VGFPAT+++L+R RFC+S+ HT+EM+D+ L ++++V++ +++    LPVPDW   L
Sbjct:   14 LFEQFAETPLSTAIFTYVGFMLLNLLGRLQDFLRWCHILHCPIVSEPKRTQSFVPLYSSYEAFYTRNLYRRVQDCWNRPICSSPGVEMVVMDRVSKDNGWTLEFTGTKRRVLNLGSYNYLGFGDPTGPSIKANERATRLFGVGIASSRQEVGNLILHRELEELVAEFVGQEDAIVFSMGFATNSLNLPCLVDQDCCVVSDELNHTSLVLGCRLSGAVIRRFKHNDMEDLERVLEDAVVYGRPRTHRPYKKILIVVEGVYSMEGSIVHLPEVIALKKKYKAYLYLDEAHSIGALGPHGRGVVDYFNLNPREIDISMGTFTKSFGSAGGYLAGSKRLIDYLRSCSHSAVYGGGMPAPVTQQIISAMRVIMGREVPGEGQRRIQQLAANTRYFRARLHAMRLIVYGNRDSPVVPVIISMPAKLVALSRKCLDLGLGTVIVGFPATSLLLSRVRFCISSMHTREMLDKALTILEQVTSELHLRNCELPVPDWAQLL 505          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Cavefish
Match: sptlc2a (serine palmitoyltransferase, long chain base subunit 2a [Source:ZFIN;Acc:ZDB-GENE-050522-23])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 286/491 (58.25%), Postives = 359/491 (73.12%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR---LPVPD 1555
            F+E FE+ P L AV+TY  Y +L + G +RDF+R+W  EK + A    +   FVPLYQD+E FYTRNLY RIRD WNRPICSVPG  M LV+R+S D NWTF +  +    VIN GSYNYLGFA+NTG+CA+A      KYG+GV S RQE GN   H E+E+LVA F G ESA+ F MGFATNS+N+P L  K C ++SDELNH SL+LG RLSG+ IR FKHN+M +LEK +R A++ G PRT RP+KKIL++VEGIYSMEGSI+ LP+++ LKKKY  ++YLDEAHSIGALGP G+GV++YF ++P D+D+ MGTFTKSFG++GGYI G K LI+++R +SHS++Y   M     +QIITSM  I G+     G ++++QL  N  YFR  L + GFI++GN DSPVVPL++  P K+ AF RE L R IG VVVGFPAT II +RARFCVSASHTKEM+DQ L  I EV  L+ + YSR   LP  D
Sbjct:  130 FYESFEETPMLVAVLTYMGYGILTIFGYLRDFMRQWKIEKCHIAREREEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPICSVPGDKMDLVERVSYDYNWTFGYTGRVVKDVINMGSYNYLGFAENTGSCAEAAAEVTVKYGVGVSSTRQEMGNLDRHEEMEKLVARFLGVESAMAFGMGFATNSMNIPALTGKGCLILSDELNHASLVLGARLSGSTIRVFKHNNMQSLEKLLRDAIVHGQPRTHRPWKKILILVEGIYSMEGSIIRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVEYFGLDPTDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRSHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTIGRERVQQLAENTVYFRRRLREIGFIIYGNNDSPVVPLMLYLPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCVSASHTKEMLDQALNAISEVGDLLQVKYSRHRILPALD 620          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Cavefish
Match: sptlc2a (serine palmitoyltransferase, long chain base subunit 2a [Source:ZFIN;Acc:ZDB-GENE-050522-23])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 286/491 (58.25%), Postives = 359/491 (73.12%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR---LPVPD 1555
            F+E FE+ P L AV+TY  Y +L + G +RDF+R+W  EK + A    +   FVPLYQD+E FYTRNLY RIRD WNRPICSVPG  M LV+R+S D NWTF +  +    VIN GSYNYLGFA+NTG+CA+A      KYG+GV S RQE GN   H E+E+LVA F G ESA+ F MGFATNS+N+P L  K C ++SDELNH SL+LG RLSG+ IR FKHN+M +LEK +R A++ G PRT RP+KKIL++VEGIYSMEGSI+ LP+++ LKKKY  ++YLDEAHSIGALGP G+GV++YF ++P D+D+ MGTFTKSFG++GGYI G K LI+++R +SHS++Y   M     +QIITSM  I G+     G ++++QL  N  YFR  L + GFI++GN DSPVVPL++  P K+ AF RE L R IG VVVGFPAT II +RARFCVSASHTKEM+DQ L  I EV  L+ + YSR   LP  D
Sbjct:  151 FYESFEETPMLVAVLTYMGYGILTIFGYLRDFMRQWKIEKCHIAREREEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPICSVPGDKMDLVERVSYDYNWTFGYTGRVVKDVINMGSYNYLGFAENTGSCAEAAAEVTVKYGVGVSSTRQEMGNLDRHEEMEKLVARFLGVESAMAFGMGFATNSMNIPALTGKGCLILSDELNHASLVLGARLSGSTIRVFKHNNMQSLEKLLRDAIVHGQPRTHRPWKKILILVEGIYSMEGSIIRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVEYFGLDPTDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRSHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTIGRERVQQLAENTVYFRRRLREIGFIIYGNNDSPVVPLMLYLPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCVSASHTKEMLDQALNAISEVGDLLQVKYSRHRILPALD 641          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Cavefish
Match: sptlc2a (serine palmitoyltransferase, long chain base subunit 2a [Source:ZFIN;Acc:ZDB-GENE-050522-23])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 286/491 (58.25%), Postives = 359/491 (73.12%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR---LPVPD 1555
            F+E FE+ P L AV+TY  Y +L + G +RDF+R+W  EK + A    +   FVPLYQD+E FYTRNLY RIRD WNRPICSVPG  M LV+R+S D NWTF +  +    VIN GSYNYLGFA+NTG+CA+A      KYG+GV S RQE GN   H E+E+LVA F G ESA+ F MGFATNS+N+P L  K C ++SDELNH SL+LG RLSG+ IR FKHN+M +LEK +R A++ G PRT RP+KKIL++VEGIYSMEGSI+ LP+++ LKKKY  ++YLDEAHSIGALGP G+GV++YF ++P D+D+ MGTFTKSFG++GGYI G K LI+++R +SHS++Y   M     +QIITSM  I G+     G ++++QL  N  YFR  L + GFI++GN DSPVVPL++  P K+ AF RE L R IG VVVGFPAT II +RARFCVSASHTKEM+DQ L  I EV  L+ + YSR   LP  D
Sbjct:  151 FYESFEETPMLVAVLTYMGYGILTIFGYLRDFMRQWKIEKCHIAREREEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPICSVPGDKMDLVERVSYDYNWTFGYTGRVVKDVINMGSYNYLGFAENTGSCAEAAAEVTVKYGVGVSSTRQEMGNLDRHEEMEKLVARFLGVESAMAFGMGFATNSMNIPALTGKGCLILSDELNHASLVLGARLSGSTIRVFKHNNMQSLEKLLRDAIVHGQPRTHRPWKKILILVEGIYSMEGSIIRLPEVIALKKKYKAYLYLDEAHSIGALGPSGRGVVEYFGLDPTDVDIMMGTFTKSFGAAGGYIGGKKELIDYLRSHSHSAVYATSMSPPVVEQIITSMKCIMGEDGTTIGRERVQQLAENTVYFRRRLREIGFIIYGNNDSPVVPLMLYLPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCVSASHTKEMLDQALNAISEVGDLLQVKYSRHRILPALD 641          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Cavefish
Match: gcat (glycine C-acetyltransferase [Source:NCBI gene;Acc:103043864])

HSP 1 Score: 149.828 bits (377), Expect = 7.268e-39
Identity = 101/360 (28.06%), Postives = 181/360 (50.28%), Query Frame = 2
Query:  413 TTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTL 1492
            +++ ++NF + NYLG + +       +E ++ KYG G+ S R  CG    H +LE+ +A F  +E  I++   F  N+    +L+  +  V+SDELNH S+I GIRL  A   R+KH D+++LE +++++      R R      LVV +G++SM+G +  L  I +L ++Y   +++DE H+ G LG  G+G  +   +  +   V         G++GGY  G K LI+ +R+ S   ++   +P      + ++   +E     NE     + +      FR  + + GF + G    P+ P+++      +  + + L  G+  +   +P      AR R  +SA+HT   ID+T+
Sbjct:   74 SSADILNFCANNYLGLSSHPEVIQAGIE-ALQKYGAGLSSVRFICGTQDLHKKLEQKLAQFHEREDCILYASCFDANAGLFEVLLGPEDAVLSDELNHASIIDGIRLCRAKRLRYKHMDLNDLEDKLKES---QSSRLR------LVVTDGVFSMDGDVAPLVGICDLAEQYGALVFIDECHATGFLGIRGRGTDELLGVMDRVHIVNSTLGKALGGAAGGYTVGPKPLIDLLRQRSRPYLFSNSLPPPV---VGSATRAVELLLASNE---IAQSMAAKTMRFRNGMTQAGFTIAGAA-HPICPVMLGDARLASLMADDMLKLGVYVIGFSYPVVPKGKARIRVQISAAHTDSDIDRTV 416          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Cavefish
Match: sptlc1 (serine palmitoyltransferase, long chain base subunit 1 [Source:ZFIN;Acc:ZDB-GENE-050522-61])

HSP 1 Score: 147.517 bits (371), Expect = 1.197e-37
Identity = 90/259 (34.75%), Postives = 140/259 (54.05%), Query Frame = 2
Query:  428 INFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGH--PRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIE 1198
            INFGS+N+LG   N      A+  S+ KYG+G   PR   G    H ELE  +A F   E AI++  GFAT +  +P    +   V  DE +  S+  G++ S + I+ FKHNDM +LE+ +++  +     PR  R  ++  +VVEG+Y     I  LP++V+LK KY   I+L+E+ S G LG HG+GV ++F +N  DID+       +  S GG+  G   +I+  R +     + A +P +     I +++I+E
Sbjct:  112 INFGSFNFLGLLDNERVKQKAL-ASLRKYGVGTCGPRGFYGTFDVHLELEERLAKFMRTEEAIIYSYGFATIASAIPAYSKRGDIVFVDEASCFSIQKGLQASRSFIKYFKHNDMEDLERLLKEQELEDQKNPRKARVTRR-FIVVEGLYMNTADICPLPELVKLKYKYKVRIFLEESMSFGVLGEHGRGVTEHFGVNIDDIDLISANMENAVASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPMLASAAIEALNIME 368          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Sea Lamprey
Match: sptlc2a (serine palmitoyltransferase, long chain base subunit 2a [Source:ZFIN;Acc:ZDB-GENE-050522-23])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 273/482 (56.64%), Postives = 350/482 (72.61%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            F E FE+ P L AV+TY  Y VL L G +RDF R W  E    AT   +   FVPLYQD+E FYTRNLY RIRD WNRPICSVPG+  ++++R+++D NW F+       VIN GSYNYLGFA+N G C +A      KYG+GV S RQE GN   H ELE+LVA F G E+A+ F MGFATNS+N+P LV K C ++SDELNH SL+LG RLS A IR FKHNDM NLEK +R A++ G PRT RP+KKIL++VEGIYSMEGSIV LP++V LKK+Y  ++YLDEAHSIGA+GP G+GV++YF ++P+D+DV MGTFTKSFG+ GGYI G K L++++R NSHS++Y   M     +QI+ SM  I G+     G ++I+QL  N  YFR  + + GFI +GN+DSPVVP+++  P K+ AF RE + R IG VVVGFPAT II +RARFC+SA+HT+EM+D+TL  +DE+  ++ + YSR
Sbjct:    7 FRETFEETPMLVAVLTYMGYGVLTLFGYLRDFFRAWGIESCQNATEREEQKDFVPLYQDFENFYTRNLYMRIRDNWNRPICSVPGSRFKVMERVTDDYNWNFRFTGRVKDVINMGSYNYLGFAENVGPCTEAAAQVAQKYGVGVCSTRQEMGNLDKHEELEKLVARFLGVEAAMAFGMGFATNSMNIPALVGKGCLILSDELNHASLVLGARLSTATIRVFKHNDMVNLEKLLRDAIVNGQPRTHRPWKKILILVEGIYSMEGSIVRLPEVVALKKRYKAYLYLDEAHSIGAVGPTGRGVVEYFGLHPQDVDVLMGTFTKSFGACGGYIGGRKDLVDYLRMNSHSAVYATSMSPPIIEQILQSMKCIMGEDGTTLGAQRIRQLAENTRYFRRRIREMGFITYGNEDSPVVPVMLYMPAKIGAFGREMMKRNIGVVVVGFPATPIIESRARFCISAAHTREMLDETLAAVDEIGDILQLKYSR 488          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Sea Lamprey
Match: sptlc1 (serine palmitoyltransferase, long chain base subunit 1 [Source:ZFIN;Acc:ZDB-GENE-050522-61])

HSP 1 Score: 122.865 bits (307), Expect = 5.317e-30
Identity = 95/324 (29.32%), Postives = 163/324 (50.31%), Query Frame = 2
Query:  428 INFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIF--GHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGN---EGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSR 1384
            IN  S+N+LG   N      A+E S++KYG+G   PR   G    H ELE  +A F   E AI++  GF+T +  +P    +   +   +    ++  G++ S ++++ F+HND+++LE+ +++       +P+     ++ LVV EG+Y+  G +  LP +V LK +Y   I+L+E+ S G LG  G+GV ++F +N  DID+       +  S GG+  G   +I+  R +     + A +P +     + ++SI+E  +C +   E  K+ K      H  RA     G ++ G   SP V L +  P++     R  L R
Sbjct:  102 INLASFNFLGLLSNKRVKKVALE-SLAKYGVGTCGPRGFYGTFDVHLELEEQIARFMRCEEAIIYAYGFSTIASAIPAYSKRGDIIYVSKAVCFAIQKGLQASRSNVKYFRHNDVADLERLLQQQQQEDRKNPKKASVVRRFLVV-EGLYTNTGDVCPLPDLVRLKYQYKVRIFLEESLSFGVLGETGRGVTEHFGVNIDDIDLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAMEALSIVE--ECPDIFGELRKRSK------HMHRALQDVPGLLLCGESLSPAVHLRLAEPSRSRDKDRRTLQR 415          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Sea Lamprey
Match: alas2 (aminolevulinate, delta-, synthase 2 [Source:NCBI gene;Acc:64607])

HSP 1 Score: 113.62 bits (283), Expect = 3.519e-28
Identity = 86/303 (28.38%), Postives = 151/303 (49.83%), Query Frame = 2
Query:  500 SISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNL-------PILVN-KQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSR 1384
            ++  +G G G  R   G    H ELE+ +A+  G+++A++F   F  N   L       P+L + K C + SD  NH S+I+GIR S      F+HND ++LE+ ++++          P    +V  E ++SM+G++  L ++ ++  KY    ++DE H++G  G +G G+ D  N+  K +D+  GT  K+FG  GGY+A    LI+ VR  +   I+   +P +     + S+ ++       EG    +  + NV Y R  L   G  V  +  S ++P+++    K    S E +++
Sbjct:    3 TLKMHGAGAGGTRNISGTSRFHVELEKELASLHGKDAALLFTSCFVANDSTLFTLAKMLPVLPHVKGCEIYSDAGNHASMIMGIRNSHVPKFVFRHNDPAHLEEVLKRS---------DPSTPKIVAFETVHSMDGAVCPLEEMCDIAHKYGAITFVDEVHAVGLYGTNGGGIGDRDNVMHK-MDIITGTLGKAFGCVGGYVASTASLIDTVRSYAAGFIFTTALPPMVLAGALESVRVLRSA----EGQALRRSHQRNVKYMRQLLMDAGLPVI-HCPSHIIPVLVANAAKNTEISNELMAQ 290          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Yeast
Match: LCB2 (Component of serine palmitoyltransferase; responsible along with Lcb1p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine [Source:SGD;Acc:S000002469])

HSP 1 Score: 428.328 bits (1100), Expect = 1.620e-143
Identity = 217/473 (45.88%), Postives = 315/473 (66.60%), Query Frame = 2
Query:  110 EDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALINI 1528
            +  PY  +++TY  Y++L ++G + DFL    F+KN      L+     P + ++E+FY R +  RI DC++RP   VPG  ++ +DRIS + N  F +       +N  SYNYLGFAQ+ G C DA   S+ KY +  G PR + G    H + E+LVA F G+E A+VF MG+ TN+      ++K+C VISDELNHTS+  G+RLSGA +R FKH DM  LEK IR+ ++ G P+T RP+KKIL+  EG++SMEG++ +LP++VELKKKY  ++++DEAHSIGA+GP G+GV + F ++PKD+D+ MGTFTKSFG++GGYIA D+ +I+ +R +  +  Y   MPA    Q I+S+  I G+ C  +G ++++++ +N  Y R AL + GFIV+G  DSPV+PL++  P+K+ AFSR  L R I  VVV +PAT +I +R RFC+SAS TKE ID  L+ + EV   +N+
Sbjct:   54 DTPPYYISLLTYLNYLILIILGHVHDFLG-MTFQKNKHLDL-LEHDGLAPWFSNFESFYVRRIKMRIDDCFSRPTTGVPGRFIRCIDRISHNINEYFTYSGAVYPCMNLSSYNYLGFAQSKGQCTDAALESVDKYSIQSGGPRAQIGTTDLHIKAEKLVARFIGKEDALVFSMGYGTNANLFNAFLDKKCLVISDELNHTSIRTGVRLSGAAVRTFKHGDMVGLEKLIREQIVLGQPKTNRPWKKILICAEGLFSMEGTLCNLPKLVELKKKYKCYLFIDEAHSIGAMGPTGRGVCEIFGVDPKDVDILMGTFTKSFGAAGGYIAADQWIIDRLRLDLTTVSYSESMPAPVLAQTISSLQTISGEICPGQGTERLQRIAFNSRYLRLALQRLGFIVYGVADSPVIPLLLYCPSKMPAFSRMMLQRRIAVVVVAYPATPLIESRVRFCMSASLTKEDIDYLLRHVSEVGDKLNL 524          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Yeast
Match: HEM1 (5-aminolevulinate synthase; catalyzes the first step in the heme biosynthetic pathway; an N-terminal signal sequence is required for localization to the mitochondrial matrix; expression is regulated by Hap2p-Hap3p; has a pyridoxal phosphate cofactor whose insertion is mediated by Mcx1p [Source:SGD;Acc:S000002640])

HSP 1 Score: 131.724 bits (330), Expect = 6.466e-33
Identity = 118/409 (28.85%), Postives = 190/409 (46.45%), Query Frame = 2
Query:  410 KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNK--QCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNI---------NPKD------------IDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECL--SRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLP-VPDW 1558
            +   KV  + S +YL  +++     DA+  +I KYG G G  R   G++     LE  +AT   +E A+VF   +  N   L +L  K     + SDELNH S+I+GI+ +      FKHND++ LE+ ++      +P++       L+  E +YSM GS+  + +I +L  KY    +LDE H++G  GPHG GV ++ +           PK             +D+  GT  KSFGS GGY+A  ++LI++ R  +   I+   +P      +  + + I  ++C    I      + +  Y + A H+ G  V  N  S +VP++I     LA  + + L     I    + FP       R R   +  HT ++ D  +  +D+V      N  +LP V DW
Sbjct:  110 READKVTVWCSNDYLALSKHP-EVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKMKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLLQS-----YPKSVPK----LIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHCDFESHRASGIATPKTNDKGGAKTVMDRVDMITGTLGKSFGSVGGYVAASRKLIDWFRSFAPGFIFTTTLPPSV---MAGATAAIRYQRC---HIDLRTSQQKHTMYVKKAFHELGIPVIPNP-SHIVPVLIGN-ADLAKQASDILINKHQIYVQAINFPTVARGTERLRITPTPGHTNDLSDILINAVDDV-----FNELQLPRVRDW 495          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Yeast
Match: LCB1 (Component of serine palmitoyltransferase; responsible along with Lcb2p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine [Source:SGD;Acc:S000004911])

HSP 1 Score: 112.464 bits (280), Expect = 1.626e-26
Identity = 76/282 (26.95%), Postives = 144/282 (51.06%), Query Frame = 2
Query:  419 SKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNIN-PKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMS-IIEGKQCGNEGIKKIKQLEWNVH 1258
            + V N  S N+L  +  T    + V+ +I  YG+G   P    GN   H  LE  +A F G + ++++   F      LP    +   +++D+     +   ++LS + +  F HNDM++LE  + +              +  +V EGI+   G +  LP++ +LK KY F +++DE  SIG LG  G+G+ ++FN++    ID+ +G+   + GS+GG++ GD  +    R  S++  + A +PA      +TS+S +++     N+ ++ +++L  ++H
Sbjct:  145 TNVFNLASNNFLQLSA-TEPVKEVVKTTIKNYGVGACGPAGFYGNQDVHYTLEYDLAQFFGTQGSVLYGQDFCAAPSVLPAFTKRGDVIVADDQVSLPVQNALQLSRSTVYYFNHNDMNSLECLLNELTEQEKLEKLPAIPRKFIVTEGIFHNSGDLAPLPELTKLKNKYKFRLFVDETFSIGVLGATGRGLSEHFNMDRATAIDITVGSMATALGSTGGFVLGDSVMCLHQRIGSNAYCFSACLPAYT----VTSVSKVLKLMDSNNDAVQTLQKLSKSLH 421          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Nematostella
Match: EDO42990 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZR1])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 282/501 (56.29%), Postives = 360/501 (71.86%), Query Frame = 2
Query:   38 NAKPHRNGYVVIKKTNEHIFFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            N  PH+       K  E  F E+FE+ P + AV+TY  Y VL + G MRDF+R+   EK+  A        FVPLY D+E+FYTRNLY RIRDCWNRPICSVPGA ++LVDR+S+D  WTF    T +K +N GSYNYLGFA+N G CAD  E S+ K G+ V S R E G    H ELE++VA F G+ESA+VF MGFATNS N+P+LV+K   +ISDELNH+SL+LG RLSGA I+ FKHND+ +LE ++R +V+ G PRT RP++KIL++VEG+YSMEGS+V LP+IV +KKKY  ++YLDEAHSIGA+GP G+GV +YF +NP DID+ MGTFTKSFG++GGYIA  K +I  +R  SHS+ Y + M      QI TSM II G+   N G ++I+ L  N  YFR  L + GFI++G+ +SPVVPL++  P K+AAF RE L R IG VVVGFPAT II +RARFC+SA+HT+EM+DQ L  IDEV  ++ + YSR
Sbjct:   31 NGIPHKG-----SKVKE--FHEEFEETPLIVAVLTYIGYFVLVVFGYMRDFMRKHGLEKSKTAKEK-GNKGFVPLYADFESFYTRNLYTRIRDCWNRPICSVPGAQIELVDRVSDDYGWTFNFTGTKTKALNLGSYNYLGFAENEGLCADEAEKSVHKNGIAVCSARHEFGTLDIHIELEKMVARFVGKESAMVFGMGFATNSTNIPVLVSKGDLIISDELNHSSLVLGARLSGATIKVFKHNDIKSLENKLRTSVVQGQPRTHRPWRKILIIVEGVYSMEGSLVRLPEIVAIKKKYKAYLYLDEAHSIGAVGPTGRGVSEYFGVNPADIDIMMGTFTKSFGAAGGYIASSKEIINHIRGCSHSAAYASSMSPPVTLQIYTSMKIILGEDGTNLGKQRIQALAENTRYFRCRLKELGFIIYGHDESPVVPLLLYMPAKIAAFGREMLKRKIGVVVVGFPATPIIESRARFCLSAAHTREMLDQALAAIDEVGDILQLKYSR 523          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Nematostella
Match: EDO27220 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9V2])

HSP 1 Score: 185.652 bits (470), Expect = 1.558e-52
Identity = 117/374 (31.28%), Postives = 188/374 (50.27%), Query Frame = 2
Query:  407 LKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALINI 1528
            L     V+NF + NYLG + +      A ++++  +G G+ S R  CG    H ELE+ VA F G E  I++   F  N      L+ +Q C+ISD LNH S+I G+RL  A   R+++NDM++LE Q+ KA   GH      FK  L+V +G++SM+G +  L +I +L  KY   + +DE H+ G +G  GKG ++  N+  +   +         G+ GGY    K +IE +R+ S   ++   +        +    ++E      +      +LEWN +YF+  + K GF +  + D+ +VP+++         + E L +GI  +   FP      AR R  +SA+HTKE +D  +K   EV   + I
Sbjct:   31 LAVGETVLNFCANNYLGLSSHP-EVVQAAKDALDSHGFGMSSVRFICGTQDIHKELEQKVAQFYGTEDTILYAAAFDANGGVFEPLLGEQDCIISDSLNHASIIDGVRLCKAARYRYQNNDMNDLEAQLIKATEAGH-----RFK--LIVTDGVFSMDGLVAPLDKICDLADKYEAMVMVDECHAAGFIGATGKGTLEAKNVMGRVDIITGTFGKALGGAMGGYTTAKKEIIEILRQRSRPYLFSNSLAPSIVGASLKVFELLEKDTSLRD------KLEWNTNYFKEGMKKAGFDII-DGDAAIVPVMLYDAKLSQTMAEELLKKGIYVIGFFFPVVPKEKARIRVQLSAAHTKEHLDIAIKAFVEVGKSLKI 389          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Nematostella
Match: EDO38490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCT4])

HSP 1 Score: 167.933 bits (424), Expect = 5.675e-46
Identity = 117/403 (29.03%), Postives = 198/403 (49.13%), Query Frame = 2
Query:  308 IRDCWNRPICSVPGATMQLVDR-ISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDS-PVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEV 1510
            +R   +  I S+  A +   +R I+       K     SK++NF + NYLG + N     +A + ++ KYG G+ S R  CG    H  LE  ++ F G E AI++   +  N+     L+  +  V SDELNH S+I GIRL  A   ++KH D+ +LE+++++A      R +      L+  +G++SM+GS+  LP+I +L  KY   +++DE H+ G LG  G+G  +Y     +   +         G++GGY  G  +L++ +R+ S   +Y   +P          + ++       +G +  K+L  N  YFR  + + GF + G  +  P+ P+++        F+ E L RGI  V + +P       R R  +SA H+KE ID  ++   +V
Sbjct:   18 LRKILDDDIASIKNAGLWKRERVITTPQASQIKVEGRESKILNFCANNYLGLSSNA-EVVNAAKEALMKYGNGLSSVRFICGTQDIHKTLEAKISKFHGMEDAILYACCYDANTGLFESLLTAEDAVFSDELNHASMIDGIRLCRAKKFKYKHIDVQDLEEKLKEA---DGARIK------LIASDGVFSMDGSMAPLPEICDLADKYGALVFIDECHATGFLGDTGRGTDEYTGTRGRVDIINSTLGKALGGAAGGYTTGPSQLVQMLRQKSRPYLYSNTLPPAVVGSATKVLDMLM------DGSELSKKLADNTSYFRTKMTQAGFNIKGGANGHPITPIMLGDSKLAMDFANEMLERGIYVVGIVYPTVPRGTGRIRVQLSAGHSKEEIDTCVQTFIDV 404          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Nematostella
Match: EDO46206 (5-aminolevulinate synthase [Source:UniProtKB/TrEMBL;Acc:A7RQQ4])

HSP 1 Score: 119.013 bits (297), Expect = 2.712e-28
Identity = 114/422 (27.01%), Postives = 192/422 (45.50%), Query Frame = 2
Query:  269 DYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVIN-----FGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNK--QCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSR-GIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEV 1510
            +YE F+   + ++  D   R          + V+R+++     F H +  S   N     + S +YLG +++      A E +I  +G+G G  R   G  + H +LE+++A    +E+A++F   +  N   L  L      C + SD  NH S+I GIR SGA    F+HND  +L K +  A               +V  E ++SM G I  + Q+ ++  KY    ++DE H++G  G HG GV +   +   D+D+  GT  K+FG  GGYIAG   LI+ +R      I+   +P +  +  I S+ I+     G+EG    +  +  V   R  L ++G  V     S ++P+ +    K    S + +S+  I    + +P       R R   +  HT+ M++    V+ +V
Sbjct:   97 EYEKFFEGEIQKKKADDTYR--------VFKKVNRLAK----AFPHAQEFSGAANKDISVWCSNDYLGMSRHPEVLKVARE-TIDVHGVGAGGTRNISGTSSYHEQLEKVLAQLHQKEAALLFTSCYVANDTTLYTLGKHLPGCLIFSDAGNHASMIQGIRNSGAKKFIFRHNDPEHLGKLLAAADPA---------APKIVAFETVHSMTGDISPIKQLCDVAHKYGALTFVDEVHAVGLYGHHGGGVGERDGL-LADMDIISGTLGKAFGVIGGYIAGTASLIDTIRSYGAGFIFTTALPPITVKSAIKSIEILS----GDEGRDLRRVHQSVVARLRNKLVQRGLPVV-YAPSHIIPIHVGDAGKCTQVSNDLMSKHNIYAQAINYPTVAKGEERLRIAPTPMHTEPMMEHFADVLTQV 490          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Nematostella
Match: EDO36082 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJP9])

HSP 1 Score: 112.079 bits (279), Expect = 3.106e-26
Identity = 89/307 (28.99%), Postives = 157/307 (51.14%), Query Frame = 2
Query:  428 INFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKK-----ILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHK-KGFIVFGNKDSPVVPL 1330
            +N  ++N+LGF  N    + A+ +++ KYG+G   PR   G+   H  LE  +A F   E AI++  GF+T +  +P    +   +  D+    ++  G+  S + +  F+HNDM +LE+ +++       + R+  KK       ++VEG+Y   G+I  LP+++ELKKKY   I +DE+ S G LG  G+GV +Y++I   D+D+   +   S  + GG+  G   +++  R +     + A +P +     I ++ I+E K    +G+     L+     F   L   KG  + G +DSP++ L
Sbjct:   96 LNLATFNFLGFVGNPRIESSAI-DTLRKYGVGSCGPRGFYGSIDVHLHLEERLAKFMHTEEAILYSYGFSTVASAIPAYSKRGDVLFCDKGVCFAIQQGVTASRSRVMWFEHNDMDDLERLLKEQ----QEKDRKNPKKGSVTRRFLIVEGLYINHGTIAPLPKLLELKKKYKVRILVDESCSFGVLGKTGRGVTEYYDIPVDDVDLISVSMENSLATIGGFCCGTSFVVDHQRLSGAGYCFSASLPPMLATAAIEALDIMEEK----DGM--FNDLQMKARLFHQELKGIKGLRIDGERDSPIIHL 391          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Medaka
Match: sptlc2b (serine palmitoyltransferase 2 [Source:NCBI gene;Acc:101165525])

HSP 1 Score: 580.867 bits (1496), Expect = 0.000e+0
Identity = 289/493 (58.62%), Postives = 359/493 (72.82%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR----LPVPDW 1558
            F E FE+ P L AV+TY  Y +L + G  RDFLR WN EK + A    +   FVPLYQD+E FYTRNLY RIRD WNRPICSVPGA + LV+R++ + NWTF+H  K    VIN GSYNYLGFA+NTGACA A   +   YG+GV S R E GN   H ELE+LVA F G ES++ F MGFATNS+N+P L  K C ++SDELNH SL+LG RLSG+ IR FKHN+M +LEK +R A+  G PRT RP+KKIL+VVEGIYSMEGSIV LP+++ LKK+Y  ++YLDEAHSIGALGP+G+GV+DYF ++PKD+D+ MGTFTKSFG++GGYI G K LI+++R +SHS++Y   M     QQII+SM II G+     G  +++QL  N  YFR  L + GFI++GN DSPVVPL++  P K+ AF RE L R IGTVVVGFPAT II +RARFCVSA+HT+EM+D  L+ I EV  L+ + YSR    L  P W
Sbjct:   63 FSESFEETPLLVAVLTYMGYGILTIFGYFRDFLRHWNIEKCHIAHEREQQKDFVPLYQDFENFYTRNLYMRIRDNWNRPICSVPGAKVDLVERVTHNYNWTFEHTGKVVKDVINMGSYNYLGFAENTGACASAAIETTHAYGVGVASTRCEIGNLDIHEELEQLVARFLGVESSMAFGMGFATNSMNIPPLTGKGCLILSDELNHASLVLGARLSGSTIRVFKHNNMQSLEKLLRDAIAHGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEVIALKKRYKAYLYLDEAHSIGALGPNGRGVVDYFGLDPKDVDIMMGTFTKSFGAAGGYIGGRKELIDYLRCHSHSALYATSMSPPVAQQIISSMKIIMGEDGSTLGKDRLRQLSENTTYFRRKLREMGFIIYGNDDSPVVPLMLYMPAKIGAFGREMLKRNIGTVVVGFPATPIIESRARFCVSAAHTREMLDTALRAISEVGDLLQLKYSRRERPLSTPGW 555          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Medaka
Match: ENSORLT00000042858.1 (serine palmitoyltransferase 2-like [Source:NCBI gene;Acc:101156930])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 276/483 (57.14%), Postives = 358/483 (74.12%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKH-LKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            F E FE+ P L AV+T   Y++L + G +RD LR W  E+ + A    +   FVPLY+D++ FYTRNLY RIRD WNRPICSVPGA M L+DR S D NWTF++  +T   VIN GSYNYLGFA+NTG CAD+    +  YG+GV S RQE GN   H E+E+ VA F G ESA+ F MGFATNS+N+P LV K C ++SDELNHTSL+LG RLSGA IR FKHN+M  LEK + +A+I+G PRT RP+KKIL+VVEGIYSMEGSIV LP+++ LKK+Y  ++YLDEAHSIGALG  G+GV+DYF+++P+D+DV MGTFTKSFG++GGYIAG + LIE++R +SHS++Y A M     +QIITSM  I G    + G K+++QL  N  YFR  L + GFI++GN DSPV+P+++  P K+ AF RE L + IG VVVGFPAT+++ +RARFC+SA+H+KE++D  L  I EV  ++ + YSR
Sbjct:   70 FTESFEETPMLVAVLTNVGYVILIIFGYLRDLLRHWKIEQRHIAREKEEQKDFVPLYRDFQNFYTRNLYMRIRDNWNRPICSVPGAKMDLMDRTSHDYNWTFEYNGRTMKDVINLGSYNYLGFAENTGPCADSAAQVVRTYGIGVASTRQEIGNLDKHEEMEKQVAKFLGVESAMAFGMGFATNSMNIPALVGKGCLILSDELNHTSLVLGARLSGATIRVFKHNNMQCLEKLLSEAIIYGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEVITLKKRYKAYLYLDEAHSIGALGHRGRGVVDYFDLDPRDVDVLMGTFTKSFGAAGGYIAGKRELIEYLRSHSHSAVYAASMSPPVVEQIITSMKCIMGDDGTSIGCKRLQQLAENTTYFRRRLREMGFIIYGNDDSPVIPMMLYMPAKIGAFGREMLKKNIGVVVVGFPATSLVESRARFCISAAHSKEILDTALSAISEVGDVLQLKYSR 552          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Medaka
Match: ENSORLT00000022091.2 (serine palmitoyltransferase 2-like [Source:NCBI gene;Acc:101156930])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 276/483 (57.14%), Postives = 358/483 (74.12%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKH-LKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSR 1540
            F E FE+ P L AV+T   Y++L + G +RD LR W  E+ + A    +   FVPLY+D++ FYTRNLY RIRD WNRPICSVPGA M L+DR S D NWTF++  +T   VIN GSYNYLGFA+NTG CAD+    +  YG+GV S RQE GN   H E+E+ VA F G ESA+ F MGFATNS+N+P LV K C ++SDELNHTSL+LG RLSGA IR FKHN+M  LEK + +A+I+G PRT RP+KKIL+VVEGIYSMEGSIV LP+++ LKK+Y  ++YLDEAHSIGALG  G+GV+DYF+++P+D+DV MGTFTKSFG++GGYIAG + LIE++R +SHS++Y A M     +QIITSM  I G    + G K+++QL  N  YFR  L + GFI++GN DSPV+P+++  P K+ AF RE L + IG VVVGFPAT+++ +RARFC+SA+H+KE++D  L  I EV  ++ + YSR
Sbjct:   22 FTESFEETPMLVAVLTNVGYVILIIFGYLRDLLRHWKIEQRHIAREKEEQKDFVPLYRDFQNFYTRNLYMRIRDNWNRPICSVPGAKMDLMDRTSHDYNWTFEYNGRTMKDVINLGSYNYLGFAENTGPCADSAAQVVRTYGIGVASTRQEIGNLDKHEEMEKQVAKFLGVESAMAFGMGFATNSMNIPALVGKGCLILSDELNHTSLVLGARLSGATIRVFKHNNMQCLEKLLSEAIIYGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEVITLKKRYKAYLYLDEAHSIGALGHRGRGVVDYFDLDPRDVDVLMGTFTKSFGAAGGYIAGKRELIEYLRSHSHSAVYAASMSPPVVEQIITSMKCIMGDDGTSIGCKRLQQLAENTTYFRRRLREMGFIIYGNDDSPVIPMMLYMPAKIGAFGREMLKKNIGVVVVGFPATSLVESRARFCISAAHSKEILDTALSAISEVGDVLQLKYSR 504          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Medaka
Match: ENSORLT00000013273.2 (serine palmitoyltransferase 2-like [Source:NCBI gene;Acc:101156930])

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 269/464 (57.97%), Postives = 348/464 (75.00%), Query Frame = 2
Query:   95 FFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKH-LKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMID 1483
            F E FE+ P L AV+T   Y++L + G +RD LR W  E+ + A    +   FVPLY+D++ FYTRNLY RIRD WNRPICSVPGA M L+DR S D NWTF++  +T   VIN GSYNYLGFA+NTG CAD+    +  YG+GV S RQE GN   H E+E+ VA F G ESA+ F MGFATNS+N+P LV K C ++SDELNHTSL+LG RLSGA IR FKHN+M  LEK + +A+I+G PRT RP+KKIL+VVEGIYSMEGSIV LP+++ LKK+Y  ++YLDEAHSIGALG  G+GV+DYF+++P+D+DV MGTFTKSFG++GGYIAG + LIE++R +SHS++Y A M     +QIITSM  I G    + G K+++QL  N  YFR  L + GFI++GN DSPV+P+++  P K+ AF RE L + IG VVVGFPAT+++ +RARFC+SA+H+KE++D
Sbjct:   70 FTESFEETPMLVAVLTNVGYVILIIFGYLRDLLRHWKIEQRHIAREKEEQKDFVPLYRDFQNFYTRNLYMRIRDNWNRPICSVPGAKMDLMDRTSHDYNWTFEYNGRTMKDVINLGSYNYLGFAENTGPCADSAAQVVRTYGIGVASTRQEIGNLDKHEEMEKQVAKFLGVESAMAFGMGFATNSMNIPALVGKGCLILSDELNHTSLVLGARLSGATIRVFKHNNMQCLEKLLSEAIIYGQPRTHRPWKKILIVVEGIYSMEGSIVRLPEVITLKKRYKAYLYLDEAHSIGALGHRGRGVVDYFDLDPRDVDVLMGTFTKSFGAAGGYIAGKRELIEYLRSHSHSAVYAASMSPPVVEQIITSMKCIMGDDGTSIGCKRLQQLAENTTYFRRRLREMGFIIYGNDDSPVIPMMLYMPAKIGAFGREMLKKNIGVVVVGFPATSLVESRARFCISAAHSKEILD 533          
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Medaka
Match: sptlc3 (serine palmitoyltransferase long chain base subunit 3 [Source:NCBI gene;Acc:101166657])

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 271/497 (54.53%), Postives = 355/497 (71.43%), Query Frame = 2
Query:  101 EQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHL-KTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLPVPDWCNNLPDQPDF 1588
            E FE AP   AV TY  + ++ L G  RDFLR    EK   A    +   FVPLYQD+E FYTRNLY R+RD WNRPICS+PG    L++R+S+D NWTF+   +T   VIN GSYNYLGFA+N       V + + +YG GV S RQE GN + H ELE+LVA F G ESA+ + MGFATNS+N+P LV K C ++SDELNHTSLILG RLSGA IR FKHN+M +LEK +++A+  G PRT R ++KIL++VEGIYSMEGS+V LP+++ LKKKY   +YLDEAHSIGA+G  G+GV + F++NP D+DV MGTFTKSFG+SGGYIAG K L++++R +SHS++Y + M     +QII ++  I GK    EGI++I+QL  N  YFRA L + GFI++GN DSPV+P+++  P K+ AF+RE L R IG VVVGFPAT I  ARARFC+SA+HT+ M++Q L+ ++EV  L+ + +SR   P    +L ++ DF
Sbjct:   50 ESFEQAPMYVAVCTYMGFGIVTLFGYFRDFLRAVGLEKCNLAQEREEQKDFVPLYQDFENFYTRNLYMRVRDNWNRPICSLPGPVFDLMERVSDDYNWTFRFTGRTIPNVINMGSYNYLGFAENNADFLKTVADKVQQYGAGVCSTRQEIGNLSIHEELEQLVANFLGVESAMTYGMGFATNSMNIPALVGKGCLILSDELNHTSLILGARLSGATIRVFKHNNMHSLEKMLKEAICCGQPRTHRAWRKILIMVEGIYSMEGSVVRLPEVIALKKKYKAHLYLDEAHSIGAVGATGRGVTELFHVNPADVDVMMGTFTKSFGASGGYIAGKKELVDYLRSHSHSAVYASAMSPPVTEQIIRAIKCIMGKDGTTEGIRRIRQLAENTRYFRARLKEMGFIIYGNDDSPVIPVLLYMPGKVVAFAREMLQRKIGVVVVGFPATPITEARARFCLSAAHTRAMLNQVLQHLNEVGDLLCLKFSRRKRPSSL-DLCEETDF 545          
BLAST of Serine palmitoyltransferase 2 vs. Planmine SMEST
Match: SMESG000011189.1 (SMESG000011189.1)

HSP 1 Score: 1060.06 bits (2740), Expect = 0.000e+0
Identity = 521/521 (100.00%), Postives = 521/521 (100.00%), Query Frame = 2
Query:   35 MNAKPHRNGYVVIKKTNEHIFFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLPVPDWCNNLPDQPDFTKI 1597
            MNAKPHRNGYVVIKKTNEHIFFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMGTFTKSFGSSGGYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLPVPDWCNNLPDQPDFTKI
Sbjct:    1 MNAKPHRNGYVVIKKTNEHIFFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMGTFTKSFGSSGGYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLPVPDWCNNLPDQPDFTKI 521          
BLAST of Serine palmitoyltransferase 2 vs. Planmine SMEST
Match: SMESG000016646.1 (SMESG000016646.1)

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 308/501 (61.48%), Postives = 392/501 (78.24%), Query Frame = 2
Query:   77 KTNEHIFFEQFEDAPYLHAVITYCCYIVLNLIGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLPVPDWCNNLPDQ 1579
            K  E  FFEQFE A   +++ITY  + +L  +G++RDF+R +  EKN  A    K   F PLY D+EAFYTRN+YRR+ DC N+PICS PG +++ ++R+S+D+NWTF+ L +TS + NFGSYNYLGFAQN G C D VE SI+++GL VGSPRQE GN   H ELE  +A F GQE+AIVFPMGFATN+LN+PILV+K CCVISDELNH SLILGIRLSGA  RRFKHN++ +LE+++ KA+  GH +T+R FKKILVVVEG+YSMEGSIV LP+I+ELKKKY F+IYLDEAHSIGALG  G+GV+DYFN+NP ++D+ MGTFTKSF SSGGYI+G + LI +VRE SHS+IYG  M    CQQI+++M+II GK  G+ G ++I+QL WN  YFRAALH+ G IVFGNK+SPV+P+I+ T  K+ AF REC+ RGIGTV+VG+PA  + LAR RFC+SA+HTK  +D TL ++DE++  +   YSRLPVPDWC N+P +
Sbjct:   16 KCKESEFFEQFEKASLFNSLITYLYFFILKCMGKLRDFMRNYGLEKNRLAVDSTKNKGFAPLYLDFEAFYTRNVYRRVCDCVNKPICSAPGGSLKAMNRVSDDHNWTFRILDSTSDIYNFGSYNYLGFAQNDGLCTDHVEKSINEFGLSVGSPRQEVGNTLYHLELEESLAEFLGQEAAIVFPMGFATNALNIPILVDKDCCVISDELNHVSLILGIRLSGADTRRFKHNNVESLERELIKAITEGHSKTKRKFKKILVVVEGVYSMEGSIVRLPEILELKKKYKFYIYLDEAHSIGALGKGGRGVVDYFNVNPHEVDIQMGTFTKSFASSGGYISGSRNLIHYVREKSHSTIYGGTMSGPICQQILSAMAIIGGKMGGSLGAERIRQLAWNTTYFRAALHRMGLIVFGNKNSPVIPVIVYTIPKVVAFHRECMRRGIGTVIVGYPACNLKLARIRFCISAAHTKRSLDYTLSIVDEIATHLRFKYSRLPVPDWCKNVPQR 516          
BLAST of Serine palmitoyltransferase 2 vs. Planmine SMEST
Match: SMESG000016646.1 (SMESG000016646.1)

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 295/470 (62.77%), Postives = 374/470 (79.57%), Query Frame = 2
Query:  170 IGRMRDFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPICSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININYSRLPVPDWCNNLPDQ 1579
            +G++RDF+R +  EKN  A    K   F PLY D+EAFYTRN+YRR+ DC N+PICS PG +++ ++R+S+D+NWTF+ L +TS + NFGSYNYLGFAQN G C D VE SI+++GL VGSPRQE GN   H ELE  +A F GQE+AIVFPMGFATN+LN+PILV+K CCVISDELNH SLILGIRLSGA  RRFKHN++ +LE+++ KA+  GH +T+R FKKILVVVEG+YSMEGSIV LP+I+ELKKKY F+IYLDEAHSIGALG  G+GV+DYFN+NP ++D+ MGTFTKSF SSGGYI+G + LI +VRE SHS+IYG  M    CQQI+++M+II GK  G+ G ++I+QL WN  YFRAALH+ G IVFGNK+SPV+P+I+ T  K+ AF REC+ RGIGTV+VG+PA  + LAR RFC+SA+HTK  +D TL ++DE++  +   YSRLPVPDWC N+P +
Sbjct:    1 MGKLRDFMRNYGLEKNRLAVDSTKNKGFAPLYLDFEAFYTRNVYRRVCDCVNKPICSAPGGSLKAMNRVSDDHNWTFRILDSTSDIYNFGSYNYLGFAQNDGLCTDHVEKSINEFGLSVGSPRQEVGNTLYHLELEESLAEFLGQEAAIVFPMGFATNALNIPILVDKDCCVISDELNHVSLILGIRLSGADTRRFKHNNVESLERELIKAITEGHSKTKRKFKKILVVVEGVYSMEGSIVRLPEILELKKKYKFYIYLDEAHSIGALGKGGRGVVDYFNVNPHEVDIQMGTFTKSFASSGGYISGSRNLIHYVREKSHSTIYGGTMSGPICQQILSAMAIIGGKMGGSLGAERIRQLAWNTTYFRAALHRMGLIVFGNKNSPVIPVIVYTIPKVVAFHRECMRRGIGTVIVGYPACNLKLARIRFCISAAHTKRSLDYTLSIVDEIATHLRFKYSRLPVPDWCKNVPQR 470          
BLAST of Serine palmitoyltransferase 2 vs. Planmine SMEST
Match: SMESG000052979.1 (SMESG000052979.1)

HSP 1 Score: 157.918 bits (398), Expect = 6.190e-42
Identity = 97/370 (26.22%), Postives = 195/370 (52.70%), Query Frame = 2
Query:  422 KVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXX-XXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKIKQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSRGIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALINI 1528
            +++NF + NYLG + +     +A  +++  +G G+ S R  CG    H  LE  +A F  +E++I++   F  N+     L+++   +ISDELNH S+I GIRL  A   R+K+ D+++L++ + +A         + ++  ++V +G++SM+G +  L  I+ L ++Y+   ++DE H+ G +G  G+G  +++N+    +D+   T      G+ GGY  G KR+++ +R+ S   ++   +P       I ++ +I   Q G      + +++ N   FR  +   GF + G+   P+ P+++      + F+ + L++GI  +   +P      AR R  +SA HT++ ID+ +    ++ + + +
Sbjct:   71 EILNFCANNYLGLSGHP-KIIEASISALKSHGAGLSSVRFICGTTDLHVNLEEKLAKFHNREASILYASCFDANAGIFEALLSQDDAIISDELNHASIIDGIRLCKAKKWRYKNGDINDLKRCLEEA---------KSYRLKMIVTDGVFSMDGKMAPLSDIISLSREYDCLTFIDECHATGFIGSTGRGSEEFWNLPVPCVDIINSTLGKAMGGTMGGYTTGSKRIVDMLRQKSRPYLFSNTLPPSVVAASIQALDLIMDDQDG-----LLDKIKANTQRFRTEMTNLGFNISGDSCHPICPVMLGDARLASQFAEKMLTKGIYVIGFSYPVVPKDKARIRVQISAVHTRQQIDKAILAFKQIGSDLKV 425          
BLAST of Serine palmitoyltransferase 2 vs. Planmine SMEST
Match: SMESG000080769.1 (SMESG000080769.1)

HSP 1 Score: 132.109 bits (331), Expect = 7.677e-33
Identity = 84/263 (31.94%), Postives = 136/263 (51.71%), Query Frame = 2
Query:  416 TSKVINFGSYNYLGFAQNTGACADAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGFATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDM----SNLEKQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNFFIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMXXXXXXXXXXXXYIAGDKRLIEFVRENSHSSIYGAPMPAV--CCQQIITSM 1186
            T  V+N  S+N+     N     +  + ++ KYG+G   PR   G    H +LE  +A F   E ++V+  GF+T +  +P    +   + +DE    ++  G+  S + I+ FKHNDM    S LE+Q  +A+   +P   R   +  +V+EG+Y   G I  LP+IVELK KY   I+LDE  S G LG HG+GV D+F ++  DID+  G+   +  + GG+  G K +++  R +     + A +P +  C   ++  M
Sbjct:  103 TKPVLNLASFNFFNLIGNE-KINETAQKALRKYGVGSCGPRGFYGTFDVHLKLEDEIANFMNCEESVVYSYGFSTVASAIPAYAKRGDVIFADEGVSFAIQCGLLASRSKIKYFKHNDMDHLVSLLEEQSEEAI--KNPAKAR-ITRTFIVIEGLYMNYGDICPLPKIVELKYKYKVRIFLDETLSFGVLGDHGRGVTDHFGVDVTDIDLITGSLETALATCGGFSVGSKYVVDHQRLSGQGYCFSASLPPLLACGASVVLEM 361          
The following BLAST results are available for this feature:
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPTLC20.000e+058.80serine palmitoyltransferase long chain base subuni... [more]
SPTLC30.000e+052.86serine palmitoyltransferase long chain base subuni... [more]
SPTLC25.323e-14859.56serine palmitoyltransferase long chain base subuni... [more]
SPTLC31.127e-4345.30serine palmitoyltransferase long chain base subuni... [more]
GCAT4.245e-4227.49glycine C-acetyltransferase [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptl-26.668e-16850.94Serine palmitoyltransferase 2 [Source:UniProtKB/S... [more]
sptl-21.845e-16750.94Serine palmitoyltransferase 2 [Source:UniProtKB/S... [more]
sptl-34.937e-14447.58Serine palmitoyltransferase 3 [Source:UniProtKB/S... [more]
sptl-34.937e-14447.58Serine palmitoyltransferase 3 [Source:UniProtKB/S... [more]
sptl-35.620e-14447.58Serine palmitoyltransferase 3 [Source:UniProtKB/S... [more]
back to top
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lace9.391e-15648.98gene:FBgn0002524 transcript:FBtr0343735[more]
lace9.391e-15648.98gene:FBgn0002524 transcript:FBtr0080738[more]
CG103615.938e-5129.06gene:FBgn0036208 transcript:FBtr0076084[more]
Spt-I8.073e-3627.82gene:FBgn0086532 transcript:FBtr0087731[more]
Spt-I8.073e-3627.82gene:FBgn0086532 transcript:FBtr0087729[more]
back to top
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptlc2b0.000e+060.33serine palmitoyltransferase, long chain base subun... [more]
sptlc2a0.000e+057.23serine palmitoyltransferase, long chain base subun... [more]
sptlc30.000e+055.67serine palmitoyltransferase, long chain base subun... [more]
sptlc30.000e+055.67serine palmitoyltransferase, long chain base subun... [more]
sptlc2a1.945e-5355.70serine palmitoyltransferase, long chain base subun... [more]
back to top
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr930.000e+059.34WD repeat domain 93 [Source:Xenbase;Acc:XB-GENE-64... [more]
wdr930.000e+059.63WD repeat domain 93 [Source:Xenbase;Acc:XB-GENE-64... [more]
wdr930.000e+059.63WD repeat domain 93 [Source:Xenbase;Acc:XB-GENE-64... [more]
wdr930.000e+059.63WD repeat domain 93 [Source:Xenbase;Acc:XB-GENE-64... [more]
wdr930.000e+059.63WD repeat domain 93 [Source:Xenbase;Acc:XB-GENE-64... [more]
back to top
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sptlc20.000e+059.42serine palmitoyltransferase, long chain base subun... [more]
Sptlc39.267e-16650.42serine palmitoyltransferase, long chain base subun... [more]
Sptlc39.267e-16650.42serine palmitoyltransferase, long chain base subun... [more]
Gcat3.397e-4328.53glycine C-acetyltransferase (2-amino-3-ketobutyrat... [more]
Gcat5.811e-3728.09glycine C-acetyltransferase (2-amino-3-ketobutyrat... [more]
back to top
BLAST of Serine palmitoyltransferase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3B7D2|SPTC2_RAT0.000e+058.63Serine palmitoyltransferase 2 OS=Rattus norvegicus... [more]
sp|P97363|SPTC2_MOUSE0.000e+059.42Serine palmitoyltransferase 2 OS=Mus musculus OX=1... [more]
sp|O54694|SPTC2_CRIGR0.000e+059.01Serine palmitoyltransferase 2 OS=Cricetulus griseu... [more]
sp|O15270|SPTC2_HUMAN0.000e+058.80Serine palmitoyltransferase 2 OS=Homo sapiens OX=9... [more]
sp|Q9NUV7|SPTC3_HUMAN0.000e+052.86Serine palmitoyltransferase 3 OS=Homo sapiens OX=9... [more]
back to top
BLAST of Serine palmitoyltransferase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068XW600.000e+062.70Serine palmitoyltransferase long chain base OS=Ech... [more]
A0A564Y7560.000e+063.47Aminotran_1_2 domain-containing protein OS=Hymenol... [more]
A0A068X1160.000e+061.89Serine palmitoyltransferase long chain base OS=Ech... [more]
A0A4Z2DW010.000e+059.35Serine palmitoyltransferase 2 OS=Schistosoma japon... [more]
A0A5J4P3Y80.000e+059.15Serine palmitoyltransferase OS=Paragonimus westerm... [more]
back to top
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptlc2a0.000e+058.25serine palmitoyltransferase, long chain base subun... [more]
sptlc2a0.000e+058.25serine palmitoyltransferase, long chain base subun... [more]
sptlc2a0.000e+058.25serine palmitoyltransferase, long chain base subun... [more]
gcat7.268e-3928.06glycine C-acetyltransferase [Source:NCBI gene;Acc:... [more]
sptlc11.197e-3734.75serine palmitoyltransferase, long chain base subun... [more]
back to top
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sptlc2a0.000e+056.64serine palmitoyltransferase, long chain base subun... [more]
sptlc15.317e-3029.32serine palmitoyltransferase, long chain base subun... [more]
alas23.519e-2828.38aminolevulinate, delta-, synthase 2 [Source:NCBI g... [more]
back to top
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
LCB21.620e-14345.88Component of serine palmitoyltransferase; responsi... [more]
HEM16.466e-3328.855-aminolevulinate synthase; catalyzes the first st... [more]
LCB11.626e-2626.95Component of serine palmitoyltransferase; responsi... [more]
back to top
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO429900.000e+056.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272201.558e-5231.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384905.675e-4629.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462062.712e-2827.015-aminolevulinate synthase [Source:UniProtKB/TrEM... [more]
EDO360823.106e-2628.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine palmitoyltransferase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptlc2b0.000e+058.62serine palmitoyltransferase 2 [Source:NCBI gene;Ac... [more]
ENSORLT00000042858.10.000e+057.14serine palmitoyltransferase 2-like [Source:NCBI ge... [more]
ENSORLT00000022091.20.000e+057.14serine palmitoyltransferase 2-like [Source:NCBI ge... [more]
ENSORLT00000013273.20.000e+057.97serine palmitoyltransferase 2-like [Source:NCBI ge... [more]
sptlc30.000e+054.53serine palmitoyltransferase long chain base subuni... [more]
back to top
BLAST of Serine palmitoyltransferase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011189.10.000e+0100.00SMESG000011189.1[more]
SMESG000016646.10.000e+061.48SMESG000016646.1[more]
SMESG000016646.10.000e+062.77SMESG000016646.1[more]
SMESG000052979.16.190e-4226.22SMESG000052979.1[more]
SMESG000080769.17.677e-3331.94SMESG000080769.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026527 ID=SMED30026527|Name=Serine palmitoyltransferase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2010bp
ATCTATATAAATCTTATATGATAAGAAGTTACCCATGAATGCCAAGCCTC
ATCGTAATGGGTACGTTGTGATTAAAAAAACAAACGAACATATCTTCTTT
GAACAATTCGAAGATGCTCCTTATCTCCATGCTGTGATAACGTATTGCTG
CTACATAGTTTTGAATTTAATTGGAAGAATGAGAGATTTTCTTCGTCGTT
GGAATTTCGAAAAAAACTATGCCGCTACAGCTCCTTTGAAAACCAGCAGT
TTCGTACCGTTGTATCAAGATTACGAAGCATTCTACACTAGAAATCTTTA
TCGACGAATTCGAGATTGTTGGAATAGGCCTATTTGTAGCGTTCCTGGTG
CGACAATGCAGTTAGTTGATCGAATATCCGAAGATAACAACTGGACATTT
AAACACCTCAAAACTACGAGTAAAGTGATAAATTTCGGTTCTTATAATTA
TTTGGGATTTGCACAAAATACTGGAGCATGTGCCGATGCAGTTGAGAATT
CGATTTCTAAATACGGTCTTGGTGTAGGATCTCCCAGACAGGAATGCGGC
AATCACACGTCACATACGGAATTAGAACGACTAGTGGCCACTTTTACTGG
TCAAGAATCAGCAATTGTTTTTCCAATGGGATTTGCTACAAATTCTTTAA
ACTTGCCAATTTTAGTTAACAAACAATGCTGTGTCATCAGTGATGAATTG
AACCACACGAGTCTCATTCTAGGAATTCGGTTATCCGGTGCCCATATCAG
AAGGTTCAAACACAACGACATGAGTAATTTAGAAAAACAAATAAGAAAAG
CTGTGATATTTGGCCACCCAAGAACACGCCGTCCTTTTAAAAAAATACTT
GTTGTGGTTGAAGGAATATATAGCATGGAAGGAAGTATCGTGCATTTACC
TCAAATTGTAGAATTGAAAAAGAAATATAATTTTTTTATTTATCTCGATG
AGGCTCATAGTATTGGTGCTCTTGGTCCACACGGCAAAGGGGTGATAGAC
TATTTTAATATCAACCCTAAAGATATCGATGTCGCTATGGGAACATTTAC
TAAAAGTTTCGGATCGTCTGGGGGGTATATTGCTGGAGACAAAAGACTAA
TAGAATTCGTTCGTGAAAACTCACACAGCTCCATTTACGGAGCACCAATG
CCAGCCGTTTGTTGTCAGCAAATCATTACATCTATGAGTATTATTGAAGG
AAAACAATGTGGAAATGAGGGAATAAAAAAAATCAAACAACTCGAATGGA
ATGTTCACTATTTTAGAGCAGCTCTTCATAAAAAAGGATTTATAGTTTTT
GGGAACAAAGACAGTCCTGTTGTGCCTTTAATCATTTGCACTCCGACCAA
ATTAGCCGCATTTTCTCGGGAATGTCTCAGTCGAGGAATCGGAACGGTTG
TTGTTGGATTTCCAGCGACAACCATTATTCTAGCTCGAGCAAGATTTTGC
GTGAGCGCCTCACATACCAAGGAAATGATAGATCAAACACTAAAAGTCAT
AGATGAGGTGTCAGCCTTGATCAACATCAATTACAGTCGTCTTCCAGTGC
CGGATTGGTGTAACAATTTGCCTGACCAACCGGATTTCACAAAAATTTGA
TATTGGTCGTGTCCATACTGCTACGCATATATTTGTATACATATATCAAC
GTAGTTACTCTCATTCATCAATTAGTGAATTCCTACTTTCCGCATATTTT
GCAAAAATATTCTTTAATTCCAACCTTTCATTCCCTGGAATCATAAATGA
CATCAAGAATGACTGATGGCATTGTATGATGTTTCTTACTTGGCCTGTGT
TACAGATTATTAACTTGTGATTTTTTTTTAGTATTTACGAAGCAGACTTA
TGATAAACCTATTTCTGACTCTGGTTTTGTTTTAAGGATTAATTTTTTTA
TATTTTTTATTAATTAACTTCCGATTGATTCTGAGTTTTTATGAAGGTTT
TGGAAACAATGTAAATCATATTTGTACAATTTTTGATAAACAATGAAAAT
TAGCCTTTTA
back to top

protein sequence of SMED30026527-orf-1

>SMED30026527-orf-1 ID=SMED30026527-orf-1|Name=SMED30026527-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=522bp
MNAKPHRNGYVVIKKTNEHIFFEQFEDAPYLHAVITYCCYIVLNLIGRMR
DFLRRWNFEKNYAATAPLKTSSFVPLYQDYEAFYTRNLYRRIRDCWNRPI
CSVPGATMQLVDRISEDNNWTFKHLKTTSKVINFGSYNYLGFAQNTGACA
DAVENSISKYGLGVGSPRQECGNHTSHTELERLVATFTGQESAIVFPMGF
ATNSLNLPILVNKQCCVISDELNHTSLILGIRLSGAHIRRFKHNDMSNLE
KQIRKAVIFGHPRTRRPFKKILVVVEGIYSMEGSIVHLPQIVELKKKYNF
FIYLDEAHSIGALGPHGKGVIDYFNINPKDIDVAMGTFTKSFGSSGGYIA
GDKRLIEFVRENSHSSIYGAPMPAVCCQQIITSMSIIEGKQCGNEGIKKI
KQLEWNVHYFRAALHKKGFIVFGNKDSPVVPLIICTPTKLAAFSRECLSR
GIGTVVVGFPATTIILARARFCVSASHTKEMIDQTLKVIDEVSALININY
SRLPVPDWCNNLPDQPDFTKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR004839Aminotransferase_I/II
IPR015421PyrdxlP-dep_Trfase_major
IPR015422PyrdxlP-dep_Trfase_dom1
IPR001917Aminotrans_II_pyridoxalP_BS
IPR015424PyrdxlP-dep_Trfase
Vocabulary: molecular function
TermDefinition
GO:0030170pyridoxal phosphate binding
GO:0003824catalytic activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0009058biosynthetic process
GO:0008152metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015421Pyridoxal phosphate-dependent transferase, major domainGENE3DG3DSA:3.40.640.10coord: 150..401
e-value: 6.2E-114
score: 382.3
IPR015422Pyridoxal phosphate-dependent transferase domain 1GENE3DG3DSA:3.90.1150.10coord: 134..493
e-value: 6.2E-114
score: 382.3
IPR004839Aminotransferase, class I/classIIPFAMPF00155Aminotran_1_2coord: 135..493
e-value: 3.3E-55
score: 187.7
NoneNo IPR availablePANTHERPTHR13693CLASS II AMINOTRANSFERASE/8-AMINO-7-OXONONANOATE SYNTHASEcoord: 19..508
NoneNo IPR availablePANTHERPTHR13693:SF83SERINE PALMITOYLTRANSFERASE, LONG CHAIN BASE SUBUNIT 2Bcoord: 19..508
NoneNo IPR availableCDDcd06454KBL_likecoord: 134..497
e-value: 5.77161E-156
score: 446.622
IPR001917Aminotransferase, class-II, pyridoxal-phosphate binding sitePROSITEPS00599AA_TRANSFER_CLASS_2coord: 342..351
IPR015424Pyridoxal phosphate-dependent transferaseSUPERFAMILYSSF53383PLP-dependent transferasescoord: 81..497